Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= K02B12_1
(608 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17506363|ref|NP_492303.1| cell division cycle 5-like (85.7 kD... 399 e-110
gi|39595616|emb|CAE67118.1| Hypothetical protein CBG12532 [Caeno... 361 5e-99
gi|10183618|emb|CAC08557.1| dJ319D22.1 (CDC5-like protein) [Homo... 107 2e-22
gi|16758290|ref|NP_445979.1| cell division cycle 5-like; CDC5 (c... 107 2e-22
gi|11067747|ref|NP_001244.1| CDC5-like; CDC5 (cell division cycl... 107 2e-22
gi|20521049|dbj|BAA24862.2| KIAA0432 [Homo sapiens] 107 2e-22
gi|22779899|ref|NP_690023.1| cell division cycle 5-like [Mus mus... 106 3e-22
gi|50510485|dbj|BAD32228.1| mKIAA0432 protein [Mus musculus] 106 3e-22
gi|50745288|ref|XP_420058.1| PREDICTED: similar to KIAA0432 [Gal... 104 1e-21
gi|38094588|ref|XP_135371.2| similar to Cell division cycle 5-li... 102 7e-21
gi|19922992|ref|NP_612033.1| CG6905-PA [Drosophila melanogaster]... 90 3e-17
gi|31205987|ref|XP_311945.1| ENSANGP00000011065 [Anopheles gambi... 85 9e-16
gi|18092653|gb|AAL59389.1| CDC5 protein [Zea mays] 67 2e-10
gi|47224734|emb|CAG00328.1| unnamed protein product [Tetraodon n... 67 3e-10
gi|50255441|gb|EAL18176.1| hypothetical protein CNBK1950 [Crypto... 63 5e-09
gi|46136583|ref|XP_389983.1| hypothetical protein FG09807.1 [Gib... 61 2e-08
gi|15080686|dbj|BAB62527.1| CDC5 [Lentinula edodes] 60 2e-08
gi|32413601|ref|XP_327280.1| hypothetical protein [Neurospora cr... 56 5e-07
gi|49076010|ref|XP_402026.1| hypothetical protein UM04411.1 [Ust... 52 1e-05
gi|38109987|gb|EAA55775.1| hypothetical protein MG01426.4 [Magna... 51 1e-05
gi|49108732|ref|XP_411632.1| hypothetical protein AN7495.2 [Aspe... 47 2e-04
gi|17553764|ref|NP_497706.1| protein kinase beta like (3E511) [C... 41 0.020
gi|48858794|ref|ZP_00312740.1| COG0419: ATPase involved in DNA r... 40 0.045
gi|48857430|ref|ZP_00311434.1| COG1196: Chromosome segregation A... 39 0.058
gi|42559523|sp|Q9BMM8|MYSP_SARSC Paramyosin >gnl|BL_ORD_ID|66920... 39 0.058
gi|13540910|ref|NP_110598.1| Uncharacterized conserved protein [... 39 0.058
gi|14324292|dbj|BAB59220.1| tropomyosin-like protein [Thermoplas... 39 0.058
gi|27462846|gb|AAO15612.1| paramyosin [Sarcoptes scabiei type ho... 39 0.058
gi|46389998|dbj|BAD16376.1| putative myosin XI [Oryza sativa (ja... 39 0.076
gi|20094208|ref|NP_614055.1| Uncharacterized protein [Methanopyr... 39 0.099
gi|11558044|emb|CAC17732.1| FYVE-finger containing protein [Mus ... 39 0.099
gi|6225510|sp|P97779|HMMR_RAT HYALURONAN MEDIATED MOTILITY RECEP... 39 0.099
gi|34878815|ref|XP_226014.2| similar to p140mDia [Rattus norvegi... 39 0.099
gi|13384072|gb|AAK21260.1| variant surface glycoprotein VSG 10.3... 38 0.13
gi|49092590|ref|XP_407756.1| hypothetical protein AN3619.2 [Aspe... 38 0.13
gi|3287482|gb|AAC25494.1| type 3 myosin heavy chain [Rana pipiens] 38 0.13
gi|313748|emb|CAA80797.1| YBLO501 [Saccharomyces cerevisiae] 38 0.17
gi|50286051|ref|XP_445454.1| unnamed protein product [Candida gl... 38 0.17
gi|6319424|ref|NP_009506.1| Key endocytic protein involved in a ... 38 0.17
gi|463262|emb|CAA55048.1| YBL0520 [Saccharomyces cerevisiae] 38 0.17
gi|50404951|ref|YP_054043.1| Guanylate-binding protein, putative... 38 0.17
gi|42559470|sp|Q86RN8|MYSP_BOOMI Paramyosin >gnl|BL_ORD_ID|12326... 37 0.22
gi|547860|sp|P36773|LON1_MYXXA ATP-dependent protease La 1 >gnl|... 37 0.22
gi|28829350|gb|AAO51892.1| similar to Plasmodium falciparum (iso... 37 0.22
gi|50782507|ref|XP_423398.1| PREDICTED: similar to cingulin [Gal... 37 0.22
gi|34856405|ref|XP_216212.2| similar to RIKEN cDNA 0710001P09 [R... 37 0.29
gi|47213927|emb|CAF90750.1| unnamed protein product [Tetraodon n... 37 0.29
gi|21618181|gb|AAM67231.1| unknown [Arabidopsis thaliana] 37 0.29
gi|15230567|ref|NP_190740.1| expressed protein [Arabidopsis thal... 37 0.29
gi|47059017|ref|NP_037096.2| hyaluronan mediated motility recept... 37 0.29
gi|6093461|sp|P79293|MYH7_PIG Myosin heavy chain, cardiac muscle... 37 0.29
gi|15895993|ref|NP_349342.1| ATPase involved in DNA repair [Clos... 37 0.29
gi|47214961|emb|CAG10783.1| unnamed protein product [Tetraodon n... 37 0.38
gi|47230475|emb|CAF99668.1| unnamed protein product [Tetraodon n... 37 0.38
gi|17647469|ref|NP_524061.1| CG9206-PA [Drosophila melanogaster]... 37 0.38
gi|21392104|gb|AAM48406.1| RE24170p [Drosophila melanogaster] 37 0.38
gi|46227257|gb|EAK88207.1| Low complexity hypothetical protein [... 37 0.38
gi|47215788|emb|CAG02584.1| unnamed protein product [Tetraodon n... 36 0.49
gi|37360312|dbj|BAC98134.1| mKIAA1288 protein [Mus musculus] 36 0.49
gi|48825577|ref|ZP_00286821.1| COG0419: ATPase involved in DNA r... 36 0.49
gi|47228910|emb|CAG09425.1| unnamed protein product [Tetraodon n... 36 0.49
gi|23508398|ref|NP_701067.1| hypothetical protein [Plasmodium fa... 36 0.49
gi|50747332|ref|XP_420841.1| PREDICTED: similar to CPEB-associat... 36 0.49
gi|27369788|ref|NP_766145.1| RUN and FYVE domain containing 1; F... 36 0.64
gi|26338251|dbj|BAC32811.1| unnamed protein product [Mus musculus] 36 0.64
gi|15144510|gb|AAK84477.1| putative centromere protein [Lycopers... 36 0.64
gi|20806787|ref|NP_621958.1| ATPase involved in DNA repair [Ther... 36 0.64
gi|46914042|emb|CAG20822.1| putative phage shock protein A [Phot... 36 0.64
gi|50306015|ref|XP_452969.1| unnamed protein product [Kluyveromy... 36 0.64
gi|84972|pir||A28313 glued protein - fruit fly (Drosophila melan... 36 0.64
gi|42559485|sp|Q8MUF6|MYSP_BLOTA Paramyosin (Allergen Blo t 11) ... 36 0.64
gi|24644332|ref|NP_730971.1| CG31551-PA [Drosophila melanogaster... 36 0.64
gi|34864325|ref|XP_236385.2| similar to KIAA1749 protein [Rattus... 36 0.64
gi|3986194|dbj|BAA34954.1| myosin heavy chain [Dugesia japonica] 36 0.64
gi|41149317|ref|XP_166160.4| similar to chromosome 6 open readin... 36 0.64
gi|10803365|emb|CAC13104.1| nuclear lamin [Branchiostoma lanceol... 36 0.64
gi|7521921|pir||T30534 chromosome segregation protein SMC1 homol... 35 0.84
gi|39588186|emb|CAE68111.1| Hypothetical protein CBG13754 [Caeno... 35 0.84
gi|40218526|gb|AAR83180.1| LPXTG anchored putative adhesin [Stre... 35 0.84
gi|50304387|ref|XP_452143.1| CBF1_KLULA [Kluyveromyces lactis] >... 35 0.84
gi|26418900|gb|AAN78184.1| variant surface glycoprotein [Trypano... 35 0.84
gi|1345701|sp|P49379|CBF1_KLULA Centromere-binding protein 1 (CB... 35 0.84
gi|33620775|ref|NP_891556.1| kinectin 1; CG-1 antigen; kinesin r... 35 0.84
gi|6681183|ref|NP_031884.1| diaphanous homolog 1 [Mus musculus] ... 35 0.84
gi|45433533|ref|NP_956114.2| Unknown (protein for MGC:66194); wu... 35 0.84
gi|47124599|gb|AAH70412.1| Diap1 protein [Mus musculus] 35 0.84
gi|422888|pir||S32763 kinectin 1 - human >gnl|BL_ORD_ID|1851636 ... 35 0.84
gi|42559514|sp|Q967Z0|MYSP_DERFA Paramyosin (Allergen Der f 11) ... 35 1.1
gi|28603844|ref|NP_776191.1| chromosome 6 open reading frame 182... 35 1.1
gi|15791435|ref|NP_281258.1| hypothetical protein Cj0036 [Campyl... 35 1.1
gi|50404942|ref|YP_054034.1| hypothetical protein with coiled-co... 35 1.1
gi|48096331|ref|XP_392432.1| similar to ENSANGP00000009968 [Apis... 35 1.1
gi|1084193|pir||S52537 emm L 15 protein - Streptococcus pyogenes... 35 1.1
gi|633790|gb|AAB31196.1| EMML15=M-like immunoglobulin-binding pr... 35 1.1
gi|37778944|gb|AAO73464.1| HDM allergen [Dermatophagoides pteron... 35 1.1
gi|46434267|gb|EAK93682.1| hypothetical protein CaO19.14182 [Can... 35 1.1
gi|37589184|gb|AAH59196.1| Unknown (protein for MGC:66194) [Dani... 35 1.1
gi|39598270|emb|CAE68962.1| Hypothetical protein CBG14942 [Caeno... 35 1.1
gi|50257941|gb|EAL20638.1| hypothetical protein CNBE3030 [Crypto... 35 1.1
gi|47228706|emb|CAG07438.1| unnamed protein product [Tetraodon n... 35 1.1
gi|34763715|ref|ZP_00144637.1| Chromosome partition protein smc ... 35 1.1
gi|39963166|gb|AAH64365.1| Unknown (protein for MGC:70837) [Homo... 35 1.1
gi|19703611|ref|NP_603173.1| membrane protein related to metallo... 35 1.4
gi|47085791|ref|NP_998233.1| zgc:55902 [Danio rerio] >gnl|BL_ORD... 35 1.4
gi|2147744|pir||I51302 myosin heavy chain - chicken (fragment) >... 35 1.4
gi|50838836|ref|NP_001001302.1| chick atrial myosin heavy chain ... 35 1.4
gi|29727|emb|CAA37068.1| cardiac beta myosin heavy chain [Homo s... 35 1.4
gi|11276954|pir||A59234 slow myosin heavy chain 3 - quail >gnl|B... 35 1.4
gi|50797117|ref|XP_423922.1| PREDICTED: chick atrial myosin heav... 35 1.4
gi|41053469|ref|NP_956604.1| similar to cell division cycle asso... 35 1.4
gi|49071858|ref|XP_400218.1| hypothetical protein UM02603.1 [Ust... 35 1.4
gi|476355|pir||A46762 myosin alpha heavy chain, cardiac muscle -... 35 1.4
gi|6324769|ref|NP_014838.1| Kinetochore-associated protein requi... 35 1.4
gi|13173388|gb|AAK14386.1| lysine/glutamic acid-rich protein [Ca... 35 1.4
gi|13095768|ref|NP_076659.1| Orf5 [Bacteriophage bIL286] >gnl|BL... 35 1.4
gi|34859473|ref|XP_218972.2| nuclear mitotic apparatus protein 1... 35 1.4
gi|31544526|ref|NP_853104.1| conserved hypothetical [Mycoplasma ... 35 1.4
gi|38090467|ref|XP_125625.2| RIKEN cDNA 4930589M24 [Mus musculus] 35 1.4
gi|12053672|emb|CAC20413.1| beta-myosin heavy chain [Homo sapiens] 35 1.4
gi|47223023|emb|CAG07110.1| unnamed protein product [Tetraodon n... 35 1.4
gi|386970|gb|AAA60385.1| myosin heavy chain beta-subunit 35 1.4
gi|14017750|dbj|BAB47396.1| atrial myosin heacy chain [Gallus ga... 35 1.4
gi|4557773|ref|NP_000248.1| myosin, heavy polypeptide 7, cardiac... 35 1.4
gi|29468|emb|CAA35940.1| beta-myosin heavy chain (1151 AA) [Homo... 35 1.4
gi|22299718|ref|NP_682965.1| ORF_ID:tlr2175~hypothetical protein... 35 1.4
gi|50744526|ref|XP_419763.1| PREDICTED: similar to chromosome 6 ... 34 1.9
gi|13279188|gb|AAH04307.1| Unknown (protein for IMAGE:3626861) [... 34 1.9
gi|50727981|ref|XP_415936.1| PREDICTED: similar to kinesin famil... 34 1.9
gi|50258855|gb|EAL21538.1| hypothetical protein CNBD0060 [Crypto... 34 1.9
gi|38101341|gb|EAA48320.1| hypothetical protein MG10579.4 [Magna... 34 1.9
gi|4502781|ref|NP_001804.1| centromere protein E; Centromere aut... 34 1.9
gi|382658|prf||1819485A CENP-E protein 34 1.9
gi|38089551|ref|XP_150129.2| hypothetical protein XP_150129 [Mus... 34 1.9
gi|677198|gb|AAB00143.1| putative 34 1.9
gi|28958135|gb|AAH47248.1| LOC397994 protein [Xenopus laevis] 34 1.9
gi|49257704|gb|AAH74454.1| LOC397994 protein [Xenopus laevis] 34 1.9
gi|18858755|ref|NP_571107.1| gefiltin [Danio rerio] >gnl|BL_ORD_... 34 1.9
gi|15606061|ref|NP_213438.1| chromosome assembly protein homolog... 34 1.9
gi|5453820|ref|NP_006176.1| nuclear mitotic apparatus protein 1 ... 34 1.9
gi|23500423|ref|NP_699863.1| hydantoinase/oxoprolinase family pr... 34 1.9
gi|50400858|sp|Q14980|NUMA_HUMAN Nuclear mitotic apparatus prote... 34 1.9
gi|743447|prf||2012303A SP-H antigen 34 1.9
gi|34852545|ref|XP_342148.1| similar to Hypothetical protein C6o... 34 1.9
gi|2062609|gb|AAB53389.1| middle molecular weight neurofilament ... 34 1.9
gi|15082250|ref|NP_149989.1| hypothetical protein LOC92922 [Homo... 34 1.9
gi|11276955|pir||A59236 embryonic muscle myosin heavy chain - se... 34 1.9
gi|3089532|gb|AAC38417.1| gas vesicle protein GvpQ [Bacillus meg... 34 1.9
gi|23593265|ref|NP_472954.2| hypothetical protein [Plasmodium fa... 34 2.4
gi|139510|sp|P04514|VN34_ROTBU NONSTRUCTURAL RNA-BINDING PROTEIN... 34 2.4
gi|24647347|ref|NP_732109.1| CG31045-PB [Drosophila melanogaster... 34 2.4
gi|47211795|emb|CAF93709.1| unnamed protein product [Tetraodon n... 34 2.4
gi|50748602|ref|XP_421320.1| PREDICTED: similar to DVL-binding p... 34 2.4
gi|47216948|emb|CAG04890.1| unnamed protein product [Tetraodon n... 34 2.4
gi|6320145|ref|NP_010225.1| involved intracellular protein trans... 34 2.4
gi|6752399|gb|AAF27710.1| PspA [Streptococcus pneumoniae] 34 2.4
gi|137175|sp|P25386|USO1_YEAST Intracellular protein transport p... 34 2.4
gi|15240464|ref|NP_198075.1| expressed protein [Arabidopsis thal... 34 2.4
gi|41688313|dbj|BAD08664.1| FYVE and coiled-coil domain containi... 34 2.4
gi|7513292|pir||T13163 Rab6 GTPase activating protein, GAPCenA -... 34 2.4
gi|7494376|pir||E71622 probable membrane associated protein PFB0... 34 2.4
gi|4884413|emb|CAB43313.1| hypothetical protein [Homo sapiens] 34 2.4
gi|24647349|ref|NP_732110.1| CG31045-PC [Drosophila melanogaster... 34 2.4
gi|333818|gb|AAA47317.1| glycoprotein 34 2.4
gi|50749502|ref|XP_421665.1| PREDICTED: similar to hypothetical ... 34 2.4
gi|1903280|emb|CAA98620.1| USO1 [Saccharomyces cerevisiae] 34 2.4
gi|49641|emb|CAA30256.1| beta-myosin heavy chain (974 AA); S2 fr... 34 2.4
gi|49899027|gb|AAH76726.1| Unknown (protein for MGC:81254) [Xeno... 34 2.4
gi|3041706|sp|P13533|MYH6_HUMAN Myosin heavy chain, cardiac musc... 34 2.4
gi|27764861|ref|NP_002462.1| myosin heavy chain 6; myosin heavy ... 34 2.4
gi|28829643|gb|AAO52159.1| similar to C25A11.4b.p [Caenorhabditi... 34 2.4
gi|8393817|ref|NP_058779.1| myosin 5B; Myosin of the dilute-myos... 34 2.4
gi|41688293|dbj|BAD08647.1| FYVE and coiled-coil domain containi... 34 2.4
gi|34922648|sp|Q9PTG8|MASK_XENLA CPEB-associated factor Maskin (... 34 2.4
gi|42820768|emb|CAF32081.1| spindle-related protein, putative [A... 34 2.4
gi|34867628|ref|XP_343311.1| similar to tubulin, gamma complex a... 34 2.4
gi|50419075|ref|XP_458060.1| unnamed protein product [Debaryomyc... 34 2.4
gi|31198815|ref|XP_308355.1| ENSANGP00000009410 [Anopheles gambi... 34 2.4
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa... 34 2.4
gi|34851236|ref|XP_341642.1| hypothetical protein XP_341641 [Rat... 34 2.4
gi|48477772|ref|YP_023478.1| hypothetical phosphoserine phosphat... 34 2.4
gi|31198813|ref|XP_308354.1| ENSANGP00000024069 [Anopheles gambi... 34 2.4
gi|12060489|dbj|BAB20630.1| myosin heavy chain slow isoform [Sus... 34 2.4
gi|41386711|ref|NP_777152.1| myosin, heavy polypeptide 7, cardia... 34 2.4
gi|48128426|ref|XP_396629.1| similar to ENSANGP00000020736 [Apis... 34 2.4
gi|21907902|dbj|BAC05681.1| myosin heavy chain slow [Equus cabal... 34 2.4
gi|24647343|ref|NP_732107.1| CG31045-PE [Drosophila melanogaster... 34 2.4
gi|18859641|ref|NP_542766.1| myosin, heavy polypeptide 7, cardia... 34 2.4
gi|12232373|ref|NP_036329.2| RAB GTPase activating protein 1; ra... 34 2.4
gi|25010035|gb|AAN71183.1| GH16009p [Drosophila melanogaster] 34 2.4
gi|34098395|sp|O97961|KTN1_VULVU Kinectin >gnl|BL_ORD_ID|905221 ... 34 2.4
gi|24647345|ref|NP_732108.1| CG31045-PA [Drosophila melanogaster... 34 2.4
gi|6320562|ref|NP_010643.1| may be involved in connecting nuclea... 33 3.2
gi|27436951|ref|NP_116126.2| lamin B2 [Homo sapiens] >gnl|BL_ORD... 33 3.2
gi|42566188|ref|NP_567176.2| XH/XS domain-containing protein / X... 33 3.2
gi|34895474|ref|NP_909080.1| putative transcription factor [Oryz... 33 3.2
gi|17570377|ref|NP_510801.1| predicted CDS, putative protein, wi... 33 3.2
gi|3915779|sp|P13539|MYH6_MESAU Myosin heavy chain, cardiac musc... 33 3.2
gi|50551299|ref|XP_503123.1| hypothetical protein [Yarrowia lipo... 33 3.2
gi|191622|gb|AAA37161.1| alpha cardiac myosin heavy chain 33 3.2
gi|191618|gb|AAA37159.1| alpha cardiac myosin heavy chain 33 3.2
gi|8393804|ref|NP_058935.1| myosin heavy chain, polypeptide 6; m... 33 3.2
gi|18313233|ref|NP_559900.1| conserved hypothetical protein [Pyr... 33 3.2
gi|6754774|ref|NP_034986.1| myosin, heavy polypeptide 6, cardiac... 33 3.2
gi|47221621|emb|CAF97886.1| unnamed protein product [Tetraodon n... 33 3.2
gi|1709011|sp|P55080|MFA1_CHICK MICROFIBRILLAR-ASSOCIATED PROTEI... 33 3.2
gi|46228494|gb|EAK89364.1| coiled coil protein [Cryptosporidium ... 33 3.2
gi|20093560|ref|NP_613407.1| Uncharacterized archaeal coiled-coi... 33 3.2
gi|542617|pir||S41720 intermediate filament - goldfish >gnl|BL_O... 33 3.2
gi|32880115|gb|AAP88888.1| lamin B2 [synthetic construct] 33 3.2
gi|41055088|ref|NP_956900.1| hypothetical protein MGC63562 [Dani... 33 3.2
gi|48143507|ref|XP_397439.1| similar to ENSANGP00000015381 [Apis... 33 3.2
gi|46156679|ref|ZP_00132327.2| COG4942: Membrane-bound metallope... 33 4.2
gi|18676654|dbj|BAB84979.1| FLJ00226 protein [Homo sapiens] 33 4.2
gi|18976442|ref|NP_577799.1| hypothetical protein PF0070 [Pyroco... 33 4.2
gi|31874769|emb|CAD98084.1| hypothetical protein [Homo sapiens] 33 4.2
gi|46229636|gb|EAK90454.1| ubiqutin C-terminal hydrolase of the ... 33 4.2
gi|48097505|ref|XP_393804.1| similar to ENSANGP00000020894 [Apis... 33 4.2
gi|22538387|ref|NP_005742.4| A-kinase anchor protein 9 isoform 2... 33 4.2
gi|3882327|dbj|BAA34523.1| KIAA0803 protein [Homo sapiens] 33 4.2
gi|34852775|ref|XP_226624.2| similar to RNA polymerase II elonga... 33 4.2
gi|34485652|gb|AAQ73211.1| M protein [Streptococcus pyogenes] 33 4.2
gi|48106337|ref|XP_396089.1| similar to CG5020-PB [Apis mellifera] 33 4.2
gi|13385542|ref|NP_085043.1| Fos-related antigen [Mus musculus] ... 33 4.2
gi|38073584|ref|XP_129608.2| similar to Beclin 1 (Coiled-coil my... 33 4.2
gi|4584423|emb|CAB40713.1| AKAP450 protein [Homo sapiens] 33 4.2
gi|46439921|gb|EAK99233.1| hypothetical protein CaO19.3342 [Cand... 33 4.2
gi|48097142|ref|XP_393700.1| similar to ENSANGP00000020478 [Apis... 33 4.2
gi|46434778|gb|EAK94179.1| hypothetical protein CaO19.9948 [Cand... 33 4.2
gi|46229652|gb|EAK90470.1| hypothetical low complexity protein w... 33 4.2
gi|17988947|ref|NP_541580.1| N-methylhydantoinase (ATP-hydrolyzi... 33 4.2
gi|46441069|gb|EAL00369.1| hypothetical protein CaO19.13026 [Can... 33 4.2
gi|5733814|gb|AAD49746.1| angiotensin II AT2 receptor-interactin... 33 4.2
gi|23481378|gb|EAA17676.1| sf-assemblin, putative [Plasmodium yo... 33 4.2
gi|46440946|gb|EAL00247.1| hypothetical protein CaO19.5580 [Cand... 33 4.2
gi|50765787|ref|XP_422977.1| PREDICTED: similar to M-phase phosp... 33 4.2
gi|31199853|ref|XP_308874.1| ENSANGP00000005723 [Anopheles gambi... 33 4.2
gi|5106478|gb|AAD39719.1| splice variant AKAP350 [Homo sapiens] 33 4.2
gi|49478913|ref|YP_037909.1| chromosome segregation SMC protein ... 33 4.2
gi|15828750|ref|NP_326110.1| conserved hypothetical protein [Myc... 33 4.2
gi|21401832|ref|NP_657817.1| SMC_C, SMC family, C-terminal domai... 33 4.2
gi|31077259|gb|EAA46385.1| GLP_165_137478_134932 [Giardia lambli... 33 4.2
gi|7512962|pir||T00637 hypothetical protein H_GS541B18.1 - human... 33 4.2
gi|50755194|ref|XP_414646.1| PREDICTED: similar to Kinesin-like ... 33 4.2
gi|19924143|ref|NP_361013.1| leucine zipper protein 1 [Homo sapi... 33 4.2
gi|4558862|gb|AAD22767.1| A-kinase anchoring protein AKAP350 [Ho... 33 4.2
gi|50548687|ref|XP_501813.1| hypothetical protein [Yarrowia lipo... 33 4.2
gi|16082450|ref|NP_394939.1| conserved hypothetical protein [The... 33 4.2
gi|30142004|gb|AAB96867.2| unknown [Homo sapiens] 33 4.2
gi|30354561|gb|AAH51733.1| LUZP1 protein [Homo sapiens] 33 4.2
gi|48096455|ref|XP_392460.1| similar to BMKETTIN [Apis mellifera] 33 4.2
gi|15239023|ref|NP_199671.1| structural maintenance of chromosom... 33 4.2
gi|22538391|ref|NP_671700.1| A-kinase anchor protein 9 isoform 1... 33 4.2
gi|48094742|ref|XP_392176.1| similar to Rho-kinase [Apis mellifera] 33 4.2
gi|39582452|emb|CAE66543.1| Hypothetical protein CBG11851 [Caeno... 33 4.2
gi|11493732|gb|AAG35627.1| stathmin-1 [Drosophila melanogaster] 33 4.2
gi|46434724|gb|EAK94126.1| hypothetical protein CaO19.2410 [Cand... 33 4.2
gi|46107656|ref|XP_380887.1| hypothetical protein FG00711.1 [Gib... 33 4.2
gi|22538393|ref|NP_671714.1| A-kinase anchor protein 9 isoform 3... 33 4.2
gi|5051743|dbj|BAA78718.1| Centrosome- and Golgi-localized PKN-a... 33 4.2
gi|47087361|ref|NP_998576.1| zgc:66400 [Danio rerio] >gnl|BL_ORD... 33 5.5
gi|32352206|dbj|BAC78596.1| hypothetical protein [Oryza sativa (... 33 5.5
gi|50755071|ref|XP_414610.1| PREDICTED: similar to RUN and FYVE ... 33 5.5
gi|14520349|ref|NP_125824.1| hypothetical protein PAB0081 [Pyroc... 33 5.5
gi|22024255|ref|NP_611787.2| CG3493-PA [Drosophila melanogaster]... 33 5.5
gi|50289577|ref|XP_447220.1| unnamed protein product [Candida gl... 33 5.5
gi|18447644|gb|AAL68382.1| SD05887p [Drosophila melanogaster] 33 5.5
gi|17552446|ref|NP_497712.1| putative nuclear protein, with 2 co... 33 5.5
gi|47209228|emb|CAF93215.1| unnamed protein product [Tetraodon n... 33 5.5
gi|47211792|emb|CAF93706.1| unnamed protein product [Tetraodon n... 33 5.5
gi|17535513|ref|NP_496326.1| homeobox protein (2L101) [Caenorhab... 33 5.5
gi|46226867|gb|EAK87833.1| predicted coiled-coil protein [Crypto... 33 5.5
gi|38100516|gb|EAA47632.1| hypothetical protein MG02875.4 [Magna... 33 5.5
gi|13173401|gb|AAK14392.1| kinesin-like protein Ldklp1 [Lymantri... 33 5.5
gi|15672215|ref|NP_266389.1| hypothetical protein L32072 [Lactoc... 33 5.5
gi|23612234|ref|NP_703814.1| ribonuclease, putative [Plasmodium ... 33 5.5
gi|17543560|ref|NP_500814.1| predicted CDS, putative cytoplasmic... 33 5.5
gi|49523259|gb|AAH75407.1| Unknown (protein for MGC:89159) [Xeno... 33 5.5
gi|8393807|ref|NP_058936.1| myosin heavy chain, polypeptide 7; m... 33 5.5
gi|47223930|emb|CAG06107.1| unnamed protein product [Tetraodon n... 33 5.5
gi|47210347|emb|CAF90604.1| unnamed protein product [Tetraodon n... 32 7.1
gi|19922664|ref|NP_611545.1| CG4030-PA [Drosophila melanogaster]... 32 7.1
gi|50355643|dbj|BAD29962.1| Be158 [Babesia equi] 32 7.1
gi|42563510|ref|NP_187147.2| expressed protein [Arabidopsis thal... 32 7.1
gi|31542083|ref|NP_849233.2| mitochondrial tumor suppressor gene... 32 7.1
gi|50757619|ref|XP_415580.1| PREDICTED: similar to myosin, heavy... 32 7.1
gi|29347341|ref|NP_810844.1| putative type IIS restriction/modif... 32 7.1
gi|10045222|emb|CAC07820.1| tetrin C protein [Tetrahymena thermo... 32 7.1
gi|50765313|ref|XP_422967.1| PREDICTED: similar to mitotic kines... 32 7.1
gi|38345753|emb|CAE03481.2| OSJNBa0065O17.6 [Oryza sativa (japon... 32 7.1
gi|23481897|gb|EAA18039.1| hypothetical protein [Plasmodium yoel... 32 7.1
gi|27694047|gb|AAH43321.1| Mtus1 protein [Mus musculus] >gnl|BL_... 32 7.1
gi|6752417|gb|AAF27719.1| PspA [Streptococcus pneumoniae] 32 7.1
gi|22095371|ref|NP_079434.2| RUN and FYVE domain-containing 1 [H... 32 7.1
gi|26327547|dbj|BAC27517.1| unnamed protein product [Mus musculus] 32 7.1
gi|34870697|ref|XP_340795.1| similar to RUN and FYVE domain cont... 32 7.1
gi|41150991|ref|XP_371164.1| NYD-SP11 protein [Homo sapiens] 32 7.1
gi|10438562|dbj|BAB15276.1| unnamed protein product [Homo sapiens] 32 7.1
gi|2119533|pir||I52300 giantin - human >gnl|BL_ORD_ID|1705043 gi... 32 7.1
gi|48527525|gb|AAT45894.1| ATBP135 [Mus musculus] 32 7.1
gi|34902454|ref|NP_912573.1| Putative receptor-like protein kina... 32 7.1
gi|34878530|ref|XP_341243.1| similar to ERIC1 [Rattus norvegicus] 32 7.1
gi|12322862|gb|AAG51424.1| hypothetical protein; 31126-29176 [Ar... 32 7.1
gi|34783674|gb|AAH57235.1| HMMR protein [Homo sapiens] 32 7.1
gi|26326505|dbj|BAC26996.1| unnamed protein product [Mus musculus] 32 7.1
gi|29725654|gb|AAO88908.1| MTSG1 [Mus musculus] >gnl|BL_ORD_ID|1... 32 7.1
gi|12666349|emb|CAC27831.1| ATP synthase A chain subunit 6 [Drep... 32 7.1
gi|37540570|ref|XP_209941.2| similar to CG17122-PA [Homo sapiens] 32 7.1
gi|25050385|ref|XP_132976.3| C1q domain containing 1 [Mus musculus] 32 7.1
gi|32419136|ref|XP_330046.1| hypothetical protein [Neurospora cr... 32 7.1
gi|6752415|gb|AAF27718.1| PspA [Streptococcus pneumoniae] 32 7.1
gi|45658148|ref|YP_002234.1| conserved hypothetical protein [Lep... 32 7.1
gi|27227803|emb|CAD59410.1| SMC2 protein [Oryza sativa] 32 7.1
gi|46110056|ref|XP_382086.1| hypothetical protein FG01910.1 [Gib... 32 7.1
gi|38566922|emb|CAE76225.1| related to putative cytoplasmic stru... 32 7.1
gi|47125402|gb|AAH70281.1| HMMR protein [Homo sapiens] 32 7.1
gi|7108351|ref|NP_036617.1| hyaluronan-mediated motility recepto... 32 7.1
gi|1263014|gb|AAB03086.1| emm18.1 gene product 32 7.1
gi|50760451|ref|XP_418028.1| PREDICTED: similar to Protein kinas... 32 7.1
gi|31377634|ref|NP_443173.2| guanylate binding protein 4 [Homo s... 32 7.1
gi|47123304|gb|AAH70055.1| Guanylate binding protein 4 [Homo sap... 32 7.1
gi|47210310|emb|CAF92125.1| unnamed protein product [Tetraodon n... 32 7.1
gi|23379831|gb|AAM88910.1| fast myosin heavy chain HCIII [Gallus... 32 7.1
gi|50425095|ref|XP_461139.1| unnamed protein product [Debaryomyc... 32 7.1
gi|7108349|ref|NP_036616.1| hyaluronan-mediated motility recepto... 32 7.1
gi|34858244|ref|XP_345250.1| similar to KIAA0460 protein [Rattus... 32 7.1
gi|4758454|ref|NP_004478.1| golgi autoantigen, golgin subfamily ... 32 7.1
gi|34880469|ref|XP_222745.2| similar to nuclear pore complex-ass... 32 7.1
gi|50759530|ref|XP_417680.1| PREDICTED: similar to NF-M protein ... 32 7.1
gi|18391490|ref|NP_563924.1| nuclear matrix constituent protein-... 32 7.1
gi|37360584|dbj|BAC98270.1| mKIAA1873 protein [Mus musculus] 32 7.1
gi|4249701|gb|AAD13772.1| myosin heavy chain [Rana catesbeiana] 32 9.3
gi|48853927|ref|ZP_00308092.1| COG1196: Chromosome segregation A... 32 9.3
gi|38045894|ref|NP_829882.1| Rab6-interacting protein 2 isoform ... 32 9.3
gi|37595290|gb|AAQ94530.1| M protein [Streptococcus pyogenes] 32 9.3
gi|34866378|ref|XP_236648.2| similar to huntingtin interacting p... 32 9.3
gi|48853839|ref|ZP_00308005.1| hypothetical protein Chut02003485... 32 9.3
gi|24646174|ref|NP_650144.1| CG3532-PA [Drosophila melanogaster]... 32 9.3
gi|37725003|gb|AAO25635.1| TACC3 [Oryctolagus cuniculus] 32 9.3
gi|29788770|ref|NP_598708.2| nuclear mitotic apparatus protein 1... 32 9.3
gi|37595318|gb|AAQ94544.1| M protein [Streptococcus pyogenes] 32 9.3
gi|17531553|ref|NP_495637.1| putative nuclear protein, with 5 co... 32 9.3
gi|3041708|sp|P13540|MYH7_MESAU Myosin heavy chain, cardiac musc... 32 9.3
gi|50747190|ref|XP_420777.1| PREDICTED: similar to RIKEN cDNA 57... 32 9.3
gi|7023532|dbj|BAA91995.1| unnamed protein product [Homo sapiens... 32 9.3
gi|92758|pir||A32612 spectrin alpha chain, nonerythroid - rat (f... 32 9.3
gi|14134110|gb|AAK54244.1| centrosome-associated AKAP350-binding... 32 9.3
gi|20978622|sp|Q96YR5|RA50_SULTO DNA double-strand break repair ... 32 9.3
gi|2135413|pir||JC5016 hyaluronan receptor - human 32 9.3
gi|49522776|gb|AAH74325.1| Unknown (protein for MGC:84152) [Xeno... 32 9.3
gi|33589856|ref|NP_878905.1| kinesin family member 9; kinesin pr... 32 9.3
gi|16716511|ref|NP_444434.1| Rab6-interacting protein 2 [Mus mus... 32 9.3
gi|19746911|ref|NP_608047.1| M18 protein precursor [Streptococcu... 32 9.3
gi|50120358|ref|YP_049525.1| tyrosine-protein kinase [Erwinia ca... 32 9.3
gi|45383211|ref|NP_989809.1| Nuf2 protein [Gallus gallus] >gnl|B... 32 9.3
gi|50365013|ref|YP_053438.1| unknown transmembrane protein [Meso... 32 9.3
gi|29246067|gb|EAA37678.1| GLP_171_8870_6279 [Giardia lamblia AT... 32 9.3
gi|37595278|gb|AAQ94524.1| M protein [Streptococcus pyogenes] 32 9.3
gi|40255143|ref|NP_078857.3| chromosome 6 open reading frame 60 ... 32 9.3
gi|38045892|ref|NP_829881.1| Rab6-interacting protein 2 isoform ... 32 9.3
gi|47228489|emb|CAG05309.1| unnamed protein product [Tetraodon n... 32 9.3
gi|47224483|emb|CAG08733.1| unnamed protein product [Tetraodon n... 32 9.3
gi|50405259|ref|YP_054351.1| Guanylate nucleotide binding protei... 32 9.3
gi|41406064|ref|NP_005955.1| myosin, heavy polypeptide 10, non-m... 32 9.3
gi|1346640|sp|P35580|MYHA_HUMAN Myosin heavy chain, nonmuscle ty... 32 9.3
gi|21750108|dbj|BAC03719.1| unnamed protein product [Homo sapiens] 32 9.3
gi|38091397|ref|XP_205737.3| RIKEN cDNA B230396K10 gene [Mus mus... 32 9.3
gi|45387543|ref|NP_991115.1| Unknown (protein for MGC:77294); wu... 32 9.3
gi|29653880|ref|NP_819572.1| SMC family protein [Coxiella burnet... 32 9.3
gi|1083152|pir||S49154 embryonic/neonatal myosin heavy chain - r... 32 9.3
gi|34485650|gb|AAQ73210.1| M protein [Streptococcus pyogenes] 32 9.3
gi|15922434|ref|NP_378103.1| 882aa long hypothetical purine NTPa... 32 9.3
gi|30912698|sp|Q8NB25|CF60_HUMAN Hypothetical protein C6orf60 32 9.3
gi|31874640|emb|CAD98058.1| hypothetical protein [Homo sapiens] 32 9.3
gi|34364814|emb|CAE45844.1| hypothetical protein [Homo sapiens] 32 9.3
gi|20521758|dbj|BAA83033.2| KIAA1081 protein [Homo sapiens] 32 9.3
>gi|17506363|ref|NP_492303.1| cell division cycle 5-like (85.7 kD)
(1J71) [Caenorhabditis elegans]
gi|7498153|pir||T20320 hypothetical protein D1081.8 - Caenorhabditis
elegans
gi|3875326|emb|CAB00029.1| Hypothetical protein D1081.8
[Caenorhabditis elegans]
gi|3878165|emb|CAB00038.1| Hypothetical protein D1081.8
[Caenorhabditis elegans]
Length = 755
Score = 399 bits (1025), Expect = e-110
Identities = 201/201 (100%), Positives = 201/201 (100%)
Frame = +3
Query: 3 MSKLLAWDVDNKPPSVIYSREELDAAADLIKQEAESGPELNSLMWKVVEQCTSEIILSKD 182
MSKLLAWDVDNKPPSVIYSREELDAAADLIKQEAESGPELNSLMWKVVEQCTSEIILSKD
Sbjct: 555 MSKLLAWDVDNKPPSVIYSREELDAAADLIKQEAESGPELNSLMWKVVEQCTSEIILSKD 614
Query: 183 KFTRIAILPREEQMKALNDEFQMYRGWMNQRAKRAAKVEKKLRVKLGGYQAIHDKLCKKY 362
KFTRIAILPREEQMKALNDEFQMYRGWMNQRAKRAAKVEKKLRVKLGGYQAIHDKLCKKY
Sbjct: 615 KFTRIAILPREEQMKALNDEFQMYRGWMNQRAKRAAKVEKKLRVKLGGYQAIHDKLCKKY 674
Query: 363 QEVTTEIEMANIEKKTFERLGEHELKAINKRVGRLQQEVTTQETREKDLQKMYSKLSNKQ 542
QEVTTEIEMANIEKKTFERLGEHELKAINKRVGRLQQEVTTQETREKDLQKMYSKLSNKQ
Sbjct: 675 QEVTTEIEMANIEKKTFERLGEHELKAINKRVGRLQQEVTTQETREKDLQKMYSKLSNKQ 734
Query: 543 WKLSQIEIHDAASTTSAPITY 605
WKLSQIEIHDAASTTSAPITY
Sbjct: 735 WKLSQIEIHDAASTTSAPITY 755