Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= K07F5_11
         (873 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17542094|ref|NP_501768.1| Sperm-Specific family, class Q SSQ-...   229   8e-59
gi|17542096|ref|NP_500698.1| Sperm-Specific family, class Q SSQ-...   203   5e-51
gi|39590625|emb|CAE64995.1| Hypothetical protein CBG09831 [Caeno...   199   9e-50
gi|25153045|ref|NP_500704.2| Sperm-Specific family, class Q SSQ-...   180   3e-44
gi|7510796|pir||T27609 hypothetical protein ZC477.1 - Caenorhabd...   172   7e-42
gi|17542098|ref|NP_501113.1| Sperm-Specific family, class Q SSQ-...   161   2e-38
gi|7508703|pir||T29173 hypothetical protein T28H11.1 - Caenorhab...   160   4e-38
gi|39582977|emb|CAE73042.1| Hypothetical protein CBG20412 [Caeno...   155   1e-36
gi|7510803|pir||T27610 hypothetical protein ZC477.8 - Caenorhabd...   150   4e-35
gi|37546113|ref|XP_063123.4| similar to hypothetical protein ZC4...    69   1e-10
gi|50757291|ref|XP_425328.1| PREDICTED: similar to hypothetical ...    64   6e-09
gi|15233976|ref|NP_193602.1| leucine-rich repeat family protein ...    62   2e-08
gi|16508143|gb|AAL17912.1| intestinal mucin [Mamestra configurata]     57   5e-07
gi|47214197|emb|CAG00825.1| unnamed protein product [Tetraodon n...    56   9e-07
gi|39581821|emb|CAE60714.1| Hypothetical protein CBG04382 [Caeno...    55   2e-06
gi|1362097|pir||S55925 probable arabinogalactan protein precurso...    55   2e-06
gi|10945615|gb|AAG24616.1| arabinogalactan protein [Nicotiana al...    55   2e-06
gi|39594960|emb|CAE70828.1| Hypothetical protein CBG17606 [Caeno...    54   4e-06
gi|206712|gb|AAA42064.1| salivary proline-rich protein                 53   1e-05
gi|34858521|ref|XP_347055.1| hypothetical protein XP_347054 [Rat...    53   1e-05
gi|48833153|ref|ZP_00290176.1| COG2931: RTX toxins and related C...    52   2e-05
gi|31559809|ref|NP_853522.1| polycystic kidney disease 1 like 3;...    51   3e-05
gi|8515090|gb|AAF75821.1| putative arabinogalactan protein [Pinu...    51   4e-05
gi|22122459|ref|NP_666112.1| RIKEN cDNA D030060M11 [Mus musculus...    50   5e-05
gi|26331972|dbj|BAC29716.1| unnamed protein product [Mus musculus]     50   5e-05
gi|41408851|ref|NP_961687.1| hypothetical protein MAP2753 [Mycob...    50   6e-05
gi|19115358|ref|NP_594446.1| hypothetical protein; extensin-like...    50   6e-05
gi|31199059|ref|XP_308477.1| ENSANGP00000017902 [Anopheles gambi...    50   8e-05
gi|11994733|dbj|BAB03062.1| unnamed protein product [Arabidopsis...    50   8e-05
gi|46226509|gb|EAK87503.1| large low complexity protein with cry...    49   1e-04
gi|30984464|ref|NP_851896.1| very large tegument protein [Cercop...    49   1e-04
gi|24657713|ref|NP_729000.1| CG32241-PA [Drosophila melanogaster...    49   1e-04
gi|46314129|ref|ZP_00214716.1| hypothetical protein Bcepa0200395...    49   1e-04
gi|38260665|gb|AAR15480.1| pollen coat oleosin-glycine rich prot...    49   1e-04
gi|50769227|ref|XP_423081.1| PREDICTED: similar to Proline-rich ...    49   1e-04
gi|23483516|gb|EAA19160.1| Drosophila melanogaster CG5228 gene p...    49   1e-04
gi|9629838|ref|NP_045322.1| very large virion protein (tegument)...    49   2e-04
gi|2224921|gb|AAC47557.1| insect intestinal mucin IIM22 [Trichop...    49   2e-04
gi|2224919|gb|AAC47556.1| insect intestinal mucin IIM14 [Trichop...    49   2e-04
gi|42781548|ref|NP_978795.1| conserved hypothetical protein [Bac...    49   2e-04
gi|37533178|ref|NP_920891.1| hypothetical protein [Oryza sativa ...    49   2e-04
gi|42528194|ref|NP_973292.1| conserved hypothetical protein [Tre...    49   2e-04
gi|48768314|ref|ZP_00272664.1| hypothetical protein Reut02004453...    48   2e-04
gi|39933290|ref|NP_945566.1| possible OmpA family member [Rhodop...    48   3e-04
gi|41720152|ref|ZP_00148991.1| COG0513: Superfamily II DNA and R...    48   3e-04
gi|50257281|gb|EAL19990.1| hypothetical protein CNBF3170 [Crypto...    48   3e-04
gi|28829337|gb|AAO51879.1| similar to F53F10.5.p [Caenorhabditis...    48   3e-04
gi|39580893|emb|CAE73891.1| Hypothetical protein CBG21491 [Caeno...    48   3e-04
gi|23577891|ref|NP_703081.1| unknown [Rachiplusia ou multiple nu...    47   4e-04
gi|31414574|dbj|BAC58076.2| large tegument protein [Cercopitheci...    47   4e-04
gi|9627834|ref|NP_054121.1| AcOrf-91 peptide [Autographa califor...    47   4e-04
gi|15240814|ref|NP_196371.1| glycine-rich protein (GRP16) [Arabi...    47   4e-04
gi|31242307|ref|XP_321584.1| ENSANGP00000011587 [Anopheles gambi...    47   4e-04
gi|15081222|gb|AAK83834.1| glycine-rich protein GRP16 [Arabidops...    47   5e-04
gi|42657138|ref|XP_376322.1| similar to hypothetical protein [Ho...    47   5e-04
gi|38260645|gb|AAR15461.1| pollen coat oleosin-glycine rich prot...    47   5e-04
gi|47551349|ref|NP_999876.1| hypothetical LOC401137 [Homo sapien...    47   5e-04
gi|15081215|gb|AAK83828.1| glycine-rich protein GRP16 [Arabidops...    47   5e-04
gi|50550621|ref|XP_502783.1| hypothetical protein [Yarrowia lipo...    47   7e-04
gi|24650758|ref|NP_651599.1| CG5514-PB [Drosophila melanogaster]...    47   7e-04
gi|34013877|gb|AAQ56103.1| pollen specific glycine-rich protein ...    47   7e-04
gi|13487281|gb|AAK27473.1| polyketide synthase; SvKS [Streptomyc...    47   7e-04
gi|24650760|ref|NP_733240.1| CG5514-PA [Drosophila melanogaster]...    47   7e-04
gi|47606845|gb|AAT36347.1| flagelliform silk protein-1 [Araneus ...    47   7e-04
gi|17545162|ref|NP_518564.1| PROBABLE GLYCIN-RICH SIGNAL PEPTIDE...    47   7e-04
gi|49103827|ref|XP_411190.1| hypothetical protein AN7053.2 [Aspe...    47   7e-04
gi|21428840|gb|AAM50139.1| GH07623p [Drosophila melanogaster]          47   7e-04
gi|10956657|ref|NP_066793.1| transfer gene complex protein-like ...    47   7e-04
gi|9453857|dbj|BAB03281.1| EBNA-1 [Cynomolgus Epstein-Barr Virus...    46   0.001
gi|1076237|pir||S52994 arabinogalactan-like protein - loblolly p...    46   0.001
gi|39594634|emb|CAE72212.1| Hypothetical protein CBG19323 [Caeno...    46   0.001
gi|42415488|ref|NP_963859.1| hypothetical gene supported by BC03...    46   0.001
gi|11278205|pir||T45462 membrane glycoprotein [imported] - equin...    46   0.001
gi|26341694|dbj|BAC34509.1| unnamed protein product [Mus musculus]     46   0.001
gi|9453859|dbj|BAB03282.1| EBNA-1 [Cynomolgus Epstein-Barr Virus...    46   0.001
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n...    46   0.001
gi|50550619|ref|XP_502782.1| hypothetical protein [Yarrowia lipo...    46   0.001
gi|34863324|ref|XP_238540.2| similar to RIKEN cDNA D030060M11 [R...    46   0.001
gi|32455965|ref|NP_862423.1| proline-rich extensin-like protein ...    46   0.001
gi|4557441|ref|NP_000067.1| cyclin-dependent kinase inhibitor 1C...    46   0.001
gi|30983559|gb|AAN85822.1| exosporium protein [Bacillus cereus] ...    46   0.001
gi|992946|dbj|BAA11015.1| p57KIP2 [Homo sapiens]                       46   0.001
gi|50550763|ref|XP_502854.1| hypothetical protein [Yarrowia lipo...    45   0.002
gi|18030050|gb|AAL56589.1| DifE protein [Myxococcus xanthus]           45   0.002
gi|46124935|ref|XP_387021.1| hypothetical protein FG06845.1 [Gib...    45   0.002
gi|42570779|ref|NP_973463.1| arabinogalactan-protein (AGP9) [Ara...    45   0.002
gi|15088808|gb|AAC27632.2| defective in fruiting DifE [Myxococcu...    45   0.002
gi|15226024|ref|NP_179095.1| arabinogalactan-protein (AGP9) [Ara...    45   0.002
gi|13265426|gb|AAG40020.2| At2g14890 [Arabidopsis thaliana]            45   0.002
gi|21105301|gb|AAM34600.1| precollagen-P [Mytilus galloprovincia...    45   0.002
gi|39936209|ref|NP_948485.1| conserved hypothetical protein [Rho...    45   0.002
gi|39935988|ref|NP_948264.1| conserved hypothetical protein [Rho...    45   0.002
gi|38091566|ref|XP_137519.4| similar to KIAA0754 protein [Mus mu...    45   0.002
gi|15228218|ref|NP_188267.1| jacalin lectin family protein [Arab...    45   0.002
gi|25029210|ref|NP_739264.1| hypothetical protein [Corynebacteri...    45   0.002
gi|15081245|gb|AAK83847.1| glycine-rich protein GRP16 [Arabidops...    45   0.002
gi|48733470|ref|ZP_00267213.1| hypothetical protein Pflu02001536...    45   0.002
gi|32411091|ref|XP_326026.1| hypothetical protein [Neurospora cr...    45   0.002
gi|50303721|ref|XP_451805.1| unnamed protein product [Kluyveromy...    45   0.002
gi|42572457|ref|NP_974324.1| jacalin lectin family protein [Arab...    45   0.002
gi|5139695|dbj|BAA81686.1| expressed in cucumber hypocotyls [Cuc...    45   0.002
gi|15842940|ref|NP_337977.1| PE_PGRS family protein [Mycobacteri...    33   0.003
gi|45551450|ref|NP_727593.3| CG32656-PA [Drosophila melanogaster...    45   0.003
gi|19528481|gb|AAL90355.1| RE32881p [Drosophila melanogaster]          45   0.003
gi|49093892|ref|XP_408407.1| hypothetical protein AN4270.2 [Aspe...    45   0.003
gi|50754031|ref|XP_414224.1| PREDICTED: similar to Telomeric rep...    45   0.003
gi|31205057|ref|XP_311477.1| ENSANGP00000024130 [Anopheles gambi...    45   0.003
gi|11360318|pir||T43481 probable mucin DKFZp434C196.1 - human (f...    45   0.003
gi|112205|pir||B39066 proline-rich protein 15 - rat                    45   0.003
gi|32407921|ref|XP_324453.1| predicted protein [Neurospora crass...    45   0.003
gi|46249562|gb|AAH68789.1| Unknown (protein for MGC:81339) [Xeno...    45   0.003
gi|15610481|ref|NP_217862.1| PE_PGRS [Mycobacterium tuberculosis...    33   0.003
gi|17221102|gb|AAK61478.1| glycoprotein gp2 [Equine herpesvirus 1]     44   0.004
gi|17221104|gb|AAK61479.1| glycoprotein gp2 [Equine herpesvirus 1]     44   0.004
gi|11278206|pir||T45463 membrane glycoprotein [imported] - equin...    44   0.004
gi|17221108|gb|AAK61481.1| glycoprotein gp2 [Equine herpesvirus 1]     44   0.004
gi|17221110|gb|AAK61482.1| glycoprotein gp2 [Equine herpesvirus 1]     44   0.004
gi|17221100|gb|AAK61477.1| glycoprotein gp2 [Equine herpesvirus 1]     44   0.004
gi|34894166|ref|NP_908408.1| P0439B06.4 [Oryza sativa (japonica ...    44   0.005
gi|15609219|ref|NP_216598.1| hypothetical protein Rv2082 [Mycoba...    44   0.005
gi|42572805|ref|NP_974499.1| expressed protein [Arabidopsis thal...    44   0.005
gi|31793265|ref|NP_855758.1| CONSERVED HYPOTHETICAL PROTEIN [Myc...    44   0.005
gi|17939907|emb|CAD19511.1| UL36 protein [Suid herpesvirus 1 str...    44   0.005
gi|48767201|ref|ZP_00271561.1| COG1530: Ribonucleases G and E [R...    44   0.005
gi|81628|pir||S19932 glycine-rich protein atGRP-6 - Arabidopsis ...    44   0.005
gi|27379673|ref|NP_771202.1| blr4562 [Bradyrhizobium japonicum U...    44   0.005
gi|9626871|ref|NP_041141.1| ORF 50 [Ictalurid herpesvirus 1] >gn...    44   0.005
gi|31227643|ref|XP_317919.1| ENSANGP00000019943 [Anopheles gambi...    44   0.005
gi|39586348|emb|CAE74005.1| Hypothetical protein CBG21646 [Caeno...    44   0.005
gi|50253342|dbj|BAD29609.1| hypothetical protein [Oryza sativa (...    44   0.005
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur...    44   0.006
gi|40556023|ref|NP_955108.1| CNPV085 putative RNA phosphatase [C...    44   0.006
gi|30022604|ref|NP_834235.1| hypothetical Membrane Spanning Prot...    44   0.006
gi|39580550|emb|CAE74682.1| Hypothetical protein CBG22492 [Caeno...    44   0.006
gi|22972947|ref|ZP_00019797.1| hypothetical protein [Chloroflexu...    44   0.006
gi|45508500|ref|ZP_00160838.1| COG1716: FOG: FHA domain [Anabaen...    44   0.006
gi|32414167|ref|XP_327563.1| hypothetical protein [Neurospora cr...    44   0.006
gi|46202785|ref|ZP_00208657.1| COG0542: ATPases with chaperone a...    44   0.006
gi|46250342|gb|AAH68851.1| MGC81512 protein [Xenopus laevis]           44   0.006
gi|39594636|emb|CAE72214.1| Hypothetical protein CBG19325 [Caeno...    44   0.006
gi|20514774|ref|NP_620610.1| putative cell surface antigen [Ratt...    43   0.008
gi|30140331|emb|CAD89603.1| putative arabinagalactan protein [Lo...    43   0.008
gi|21542298|sp|Q9PU53|TRF2_CHICK Telomeric repeat binding factor...    43   0.008
gi|5918158|emb|CAB56220.1| TTAGGG-repeat binding factor 2 TRF2 [...    43   0.008
gi|50254545|gb|EAL17294.1| hypothetical protein CNBN1210 [Crypto...    43   0.008
gi|46134297|ref|XP_389464.1| hypothetical protein FG09288.1 [Gib...    43   0.008
gi|50427403|ref|XP_462314.1| unnamed protein product [Debaryomyc...    43   0.008
gi|48094888|ref|XP_394291.1| similar to ENSANGP00000000887 [Apis...    43   0.008
gi|31240619|ref|XP_320723.1| ENSANGP00000020175 [Anopheles gambi...    43   0.008
gi|47565164|ref|ZP_00236207.1| VrrB [Bacillus cereus G9241] >gnl...    43   0.008
gi|38234682|ref|NP_940449.1| Putative conserved membrane protein...    43   0.010
gi|34531631|dbj|BAC86188.1| unnamed protein product [Homo sapiens]     43   0.010
gi|4877929|gb|AAD31496.1| serum opacity factor precursor [Strept...    43   0.010
gi|48837010|ref|ZP_00294005.1| COG0515: Serine/threonine protein...    43   0.010
gi|49250379|gb|AAH74710.1| Unknown (protein for MGC:69268) [Xeno...    43   0.010
gi|21105299|gb|AAM34599.1| precollagen-NG [Mytilus galloprovinci...    43   0.010
gi|15081243|gb|AAK83846.1| glycine-rich protein GRP16 [Arabidops...    43   0.010
gi|34785899|gb|AAH57737.1| MGC68961 protein [Xenopus laevis]           43   0.010
gi|38345958|emb|CAE04352.2| OSJNBb0038F03.16 [Oryza sativa (japo...    43   0.010
gi|7446482|pir||S71558 probable cell wall-plasma membrane linker...    43   0.010
gi|26991984|ref|NP_747409.1| ferric siderophore transport system...    43   0.010
gi|806720|gb|AAA66362.1| arabinogalactan-protein precursor             43   0.010
gi|15228479|ref|NP_189520.1| glycine-rich protein [Arabidopsis t...    43   0.010
gi|27375632|ref|NP_767161.1| blr0521 [Bradyrhizobium japonicum U...    42   0.014
gi|15078872|ref|NP_149622.1| 159L [Invertebrate iridescent virus...    42   0.014
gi|42795202|gb|AAS45959.1| envelope glycoprotein [Equine herpesv...    42   0.014
gi|23500119|ref|NP_699559.1| trbL protein [Brucella suis 1330] >...    42   0.014
gi|30984298|gb|AAP42650.1| exosporium protein H [Bacillus cereus]      42   0.014
gi|46365738|ref|ZP_00228178.1| COG0642: Signal transduction hist...    42   0.014
gi|71400|pir||SKXLAG dermal gland protein APEG precursor - Afric...    42   0.014
gi|731172|sp|P17437|XP2_XENLA Skin secretory protein xP2 precurs...    42   0.014
gi|14595286|gb|AAK70858.1| TonB [Pseudomonas putida]                   42   0.014
gi|17221112|gb|AAK61483.1| glycoprotein gp2 [Equine herpesvirus 1]     42   0.014
gi|11990219|emb|CAC19557.1| hypothetical protein [Cryptosporidiu...    42   0.014
gi|15242165|ref|NP_196996.1| gibberellin-regulated family protei...    42   0.014
gi|21592790|gb|AAM64739.1| unknown [Arabidopsis thaliana]              42   0.014
gi|17221106|gb|AAK61480.1| glycoprotein gp2 [Equine herpesvirus 1]     42   0.014
gi|23015821|ref|ZP_00055587.1| hypothetical protein Magn0210257 ...    42   0.014
gi|34859306|ref|XP_341933.1| similar to Snf2-related CBP activat...    42   0.014
gi|48833629|ref|ZP_00290647.1| COG2274: ABC-type bacteriocin/lan...    42   0.014
gi|38260627|gb|AAR15444.1| pollen coat oleosin-glycine rich prot...    42   0.018
gi|21221717|ref|NP_627496.1| putative large glycine/alanine rich...    42   0.018
gi|50553536|ref|XP_504179.1| hypothetical protein [Yarrowia lipo...    42   0.018
gi|48837302|ref|ZP_00294297.1| COG0515: Serine/threonine protein...    42   0.018
gi|17221114|gb|AAK61484.1| glycoprotein gp2 [Equine herpesvirus 1]     42   0.018
gi|24646197|ref|NP_731673.1| CG4795-PA [Drosophila melanogaster]...    42   0.018
gi|49479306|ref|YP_036570.1| possible exosporium protein H [Baci...    42   0.018
gi|17221116|gb|AAK61485.1| glycoprotein gp2 [Equine herpesvirus 1]     42   0.018
gi|38112111|gb|EAA57577.1| predicted protein [Magnaporthe grisea...    42   0.018
gi|32455964|ref|NP_862422.1| putative minor silk ampullate prote...    42   0.018
gi|46363288|ref|ZP_00226055.1| COG3391: Uncharacterized conserve...    42   0.018
gi|2497730|sp|Q49538|VLPF_MYCHR Variant surface antigen F precur...    42   0.018
gi|50405487|ref|XP_456379.1| unnamed protein product [Debaryomyc...    42   0.018
gi|46109412|ref|XP_381764.1| hypothetical protein FG01588.1 [Gib...    42   0.018
gi|16764015|ref|NP_459630.1| minor lipoprotein [Salmonella typhi...    42   0.018
gi|15611022|ref|NP_218403.1| hypothetical protein Rv3886c [Mycob...    42   0.018
gi|423789|pir||A47283 calphotin - fruit fly (Drosophila melanoga...    42   0.018
gi|41053079|dbj|BAD08023.1| Fibroin heavy chain precursor-like p...    42   0.018
gi|30020513|ref|NP_832144.1| hypothetical protein [Bacillus cere...    42   0.018
gi|24646199|ref|NP_731674.1| CG4795-PB [Drosophila melanogaster]...    42   0.018
gi|16182657|gb|AAL13544.1| GH08002p [Drosophila melanogaster]          42   0.018
gi|45512487|ref|ZP_00164053.1| COG2812: DNA polymerase III, gamm...    42   0.018
gi|50313312|ref|YP_053115.1| membrane glycoprotein [Equine herpe...    42   0.018
gi|50554683|ref|XP_504750.1| hypothetical protein [Yarrowia lipo...    42   0.023
gi|39597010|emb|CAE59237.1| Hypothetical protein CBG02561 [Caeno...    42   0.023
gi|15610345|ref|NP_217725.1| hypothetical protein Rv3209 [Mycoba...    42   0.023
gi|34894174|ref|NP_908412.1| putative protein kinase [Oryza sati...    42   0.023
gi|33114628|gb|AAP94887.1| MFP3 [Ascaris suum]                         42   0.023
gi|559557|gb|AAA51649.1| arabinogalactan-protein                       42   0.023
gi|41206813|ref|XP_373730.1| hypothetical protein XP_378673 [Hom...    42   0.023
gi|46324162|ref|ZP_00224524.1| COG0296: 1,4-alpha-glucan branchi...    42   0.023
gi|49076038|ref|XP_402037.1| hypothetical protein UM04422.1 [Ust...    42   0.023
gi|9625624|ref|NP_039875.1| nuclear antigen EBNA1 [Human herpesv...    42   0.023
gi|15842796|ref|NP_337833.1| hypothetical protein [Mycobacterium...    42   0.023
gi|27379973|ref|NP_771502.1| bll4862 [Bradyrhizobium japonicum U...    42   0.023
gi|41407911|ref|NP_960747.1| hypothetical protein MAP1813c [Myco...    42   0.023
gi|28872238|ref|NP_794857.1| conserved hypothetical protein [Pse...    42   0.023
gi|24641567|ref|NP_572812.2| CG32654-PC [Drosophila melanogaster...    42   0.023
gi|50754315|ref|XP_414326.1| PREDICTED: similar to mKIAA1760 pro...    41   0.030
gi|33944943|ref|XP_340619.1| hypothetical protein Tb927.2.5200 [...    41   0.030
gi|29566642|ref|NP_818208.1| gp135 [Mycobacteriophage Bxz1] >gnl...    41   0.030
gi|5730067|ref|NP_006653.1| Snf2-related CBP activator protein [...    41   0.030
gi|13431956|sp|O08816|WASL_RAT Neural Wiskott-Aldrich syndrome p...    41   0.030
gi|34394274|dbj|BAC84754.1| mucin-like protein [Oryza sativa (ja...    41   0.030
gi|34532953|dbj|BAC86558.1| unnamed protein product [Homo sapiens]     41   0.030
gi|50548483|ref|XP_501711.1| hypothetical protein [Yarrowia lipo...    41   0.030
gi|25404769|pir||H96711 hypothetical protein F14K14.17 [imported...    41   0.030
gi|21229984|ref|NP_635901.1| conserved hypothetical protein [Xan...    41   0.030
gi|41203927|ref|XP_372536.1| similar to chloride intracellular c...    41   0.030
gi|21230133|ref|NP_636050.1| outer membrane protein [Xanthomonas...    41   0.030
gi|50253344|dbj|BAD29611.1| hypothetical protein [Oryza sativa (...    41   0.030
gi|34327954|dbj|BAA20768.2| KIAA0309 [Homo sapiens]                    41   0.030
gi|22330504|ref|NP_177041.2| arabinogalactan-protein, putative (...    41   0.030
gi|34535199|dbj|BAC87237.1| unnamed protein product [Homo sapiens]     41   0.030
gi|48832072|ref|ZP_00289116.1| COG0810: Periplasmic protein TonB...    41   0.030
gi|25518689|pir||G86292 hypothetical protein F7H2.17 [imported] ...    41   0.039
gi|28868581|ref|NP_791200.1| type III helper protein HrpW(Pto) [...    41   0.039
gi|46226797|gb|EAK87763.1| domain similar to KOG0260, KOG1984, K...    41   0.039
gi|37531932|ref|NP_920268.1| putative proline-rich cell wall pro...    41   0.039
gi|45516529|ref|ZP_00168081.1| COG0810: Periplasmic protein TonB...    41   0.039
gi|15608297|ref|NP_215673.1| hypothetical protein Rv1157c [Mycob...    41   0.039
gi|15840599|ref|NP_335636.1| hypothetical protein [Mycobacterium...    41   0.039
gi|45825055|gb|AAS77435.1| LP20693p [Drosophila melanogaster]          41   0.039
gi|39582681|emb|CAE73785.1| Hypothetical protein CBG21335 [Caeno...    41   0.039
gi|15805485|ref|NP_294181.1| hypothetical protein [Deinococcus r...    41   0.039
gi|17563994|ref|NP_505483.1| predicted CDS, putative protein, wi...    41   0.039
gi|38565531|gb|AAR24088.1| atherin [Oryctolagus cuniculus]             41   0.039
gi|49068398|ref|XP_398488.1| hypothetical protein UM00873.1 [Ust...    41   0.039
gi|46202034|ref|ZP_00053896.2| COG2885: Outer membrane protein a...    41   0.039
gi|11641239|ref|NP_071733.1| chromosome 11 open reading frame 24...    41   0.039
gi|15079958|gb|AAH11765.1| Chromosome 11 open reading frame 24 [...    41   0.039
gi|21231472|ref|NP_637389.1| YapH protein [Xanthomonas campestri...    41   0.039
gi|50546681|ref|XP_500810.1| hypothetical protein [Yarrowia lipo...    41   0.039
gi|21225405|ref|NP_631184.1| putative acyltransferase [Streptomy...    41   0.039
gi|38090759|ref|XP_356495.1| similar to CG32602-PA [Mus musculus]      40   0.051
gi|39594632|emb|CAE72210.1| Hypothetical protein CBG19321 [Caeno...    40   0.051
gi|25152834|ref|NP_741367.1| prion-like Q/N-rich domain protein ...    40   0.051
gi|85096|pir||C26427 period clock protein type C - fruit fly (Dr...    40   0.051
gi|19684085|gb|AAH25998.1| Hypothetical protein MGC26988 [Homo s...    40   0.051
gi|18702327|ref|NP_570969.1| hypothetical protein MGC26988 [Homo...    40   0.051
gi|19263509|gb|AAH25409.1| Hypothetical protein MGC26988 [Homo s...    40   0.051
gi|19032214|emb|CAA48691.2| type II transmembrane protein [Droso...    40   0.051
gi|42408151|dbj|BAD09289.1| unknown protein [Oryza sativa (japon...    40   0.051
gi|33873597|gb|AAH07390.2| TRIM28 protein [Homo sapiens]               40   0.051
gi|85094|pir||A26427 period clock protein type A - fruit fly (Dr...    40   0.051
gi|46226942|gb|EAK87908.1| hypothetical protein with signal pept...    40   0.051
gi|24639387|ref|NP_525056.2| CG2647-PA [Drosophila melanogaster]...    40   0.051
gi|41400384|gb|AAS07044.1| plus agglutinin [Chlamydomonas reinha...    40   0.051
gi|8745462|gb|AAF78928.1| Dip1-associated protein C [Crypthecodi...    40   0.051
gi|1076802|pir||S49915 extensin-like protein - maize >gnl|BL_ORD...    40   0.051
gi|3261850|emb|CAA19678.1| EG:155E2.4 [Drosophila melanogaster]        40   0.051
gi|72234|pir||UMFF period clock protein - fruit fly (Drosophila ...    40   0.051
gi|29829870|ref|NP_824504.1| hypothetical protein SAV3328 [Strep...    40   0.051
gi|15607585|ref|NP_214958.1| hypothetical protein Rv0444c [Mycob...    40   0.051
gi|31791622|ref|NP_854115.1| CONSERVED HYPOTHETICAL PROTEIN [Myc...    40   0.051
gi|25152837|ref|NP_741366.1| prion-like Q/N-rich domain protein ...    40   0.051
gi|15611028|ref|NP_218409.1| PPE [Mycobacterium tuberculosis H37...    40   0.051
gi|31795065|ref|NP_857558.1| PPE FAMILY PROTEIN [Mycobacterium b...    40   0.051
gi|15843523|ref|NP_338560.1| PPE family protein [Mycobacterium t...    40   0.051
gi|85222|pir||A25018 circadian rhythm protein - fruit fly (Droso...    40   0.051
gi|7512499|pir||G01950 hypothetical protein - human (fragment) >...    40   0.051
gi|217340|dbj|BAA00007.1| proteoglycan [Drosophila melanogaster]       40   0.051
gi|25152832|ref|NP_741365.1| prion-like Q/N-rich domain protein ...    40   0.051
gi|13561980|gb|AAK30593.1| flagelliform silk protein [Argiope tr...    40   0.051
gi|12005688|gb|AAG44573.1| period [Drosophila melanogaster]            40   0.051
gi|3261849|emb|CAA19677.1| EG:155E2.4 [Drosophila melanogaster]        40   0.051
gi|17229095|ref|NP_485643.1| putative heterocyst to vegetative c...    40   0.051
gi|22327898|ref|NP_680446.1| protein kinase family protein [Arab...    40   0.051
gi|20453162|gb|AAM19822.1| At5g56885 [Arabidopsis thaliana] >gnl...    40   0.051
gi|39930517|ref|NP_612361.1| atherin [Homo sapiens] >gnl|BL_ORD_...    40   0.051
gi|23103444|ref|ZP_00089926.1| hypothetical protein [Azotobacter...    40   0.051
gi|6174900|sp|P07663|PER_DROME Period circadian protein (Clock-6...    40   0.051
gi|9022429|gb|AAF82380.1| spore coat structural protein SP65 [Di...    40   0.051
gi|34895354|ref|NP_909020.1| P0494A10.31 [Oryza sativa (japonica...    40   0.051
gi|17221098|gb|AAK61476.1| glycoprotein gp2 [Equine herpesvirus 1]     40   0.051
gi|10566656|dbj|BAB15897.1| B region~corresponds to pos. 5234-57...    40   0.067
gi|10566654|dbj|BAB15896.1| B region~corresponds to pos. 5234-57...    40   0.067
gi|2914731|gb|AAC04504.1| dragline silk protein spidroin 1 [Neph...    40   0.067
gi|39584429|emb|CAE72567.1| Hypothetical protein CBG19751 [Caeno...    40   0.067
gi|31238165|ref|XP_319720.1| ENSANGP00000006494 [Anopheles gambi...    40   0.067
gi|50804055|ref|XP_424297.1| PREDICTED: similar to Hypothetical ...    40   0.067
gi|7488469|pir||T08134 oleosin-like protein - rape >gnl|BL_ORD_I...    40   0.067
gi|17063211|gb|AAL32375.1| dragline silk protein [Nephila clavipes]    40   0.067
gi|24641507|ref|NP_511137.3| CG32659-PA [Drosophila melanogaster...    40   0.067
gi|39580548|emb|CAE74680.1| Hypothetical protein CBG22490 [Caeno...    40   0.067
gi|40787890|ref|NP_954911.1| UL36 very large tegument protein [B...    40   0.067
gi|21223640|ref|NP_629419.1| hypothetical protein [Streptomyces ...    40   0.067
gi|46202106|ref|ZP_00208384.1| hypothetical protein Magn028348 [...    40   0.067
gi|25404764|pir||D96711 hypothetical protein F24J5.8 [imported] ...    40   0.067
gi|416833|sp|Q02910|CPN_DROME Calphotin >gnl|BL_ORD_ID|454593 gi...    40   0.067
gi|47575235|ref|ZP_00245270.1| COG3170: Tfp pilus assembly prote...    40   0.067
gi|397689|gb|AAA21421.1| ipiB3 >gnl|BL_ORD_ID|1305990 gi|741005|...    40   0.067
gi|13431960|sp|O00401|WASL_HUMAN Neural Wiskott-Aldrich syndrome...    40   0.067
gi|15600376|ref|NP_253870.1| hypothetical protein [Pseudomonas a...    40   0.067
gi|47211906|emb|CAF95482.1| unnamed protein product [Tetraodon n...    40   0.067
gi|38111410|gb|EAA56995.1| predicted protein [Magnaporthe grisea...    40   0.067
gi|15219860|ref|NP_176303.1| proline-rich family protein [Arabid...    40   0.067
gi|13471938|ref|NP_103505.1| probable transcriptional repressor ...    40   0.067
gi|586105|sp|Q05613|TONB_PSEPU TonB protein >gnl|BL_ORD_ID|88847...    40   0.067
gi|7441829|pir||T09854 proline-rich cell wall protein - upland c...    40   0.067
gi|42783700|ref|NP_980947.1| hypothetical protein BCE4654 [Bacil...    40   0.067
gi|7441828|pir||T10737 extensin-like cell wall protein - sea-isl...    40   0.067
gi|15218332|ref|NP_173035.1| expressed protein [Arabidopsis thal...    40   0.067
gi|401789|gb|AAA21425.1| ipiB1 >gnl|BL_ORD_ID|948413 gi|741003|p...    40   0.088
gi|33589474|gb|AAQ22504.1| LD47819p [Drosophila melanogaster]          40   0.088
gi|20129067|ref|NP_608356.1| CG12701-PA [Drosophila melanogaster...    40   0.088
gi|39581663|emb|CAE57171.1| Hypothetical protein CBG00005 [Caeno...    40   0.088
gi|18420042|ref|NP_568027.1| arabinogalactan-protein (AGP18) [Ar...    40   0.088
gi|5762340|gb|AAD51108.1| serum opacity factor precursor [Strept...    40   0.088
gi|47077591|dbj|BAD18678.1| unnamed protein product [Homo sapiens]     40   0.088
gi|48850413|ref|ZP_00304655.1| COG0810: Periplasmic protein TonB...    40   0.088
gi|9945318|ref|NP_064706.1| MAX binding protein; Max-interacting...    40   0.088
gi|3914992|sp|Q26264|SM41_HEMPU 41 kDa spicule matrix protein pr...    40   0.088
gi|37536184|ref|NP_922394.1| hypothetical protein [Oryza sativa ...    40   0.088
gi|17547022|ref|NP_520424.1| PROBABLE GSPD-RELATED PROTEIN [Rals...    40   0.088
gi|49086416|ref|XP_405257.1| hypothetical protein AN1120.2 [Aspe...    40   0.088
gi|39586345|emb|CAE74002.1| Hypothetical protein CBG21638 [Caeno...    40   0.088
gi|50760216|ref|XP_425807.1| PREDICTED: similar to RIKEN cDNA D0...    40   0.088
gi|39580549|emb|CAE74681.1| Hypothetical protein CBG22491 [Caeno...    40   0.088
gi|50551659|ref|XP_503304.1| hypothetical protein [Yarrowia lipo...    40   0.088
gi|38075518|ref|XP_195424.2| similar to erythrocyte membrane pro...    40   0.088
gi|5732089|gb|AAD31491.3| serum opacity factor precursor [Strept...    40   0.088
gi|16759597|ref|NP_455214.1| rare lipoprotein A precursor [Salmo...    40   0.088
gi|22135894|gb|AAM91529.1| unknown protein [Arabidopsis thaliana]      40   0.088
gi|23103829|ref|ZP_00090303.1| COG3147: Uncharacterized protein ...    40   0.088
gi|46318676|ref|ZP_00219114.1| hypothetical protein Bucepa020063...    40   0.088
gi|7486500|pir||T04739 hypothetical protein F6G17.100 - Arabidop...    40   0.088
gi|50548845|ref|XP_501892.1| hypothetical protein [Yarrowia lipo...    40   0.088
gi|46364380|ref|ZP_00227000.1| COG0642: Signal transduction hist...    40   0.088
gi|22327039|ref|NP_197859.2| WD-40 repeat family protein [Arabid...    40   0.088
gi|48730955|ref|ZP_00264701.1| COG0552: Signal recognition parti...    40   0.088
gi|9759211|dbj|BAB09653.1| unnamed protein product [Arabidopsis ...    40   0.088
gi|37522736|ref|NP_926113.1| unknown protein [Gloeobacter violac...    40   0.088
gi|13508191|ref|NP_110140.1| cytadherence accessory protein HMW3...    39   0.11
gi|91207|pir||C29149 proline-rich protein - mouse (fragment) >gn...    39   0.11
gi|32822873|gb|AAH55045.1| Wasl protein [Mus musculus]                 39   0.11
gi|15706272|emb|CAC69994.1| N-WASP protein [Mus musculus]              39   0.11
gi|22974592|ref|ZP_00020794.1| hypothetical protein [Chloroflexu...    39   0.11
gi|48848426|ref|ZP_00302672.1| hypothetical protein Saro02003234...    39   0.11
gi|18399983|ref|NP_565537.1| arabinogalactan-protein (AGP2) [Ara...    39   0.11
gi|19554019|ref|NP_602021.1| hypothetical membrane protein [Cory...    39   0.11
gi|47497686|dbj|BAD19753.1| unknown protein [Oryza sativa (japon...    39   0.11
gi|7140837|gb|AAD17484.2| dihydrolipoamide acetyltransferase [St...    39   0.11
gi|3883122|gb|AAC77824.1| arabinogalactan-protein [Arabidopsis t...    39   0.11
gi|30021453|ref|NP_833084.1| Collagen-like triple helix repeat p...    39   0.11
gi|15226923|ref|NP_180435.1| disease resistance-responsive famil...    39   0.11
gi|27370004|ref|NP_766282.1| EGF-like-domain, multiple 5 [Mus mu...    39   0.11
gi|12005704|gb|AAG44581.1| period [Drosophila sechellia]               39   0.11
gi|30022809|ref|NP_834440.1| VrrB [Bacillus cereus ATCC 14579] >...    39   0.11
gi|48729926|ref|ZP_00263675.1| COG3210: Large exoproteins involv...    39   0.11
gi|15608897|ref|NP_216275.1| PE_PGRS(wag22) [Mycobacterium tuber...    39   0.11
gi|50258570|gb|EAL21257.1| hypothetical protein CNBD3120 [Crypto...    39   0.11
gi|1706636|sp|P54320|ELS_MOUSE Elastin precursor (Tropoelastin) ...    39   0.11
gi|31792948|ref|NP_855441.1| PE-PGRS FAMILY PROTEIN WAG22B [SECO...    39   0.11
gi|31542606|ref|NP_031951.2| elastin; tropoelastin [Mus musculus...    39   0.11
gi|5305335|gb|AAD41594.1| proline-rich mucin homolog [Mycobacter...    39   0.11
gi|21355869|ref|NP_647875.1| CG1259-PB [Drosophila melanogaster]...    39   0.11
gi|15609477|ref|NP_216856.1| PE [Mycobacterium tuberculosis H37R...    39   0.11
gi|12005706|gb|AAG44582.1| period [Drosophila simulans]                39   0.11
gi|50287949|ref|XP_446403.1| unnamed protein product [Candida gl...    39   0.11
gi|38110502|gb|EAA56210.1| predicted protein [Magnaporthe grisea...    39   0.11
gi|24585618|ref|NP_724320.1| CG31626-PA [Drosophila melanogaster...    39   0.11
gi|21325603|dbj|BAC00224.1| Hypothetical membrane protein [Coryn...    39   0.11
gi|50546877|ref|XP_500908.1| hypothetical protein [Yarrowia lipo...    39   0.11
gi|50551509|ref|XP_503228.1| hypothetical protein [Yarrowia lipo...    39   0.11
gi|15609220|ref|NP_216599.1| hypothetical protein Rv2083 [Mycoba...    39   0.11
gi|31793266|ref|NP_855759.1| CONSERVED HYPOTHETICAL PROTEIN [Myc...    39   0.11
gi|41745812|gb|AAS10183.1| Oda5p [Chlamydomonas reinhardtii]           39   0.11
gi|15841576|ref|NP_336613.1| hypothetical protein [Mycobacterium...    39   0.11
gi|48845846|ref|ZP_00300117.1| COG3846: Type IV secretory pathwa...    39   0.11
gi|9800520|gb|AAF99336.1| ELN [Mus musculus]                           39   0.11
gi|28828569|gb|AAO51173.1| similar to Dictyostelium discoideum (...    39   0.11
gi|31215700|ref|XP_316078.1| ENSANGP00000012440 [Anopheles gambi...    39   0.15
gi|37590102|gb|AAH58665.1| Cic protein [Mus musculus]                  39   0.15
gi|10566658|dbj|BAB15898.1| B region~corresponds to pos. 5234-57...    39   0.15
gi|21536695|gb|AAM61027.1| unknown [Arabidopsis thaliana]              39   0.15
gi|18424945|ref|NP_569011.1| arabinogalactan-protein (AGP7) [Ara...    39   0.15
gi|32417598|ref|XP_329277.1| predicted protein [Neurospora crass...    39   0.15
gi|48767888|ref|ZP_00272240.1| COG0810: Periplasmic protein TonB...    39   0.15
gi|15841912|ref|NP_336949.1| PE_PGRS family protein [Mycobacteri...    39   0.15
gi|50423177|ref|XP_460169.1| unnamed protein product [Debaryomyc...    39   0.15
gi|50546166|ref|XP_500610.1| hypothetical protein [Yarrowia lipo...    39   0.15
gi|15609533|ref|NP_216912.1| PE_PGRS [Mycobacterium tuberculosis...    39   0.15
gi|10566624|dbj|BAB15881.1| B region~corresponds to pos. 5234-57...    39   0.15
gi|41409898|ref|NP_962734.1| hypothetical protein MAP3800 [Mycob...    39   0.15
gi|10566652|dbj|BAB15895.1| B region~corresponds to pos. 5234-57...    39   0.15
gi|38099971|gb|EAA47207.1| hypothetical protein MG11032.4 [Magna...    39   0.15
gi|31793574|ref|NP_856067.1| PE-PGRS FAMILY PROTEIN [Mycobacteri...    39   0.15
gi|9634084|ref|NP_052277.1| hypothetical protein 186p27 [Enterob...    39   0.15
gi|39582682|emb|CAE73786.1| Hypothetical protein CBG21336 [Caeno...    39   0.15
gi|38455898|gb|AAR20918.1| PspA [Streptococcus pneumoniae]             39   0.15
gi|16507202|ref|NP_082158.1| capicua homolog [Mus musculus] >gnl...    39   0.15
gi|34902428|ref|NP_912560.1| Unknown protein [Oryza sativa (japo...    39   0.15
gi|50745638|ref|XP_420179.1| PREDICTED: similar to Nuclear pore ...    39   0.15
gi|544392|sp|P35409|GLHR_ANTEL Probable glycoprotein hormone G-p...    39   0.15
gi|21244271|ref|NP_643853.1| outer membrane protein [Xanthomonas...    39   0.15
gi|21220050|ref|NP_625829.1| putative eukaryotic-type protein ki...    39   0.15
gi|12836037|dbj|BAB23472.1| unnamed protein product [Mus musculus]     39   0.15
gi|10566626|dbj|BAB15882.1| B region~corresponds to pos. 5234-57...    39   0.15
gi|32442180|gb|AAP82055.1| putative mating pair formation protei...    39   0.15
gi|31791303|ref|NP_853796.1| PE-PGRS FAMILY PROTEIN [Mycobacteri...    39   0.15
gi|47777667|gb|AAT38111.1| TAF4 RNA polymerase II, TATA box bind...    39   0.15
gi|12240028|gb|AAG49547.1| translation initiation factor IF2 [My...    39   0.15
gi|13559031|emb|CAC36006.1| bA11M20.1 (TATA box binding protein ...    39   0.15
gi|49140800|ref|XP_413661.1| hypothetical protein AN9524.2 [Aspe...    39   0.15
gi|38260663|gb|AAR15478.1| pollen coat oleosin-glycine rich prot...    39   0.15
gi|46365146|ref|ZP_00227658.1| COG0515: Serine/threonine protein...    39   0.15
gi|41720153|ref|ZP_00148992.1| hypothetical protein Mbur070001 [...    39   0.15
gi|26006131|dbj|BAC41408.1| mKIAA0306 protein [Mus musculus]           39   0.15
gi|26251956|gb|AAH40463.1| Cic protein [Mus musculus]                  39   0.15
gi|4507349|ref|NP_003176.1| TBP-associated factor 4; TATA box bi...    39   0.15
gi|1171094|sp|P42522|MYSC_DICDI Myosin IC heavy chain >gnl|BL_OR...    39   0.15
gi|15839505|ref|NP_334542.1| PE_PGRS family protein [Mycobacteri...    39   0.15
gi|29829156|ref|NP_823790.1| putative membrane protein [Streptom...    39   0.15
gi|39578758|emb|CAE57148.1| Hypothetical protein CBG25081 [Caeno...    39   0.15
gi|50292701|ref|XP_448783.1| unnamed protein product [Candida gl...    39   0.15
gi|49477241|ref|YP_035673.1| collagen-like protein [Bacillus thu...    39   0.15
gi|34899116|ref|NP_910904.1| P0496C02.24 [Oryza sativa (japonica...    39   0.20
gi|31543259|ref|NP_034943.2| max binding protein [Mus musculus] ...    39   0.20
gi|1841930|emb|CAA68878.1| ROX protein [Mus musculus] >gnl|BL_OR...    39   0.20
gi|24571157|gb|AAN62894.1| cell wall protein; Sed1p [Saccharomyc...    39   0.20
gi|13562010|gb|AAK30608.1| major ampullate spidroin 1 [Nephila s...    39   0.20
gi|38201621|ref|NP_886553.2| eukaryotic translation initiation f...    39   0.20
gi|38201625|ref|NP_937885.1| eukaryotic translation initiation f...    39   0.20
gi|41206815|ref|XP_373731.1| keratin associated protein 4-9 [Hom...    39   0.20
gi|34872745|ref|XP_220698.2| similar to Myc antagonist Mnt [Ratt...    39   0.20
gi|24571166|gb|AAN62897.1| cell wall protein; Sed1p [Saccharomyc...    39   0.20
gi|31794689|ref|NP_857182.1| PE-PGRS FAMILY PROTEIN [Mycobacteri...    39   0.20
gi|31044495|ref|NP_848140.2| nuclear protein ZAP; ZAP3 protein [...    39   0.20
gi|38201627|ref|NP_937887.1| eukaryotic translation initiation f...    39   0.20
gi|38201619|ref|NP_004944.2| eukaryotic translation initiation f...    39   0.20
gi|33324323|gb|AAQ07956.1| unknown [Red sea bream iridovirus]          39   0.20
gi|2119175|pir||A26601 elastin precursor - chicken (fragment)          39   0.20
gi|24653688|ref|NP_610981.1| CG30479-PA [Drosophila melanogaster...    39   0.20
gi|397687|gb|AAA21420.1| ipiB2 >gnl|BL_ORD_ID|513352 gi|741004|p...    39   0.20
gi|28197954|ref|NP_778268.1| TonB protein [Xylella fastidiosa Te...    39   0.20
gi|47570813|ref|ZP_00241366.1| Col3a1 protein [Bacillus cereus G...    39   0.20
gi|10566622|dbj|BAB15880.1| B region~corresponds to pos. 5234-57...    39   0.20
gi|38100429|gb|EAA47559.1| hypothetical protein MG02802.4 [Magna...    39   0.20
gi|17561512|ref|NP_506158.1| predicted CDS, putative protein fam...    39   0.20
gi|9629328|ref|NP_044528.1| RL2 [Human herpesvirus 2] >gnl|BL_OR...    39   0.20
gi|10566606|dbj|BAB15872.1| B region~corresponds to pos. 5234-57...    39   0.20
gi|46203872|ref|ZP_00050853.2| COG1555: DNA uptake protein and r...    39   0.20
gi|48764960|ref|ZP_00269511.1| COG2861: Uncharacterized protein ...    39   0.20
gi|46364748|ref|ZP_00227330.1| COG1572: Uncharacterized conserve...    39   0.20
gi|10121238|gb|AAG13121.1| penicillin-binding protein 1 [Mycobac...    39   0.20
gi|9629269|ref|NP_044469.1| RL2 [Human herpesvirus 2] >gnl|BL_OR...    39   0.20
gi|17507541|ref|NP_491232.1| putative mitochondrial protein, wit...    39   0.20
gi|119296|sp|P07916|ELS_CHICK Elastin precursor (Tropoelastin) >...    39   0.20
gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC ...    39   0.20
gi|2388676|gb|AAB80719.1| precollagen P [Mytilus edulis]               39   0.20
gi|1304179|dbj|BAA07817.1| fibrinogen A-alpha-chain [Sus scrofa]       39   0.20
gi|17549105|ref|NP_522445.1| PROBABLE TRANSMEMBRANE PROTEIN [Ral...    39   0.20
gi|50557064|ref|XP_505940.1| hypothetical protein [Yarrowia lipo...    39   0.20
gi|16262650|ref|NP_435443.1| hypothetical protein SMa0367 [Sinor...    39   0.20
gi|46114672|ref|XP_383354.1| hypothetical protein FG03178.1 [Gib...    39   0.20
gi|47569234|ref|ZP_00239920.1| hypothetical protein membrane Spa...    39   0.20
gi|39598021|emb|CAE68713.1| Hypothetical protein CBG14638 [Caeno...    39   0.20
gi|48787177|ref|ZP_00283259.1| hypothetical protein Bcep02001963...    39   0.20
gi|45383858|ref|NP_989457.1| sterol regulatory element binding t...    39   0.20
gi|31794684|ref|NP_857177.1| PE-PGRS FAMILY PROTEIN [Mycobacteri...    39   0.20
gi|212742|gb|AAA49082.1| tropoelastin                                  39   0.20
gi|6754576|ref|NP_034869.1| lymphocyte antigen 64 [Mus musculus]...    38   0.26
gi|3941724|gb|AAC82471.1| eukaryotic protein synthesis initiatio...    38   0.26
gi|48891739|ref|ZP_00325205.1| COG2931: RTX toxins and related C...    38   0.26
gi|19881428|ref|NP_612245.1| ORF023R [infectious spleen and kidn...    38   0.26
gi|32029187|ref|ZP_00132251.1| COG5295: Autotransporter adhesin ...    38   0.26
gi|48772504|ref|ZP_00276846.1| hypothetical protein Reut02001267...    38   0.26
gi|27922909|gb|AAO24643.1| elicitin protein [Phytophthora sojae]       38   0.26
gi|48765116|ref|ZP_00269667.1| COG2885: Outer membrane protein a...    38   0.26
gi|31127073|gb|AAH52781.1| RANBP9 protein [Homo sapiens]               38   0.26
gi|584904|sp|P37697|CCPA_ACEXY Cellulose complementing protein >...    38   0.26
gi|39579352|emb|CAE56520.1| Hypothetical protein CBG24243 [Caeno...    38   0.26
gi|10566650|dbj|BAB15894.1| B region~corresponds to pos. 5234-57...    38   0.26
gi|18311680|ref|NP_558347.1| hypothetical protein PAE0055 [Pyrob...    38   0.26
gi|3858883|gb|AAD09141.1| myosin I heavy chain kinase [Acanthamo...    38   0.26
gi|10566612|dbj|BAB15875.1| B region~corresponds to pos. 5234-57...    38   0.26
gi|50363145|gb|AAT75312.1| major ampullate spidroin 1 [Nephila c...    38   0.26
gi|24650935|ref|NP_651665.2| CG1401-PA [Drosophila melanogaster]...    38   0.26
gi|27375463|ref|NP_766992.1| blr0352 [Bradyrhizobium japonicum U...    38   0.26


>gi|17542094|ref|NP_501768.1| Sperm-Specific family, class Q SSQ-1,
           putative protein (24.4 kD) (ssq-1) [Caenorhabditis
           elegans]
 gi|7505463|pir||T23416 hypothetical protein K07F5.11 -
           Caenorhabditis elegans
 gi|3878313|emb|CAA94280.1| C. elegans SSQ-1 protein (corresponding
           sequence K07F5.11) [Caenorhabditis elegans]
          Length = 290

 Score =  229 bits (583), Expect = 8e-59
 Identities = 128/191 (67%), Positives = 128/191 (67%)
 Frame = +1

Query: 1   MTSAYFGVAGGSNTGAQSAYFXXXXXXXXXXXXXXXXXXXXXXXXXTSVYMXXXXXXXXX 180
           MTSAYFGVAGGSNTGAQSAYF                         TSVYM
Sbjct: 1   MTSAYFGVAGGSNTGAQSAYFGVGGGPAGGGGGASKVGGAGAPPPGTSVYMGAGAGGGGG 60

Query: 181 XXXQSAYFXXXXXXXXXXXXXXXXXXXXXXXXXXSTMTALGGAPSGASTMTAVGGAPRGA 360
              QSAYF                          STMTALGGAPSGASTMTAVGGAPRGA
Sbjct: 61  GGAQSAYFAVGGAPVGGAPAAVPMGAPPPAGGGASTMTALGGAPSGASTMTAVGGAPRGA 120

Query: 361 STMTAVGGAPTGASTMTAVGGAPRGASTMTAVGGAPTGASTMTAVGGAPGEASTMTAVGG 540
           STMTAVGGAPTGASTMTAVGGAPRGASTMTAVGGAPTGASTMTAVGGAPGEASTMTAVGG
Sbjct: 121 STMTAVGGAPTGASTMTAVGGAPRGASTMTAVGGAPTGASTMTAVGGAPGEASTMTAVGG 180

Query: 541 APRGASTMTAV 573
           APRGASTMTAV
Sbjct: 181 APRGASTMTAV 191



 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 49/131 (37%), Positives = 54/131 (40%), Gaps = 42/131 (32%)
 Frame = +1

Query: 283 STMTALGGAPSGASTMTAVGGAPRGASTMTAVGGAPTGASTMTAV--------------- 417
           STMTA+GGAP  ASTMTAVGGAPRGASTMTAVG    GAS + A
Sbjct: 160 STMTAVGGAPGEASTMTAVGGAPRGASTMTAVGAPGGGASALGAAPPAGSMSGGGGGGGA 219

Query: 418 ---------------------------GGAPRGASTMTAVGGAPTGASTMTAVGGAPGEA 516
                                      GGA  GA +    GG   G S     GG  G
Sbjct: 220 TSGYFGVGQGVMGGGGAVGQSAYFGVGGGAAGGAKSGGGGGGGIPGQSMYMGAGGGGGAG 279

Query: 517 STMTAVGGAPR 549
              T+   AP+
Sbjct: 280 GGATSAYFAPK 290



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 31/87 (35%), Positives = 37/87 (41%), Gaps = 4/87 (4%)
 Frame = -2

Query: 554 APRGAPPTAVMVEASP----GAPPTAVIVEAPVGAPPTAVMVEAPRGAPPTAVMVEAPVG 387
           AP G  P AV + A P    GA     +  AP GA     +  APRGA     +  AP G
Sbjct: 73  APVGGAPAAVPMGAPPPAGGGASTMTALGGAPSGASTMTAVGGAPRGASTMTAVGGAPTG 132

Query: 386 APPTAVIVEAPLGAPPTAVIVDAPDGA 306
           A     +  AP GA     +  AP GA
Sbjct: 133 ASTMTAVGGAPRGASTMTAVGGAPTGA 159



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 36/90 (40%), Positives = 42/90 (46%), Gaps = 4/90 (4%)
 Frame = -2

Query: 551 PRGAPPTA----VMVEASPGAPPTAVIVEAPVGAPPTAVMVEAPRGAPPTAVMVEAPVGA 384
           P GAPP A      + A  GAP  A  + A  GAP  A  + A  GAP  A  + A  GA
Sbjct: 83  PMGAPPPAGGGASTMTALGGAPSGASTMTAVGGAPRGASTMTAVGGAPTGASTMTAVGGA 142

Query: 383 PPTAVIVEAPLGAPPTAVIVDAPDGAPPRA 294
           P  A  + A  GAP  A  + A  GAP  A
Sbjct: 143 PRGASTMTAVGGAPTGASTMTAVGGAPGEA 172



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 33/81 (40%), Positives = 39/81 (47%)
 Frame = -2

Query: 545 GAPPTAVMVEASPGAPPTAVIVEAPVGAPPTAVMVEAPRGAPPTAVMVEAPVGAPPTAVI 366
           GAP  A  + A  GAP  A  + A  GAP  A  + A  GAP  A  + A  GAP  A
Sbjct: 102 GAPSGASTMTAVGGAPRGASTMTAVGGAPTGASTMTAVGGAPRGASTMTAVGGAPTGAST 161

Query: 365 VEAPLGAPPTAVIVDAPDGAP 303
           + A  GAP  A  + A  GAP
Sbjct: 162 MTAVGGAPGEASTMTAVGGAP 182



 Score = 40.8 bits (94), Expect = 0.039
 Identities = 35/90 (38%), Positives = 41/90 (44%), Gaps = 3/90 (3%)
 Frame = -2

Query: 569 AVIVDAPRGAPPTAVMVEASPGAPPTAVIVEAPVGAPPTAVMVEAPRGAPPTAVMVEAPV 390
           A  + A  GAP  A  + A  GAP  A  + A  GAP  A  + A  GAP  A  + A
Sbjct: 107 ASTMTAVGGAPRGASTMTAVGGAPTGASTMTAVGGAPRGASTMTAVGGAPTGASTMTAVG 166

Query: 389 GAPPTAVIVEAPLGAP---PTAVIVDAPDG 309
           GAP  A  + A  GAP    T   V AP G
Sbjct: 167 GAPGEASTMTAVGGAPRGASTMTAVGAPGG 196



 Score = 40.0 bits (92), Expect = 0.067
 Identities = 27/83 (32%), Positives = 33/83 (39%)
 Frame = -2

Query: 554 APRGAPPTAVMVEASPGAPPTAVIVEAPVGAPPTAVMVEAPRGAPPTAVMVEAPVGAPPT 375
           AP GA     +  A  GA     +  AP GA     +  APRGA     +  AP GA
Sbjct: 103 APSGASTMTAVGGAPRGASTMTAVGGAPTGASTMTAVGGAPRGASTMTAVGGAPTGASTM 162

Query: 374 AVIVEAPLGAPPTAVIVDAPDGA 306
             +  AP  A     +  AP GA
Sbjct: 163 TAVGGAPGEASTMTAVGGAPRGA 185



 Score = 37.7 bits (86), Expect = 0.33
 Identities = 33/93 (35%), Positives = 38/93 (40%), Gaps = 9/93 (9%)
 Frame = -2

Query: 545 GAPPTAVMVEASPGAPPTA---------VIVEAPVGAPPTAVMVEAPRGAPPTAVMVEAP 393
           GAPP    V    GA              +  APVG  P AV + AP  A   A  + A
Sbjct: 41  GAPPPGTSVYMGAGAGGGGGGGAQSAYFAVGGAPVGGAPAAVPMGAPPPAGGGASTMTAL 100

Query: 392 VGAPPTAVIVEAPLGAPPTAVIVDAPDGAPPRA 294
            GAP  A  + A  GAP  A  + A  GAP  A
Sbjct: 101 GGAPSGASTMTAVGGAPRGASTMTAVGGAPTGA 133



 Score = 36.2 bits (82), Expect = 0.97
 Identities = 31/82 (37%), Positives = 37/82 (44%), Gaps = 1/82 (1%)
 Frame = -2

Query: 545 GAPPTAVMVEASP-GAPPTAVIVEAPVGAPPTAVMVEAPRGAPPTAVMVEAPVGAPPTAV 369
           GA      V  +P G  P AV + AP  A   A  + A  GAP  A  + A  GAP  A
Sbjct: 62  GAQSAYFAVGGAPVGGAPAAVPMGAPPPAGGGASTMTALGGAPSGASTMTAVGGAPRGAS 121

Query: 368 IVEAPLGAPPTAVIVDAPDGAP 303
            + A  GAP  A  + A  GAP
Sbjct: 122 TMTAVGGAPTGASTMTAVGGAP 143




[DB home][top]