Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= K02A11_5
(331 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17506867|ref|NP_492591.1| PP2A-B regulatory subunit PR55/B, S... 229 1e-59
gi|39595198|emb|CAE60235.1| Hypothetical protein CBG03807 [Caeno... 196 7e-50
gi|31209667|ref|XP_313800.1| ENSANGP00000011674 [Anopheles gambi... 84 5e-16
gi|31209669|ref|XP_313801.1| ENSANGP00000023152 [Anopheles gambi... 84 5e-16
gi|17136742|ref|NP_476880.1| CG6235-PA [Drosophila melanogaster]... 82 3e-15
gi|290260|gb|AAA99871.1| phosphoprotein phosphatase 2A 55 kDa re... 82 3e-15
gi|17136744|ref|NP_476881.1| CG6235-PE [Drosophila melanogaster]... 82 3e-15
gi|48098473|ref|XP_394082.1| similar to ENSANGP00000011674 [Apis... 81 5e-15
gi|38076365|ref|XP_127816.2| alpha isoform of regulatory subunit... 76 2e-13
gi|12845784|dbj|BAB26898.1| unnamed protein product [Mus musculus] 76 2e-13
gi|16758910|ref|NP_446451.1| alpha isoform of regulatory subunit... 76 2e-13
gi|4506019|ref|NP_002708.1| alpha isoform of regulatory subunit ... 76 2e-13
gi|50759516|ref|XP_417674.1| PREDICTED: similar to alpha isoform... 76 2e-13
gi|47507401|gb|AAH70965.1| PP2A protein [Xenopus laevis] 75 4e-13
gi|7512187|pir||S65951 [phosphorylase] phosphatase (EC 3.1.3.17)... 75 4e-13
gi|963087|emb|CAA56714.1| phosphorylase phosphatase [Xenopus lae... 75 4e-13
gi|47086277|ref|NP_998045.1| hypothetical protein zgc:76887 [Dan... 74 6e-13
gi|206297|gb|AAA41909.1| protein phosphatase 2A 55 kD regulatory... 74 7e-13
gi|41054269|ref|NP_956070.1| Unknown (protein for MGC:63780); wu... 74 7e-13
gi|49022892|dbj|BAC98196.2| mKIAA1541 protein [Mus musculus] 73 2e-12
gi|22726177|ref|NP_080667.1| protein phosphatase 2A, regulatory ... 73 2e-12
gi|21426767|ref|NP_653347.1| protein phosphatase 2A B regulatory... 73 2e-12
gi|47210286|emb|CAF93639.1| unnamed protein product [Tetraodon n... 73 2e-12
gi|50749997|ref|XP_421828.1| PREDICTED: similar to protein phosp... 73 2e-12
gi|28175273|gb|AAH45219.1| MGC53013 protein [Xenopus laevis] 72 2e-12
gi|47222305|emb|CAG05054.1| unnamed protein product [Tetraodon n... 72 2e-12
gi|49522596|gb|AAH75402.1| Unknown (protein for MGC:89145) [Xeno... 71 5e-12
gi|19113873|ref|NP_592961.1| protein phosphatase pp2a regulatory... 68 4e-11
gi|974195|dbj|BAA09945.1| protein phosphatase 2A 55kD regulatory... 68 4e-11
gi|30575397|gb|AAP33142.1| protein phosphatase 2A regulatory sub... 66 2e-10
gi|21312161|ref|NP_082668.1| RIKEN cDNA 2900026H06 [Mus musculus... 66 2e-10
gi|49087510|ref|XP_405682.1| hypothetical protein AN1545.2 [Aspe... 66 2e-10
gi|50412815|ref|XP_457167.1| unnamed protein product [Debaryomyc... 66 2e-10
gi|32423263|ref|XP_332069.1| hypothetical protein ( (AF077355) p... 66 2e-10
gi|4322265|gb|AAD15986.1| protein phosphatase 2A regulatory B su... 66 2e-10
gi|46444349|gb|EAL03624.1| hypothetical protein CaO19.9043 [Cand... 65 3e-10
gi|49078460|ref|XP_402980.1| hypothetical protein UM05365.1 [Ust... 64 8e-10
gi|50747248|ref|XP_420804.1| PREDICTED: similar to gamma isoform... 64 1e-09
gi|50257644|gb|EAL20349.1| hypothetical protein CNBF1600 [Crypto... 64 1e-09
gi|47522872|ref|NP_999190.1| protein phosphatase 2A 55 kDa regul... 63 1e-09
gi|26347737|dbj|BAC37517.1| unnamed protein product [Mus musculus] 63 2e-09
gi|12857690|dbj|BAB31079.1| unnamed protein product [Mus musculus] 63 2e-09
gi|11094369|gb|AAG29595.1| Ser/Thr specific protein phosphatase ... 63 2e-09
gi|50293265|ref|XP_449044.1| unnamed protein product [Candida gl... 63 2e-09
gi|423718|pir||S33257 phosphoprotein phosphatase (EC 3.1.3.16) 2... 63 2e-09
gi|1702998|sp|P53031|2ABA_CANTR Protein phosphatase PP2A regulat... 63 2e-09
gi|4758954|ref|NP_004567.1| beta isoform of regulatory subunit B... 63 2e-09
gi|11559986|ref|NP_071545.1| BRbeta B-regulatory subunit of prot... 63 2e-09
gi|16923962|ref|NP_476457.1| protein phosphatase 2 (formerly 2A)... 60 8e-09
gi|27370502|ref|NP_766582.1| RIKEN cDNA 6330548O06 [Mus musculus... 60 8e-09
gi|29248798|gb|EAA40324.1| GLP_464_58737_60155 [Giardia lamblia ... 60 8e-09
gi|5902681|sp|Q29090|2ABA_PIG Serine/threonine protein phosphata... 60 1e-08
gi|50257645|gb|EAL20350.1| hypothetical protein CNBF1600 [Crypto... 60 1e-08
gi|32967588|ref|NP_065149.2| gamma isoform of regulatory subunit... 60 1e-08
gi|19865481|sp|Q9Y2T4|2ABG_HUMAN Serine/threonine protein phosph... 60 1e-08
gi|1703001|sp|P50410|2ABG_RABIT Serine/threonine protein phospha... 60 1e-08
gi|33150802|gb|AAP97279.1| protein phosphatase 2A1 B gamma subun... 60 1e-08
gi|6321248|ref|NP_011325.1| Non-essential regulatory subunit B o... 60 1e-08
gi|171195|gb|AAA34482.1| CDC55 60 1e-08
gi|1143558|emb|CAA62785.1| cell division control protein CDC55 [... 60 1e-08
gi|50755236|ref|XP_414666.1| PREDICTED: similar to RIKEN cDNA 29... 59 2e-08
gi|50310939|ref|XP_455492.1| unnamed protein product [Kluyveromy... 59 2e-08
gi|32307121|ref|NP_858064.1| beta isoform of regulatory subunit ... 59 2e-08
gi|26984174|gb|AAN85209.1| serine-threonine protein phosphatase ... 59 2e-08
gi|21314523|gb|AAM46987.1| protein phosphatase 2A regulatory PR5... 59 3e-08
gi|38108901|gb|EAA54846.1| hypothetical protein MG05637.4 [Magna... 59 3e-08
gi|11094371|gb|AAG29596.1| Ser/Thr specific protein phosphatase ... 58 5e-08
gi|32967593|ref|NP_870991.1| gamma isoform of regulatory subunit... 58 5e-08
gi|16041100|dbj|BAB69717.1| hypothetical protein [Macaca fascicu... 58 5e-08
gi|45198713|ref|NP_985742.1| AFR195Wp [Eremothecium gossypii] >g... 58 5e-08
gi|32307119|ref|NP_858063.1| beta isoform of regulatory subunit ... 57 7e-08
gi|30685484|ref|NP_849681.1| serine/threonine protein phosphatas... 57 9e-08
gi|18394522|ref|NP_564033.1| serine/threonine protein phosphatas... 57 9e-08
gi|47215672|emb|CAG04756.1| unnamed protein product [Tetraodon n... 56 2e-07
gi|7512177|pir||JC5417 phosphoprotein phosphatase (EC 3.1.3.16) ... 56 2e-07
gi|1783183|dbj|BAA19100.1| protein phosphatase 2A regulatory sub... 56 2e-07
gi|21432089|gb|AAH32954.1| PPP2R2C protein [Homo sapiens] 56 2e-07
gi|1362003|pir||S55889 protein phosphatase 2A B regulatory chain... 56 2e-07
gi|18403637|ref|NP_564595.1| serine/threonine protein phosphatas... 56 2e-07
gi|42571825|ref|NP_974003.1| serine/threonine protein phosphatas... 56 2e-07
gi|46108974|ref|XP_381545.1| hypothetical protein FG01369.1 [Gib... 55 3e-07
gi|4768953|gb|AAD29694.1| protein phosphatase 2A 55 kDa regulato... 55 5e-07
gi|7959349|dbj|BAA96065.1| KIAA1541 protein [Homo sapiens] 55 5e-07
gi|5566469|gb|AAD45396.1| protein phosphatase 2A B55 regulatory ... 55 5e-07
gi|4454851|gb|AAD20987.1| protein phosphatase 2A BR gamma subuni... 55 5e-07
gi|46805644|dbj|BAD17063.1| putative Ser/Thr specific protein ph... 54 8e-07
gi|34912344|ref|NP_917519.1| putative Ser/Thr specific protein p... 54 8e-07
gi|7489549|pir||T02952 probable protein phosphatase 2A B regulat... 54 8e-07
gi|47216816|emb|CAG10138.1| unnamed protein product [Tetraodon n... 54 1e-06
gi|47216105|emb|CAG11173.1| unnamed protein product [Tetraodon n... 52 2e-06
gi|231447|sp|Q00006|2ABB_RABIT Serine/threonine protein phosphat... 49 2e-05
gi|109354|pir||C38351 phosphoprotein phosphatase (EC 3.1.3.16) 2... 47 7e-05
gi|29250537|gb|EAA42029.1| GLP_68_30856_29159 [Giardia lamblia A... 41 0.007
gi|49073338|ref|XP_400895.1| hypothetical protein UM03280.1 [Ust... 39 0.034
gi|45200863|ref|NP_986433.1| AGL234Wp [Eremothecium gossypii] >g... 38 0.058
gi|6319926|ref|NP_010007.1| General repressor of transcription (... 37 0.075
gi|173067|gb|AAA35182.1| TUP1 protein 37 0.075
gi|4460|emb|CAA34411.1| unnamed protein product [Saccharomyces c... 37 0.075
gi|9955107|pdb|1ERJ|A Chain A, Crystal Structure Of The C-Termin... 37 0.075
gi|31227743|ref|XP_317937.1| ENSANGP00000011371 [Anopheles gambi... 37 0.13
gi|31195843|ref|XP_306869.1| ENSANGP00000013761 [Anopheles gambi... 37 0.13
gi|21358407|ref|NP_648731.1| CG5114-PA [Drosophila melanogaster]... 37 0.13
gi|50257760|gb|EAL20461.1| hypothetical protein CNBE3820 [Crypto... 36 0.22
gi|46575873|dbj|BAB88914.2| WD-repeat protein [Burkholderia glumae] 36 0.22
gi|50286567|ref|XP_445712.1| unnamed protein product [Candida gl... 35 0.29
gi|32398937|emb|CAD98402.1| hypothetical predicted WD-40 repeat ... 35 0.37
gi|31199845|ref|XP_308870.1| ENSANGP00000021636 [Anopheles gambi... 35 0.37
gi|47218995|emb|CAG02033.1| unnamed protein product [Tetraodon n... 35 0.37
gi|46111239|ref|XP_382677.1| hypothetical protein FG02501.1 [Gib... 35 0.37
gi|31205449|ref|XP_311674.1| ENSANGP00000014929 [Anopheles gambi... 35 0.37
gi|34558177|ref|NP_907992.1| hypothetical protein WS1882 [Woline... 35 0.37
gi|19114472|ref|NP_593560.1| putative WD repeat stress protein [... 35 0.49
gi|25406125|pir||A96741 hypothetical protein F14O23.22 [imported... 35 0.49
gi|32406232|ref|XP_323729.1| predicted protein [Neurospora crass... 35 0.49
gi|30698820|ref|NP_177329.2| transducin family protein / WD-40 r... 35 0.49
gi|49108048|ref|XP_411585.1| hypothetical protein AN7448.2 [Aspe... 35 0.49
gi|33867013|ref|NP_898572.1| conserved hypothetical protein [Syn... 35 0.49
gi|50309847|ref|XP_454937.1| unnamed protein product [Kluyveromy... 35 0.49
gi|50746317|ref|XP_420440.1| PREDICTED: similar to LPS-responsiv... 34 0.64
gi|34905224|ref|NP_913959.1| P0672D01.14 [Oryza sativa (japonica... 34 0.64
gi|34857904|ref|XP_227491.2| similar to LBA [Rattus norvegicus] 34 0.64
gi|34855136|ref|XP_231599.2| similar to HSPC049 protein [Rattus ... 34 0.64
gi|49098364|ref|XP_410642.1| hypothetical protein AN6505.2 [Aspe... 34 0.64
gi|49081056|ref|XP_403977.1| hypothetical protein UM06362.1 [Ust... 34 0.64
gi|50728564|ref|XP_416180.1| PREDICTED: similar to HSPC049 prote... 34 0.64
gi|13507628|ref|NP_109620.1| LPS-responsive beige-like anchor [M... 34 0.64
gi|26327125|dbj|BAC27306.1| unnamed protein product [Mus musculus] 34 0.64
gi|11066216|gb|AAG28504.1| TUPA [Emericella nidulans] 34 0.64
gi|49115497|gb|AAH73405.1| Unknown (protein for MGC:80868) [Xeno... 34 0.83
gi|12843168|dbj|BAB25884.1| unnamed protein product [Mus musculus] 34 0.83
gi|19075235|ref|NP_587735.1| WD repeat protein [Schizosaccharomy... 34 0.83
gi|50287929|ref|XP_446393.1| unnamed protein product [Candida gl... 33 1.1
gi|12838350|dbj|BAB24172.1| unnamed protein product [Mus musculus] 33 1.1
gi|38077056|ref|XP_131185.2| RIKEN cDNA 1700006A11 [Mus musculus] 33 1.1
gi|39597052|emb|CAE59279.1| Hypothetical protein CBG02611 [Caeno... 33 1.1
gi|47207981|emb|CAF90920.1| unnamed protein product [Tetraodon n... 33 1.1
gi|45507307|ref|ZP_00159652.1| COG2319: FOG: WD40 repeat [Anabae... 33 1.4
gi|7499046|pir||T16064 hypothetical protein F13H8.2 - Caenorhabd... 33 1.4
gi|34557666|ref|NP_907481.1| hypothetical protein WS1305 [Woline... 33 1.4
gi|49389259|dbj|BAD25221.1| putative LvsC [Oryza sativa (japonic... 33 1.4
gi|45187738|ref|NP_983961.1| ADL135Cp [Eremothecium gossypii] >g... 33 1.4
gi|22969840|ref|ZP_00017055.1| hypothetical protein [Chloroflexu... 33 1.4
gi|4557229|ref|NP_001078.1| angio-associated, migratory cell pro... 33 1.9
gi|8885520|dbj|BAA97453.1| streptococcal hemagglutinin [Streptoc... 33 1.9
gi|18044384|gb|AAH20244.1| Similar to angio-associated, migrator... 33 1.9
gi|17944584|gb|AAL48179.1| SD01032p [Drosophila melanogaster] 33 1.9
gi|19921984|ref|NP_610600.1| CG11887-PA [Drosophila melanogaster... 33 1.9
gi|31044189|gb|AAO38199.1| angio-associated migratory cell prote... 33 1.9
gi|50311047|ref|XP_455547.1| TUP1_KLULA [Kluyveromyces lactis] >... 33 1.9
gi|2494900|sp|P56094|TUP1_KLULA Transcriptional repressor TUP1 >... 33 1.9
gi|22122619|ref|NP_666222.1| angio-associated migratory protein ... 33 1.9
gi|16904381|ref|NP_006717.1| LPS-responsive vesicle trafficking,... 33 1.9
gi|50285811|ref|XP_445334.1| unnamed protein product [Candida gl... 33 1.9
gi|21434741|gb|AAM53530.1| beige-like protein; CDC4L protein [Ho... 33 1.9
gi|31247948|ref|XP_316573.1| ENSANGP00000002549 [Anopheles gambi... 33 1.9
gi|33874730|gb|AAH14122.1| AAMP protein [Homo sapiens] 33 1.9
gi|39644832|gb|AAH08809.2| AAMP protein [Homo sapiens] 33 1.9
gi|24639887|ref|NP_572232.2| CG4136-PA [Drosophila melanogaster]... 33 1.9
gi|38099099|gb|EAA46486.1| hypothetical protein MG08829.4 [Magna... 32 2.4
gi|24657364|ref|NP_647876.1| CG1332-PA [Drosophila melanogaster]... 32 2.4
gi|17229242|ref|NP_485790.1| similar to WD-repeat containing pro... 32 2.4
gi|34912496|ref|NP_917595.1| putative flower development regulat... 32 2.4
gi|39595777|emb|CAE67280.1| Hypothetical protein CBG12728 [Caeno... 32 2.4
gi|50545019|ref|XP_500061.1| YlTUP1 [Yarrowia lipolytica] >gnl|B... 32 2.4
gi|6016359|sp|Q29612|IL1S_CERAE Interleukin-1 receptor, type II ... 32 2.4
gi|1488064|gb|AAB05877.1| soluble type II interleukin-1 receptor 32 2.4
gi|49087784|ref|XP_405789.1| hypothetical protein AN1652.2 [Aspe... 32 3.2
gi|17533163|ref|NP_495256.1| transducin protein (103.2 kD) (2G56... 32 3.2
gi|6841336|gb|AAF29021.1| HSPC049 [Homo sapiens] 32 3.2
gi|38345586|emb|CAE01863.2| OSJNBb0012E24.4 [Oryza sativa (japon... 32 3.2
gi|40254873|ref|NP_054868.2| HSPC049 protein [Homo sapiens] >gnl... 32 3.2
gi|16878074|gb|AAH17246.1| HSPC049 protein [Homo sapiens] 32 3.2
gi|39794262|gb|AAH63394.1| HSPC049 protein [Homo sapiens] 32 3.2
gi|38105264|gb|EAA51710.1| predicted protein [Magnaporthe grisea... 32 3.2
gi|39645025|gb|AAH09939.2| HSPC049 protein [Homo sapiens] 32 3.2
gi|46439391|gb|EAK98709.1| hypothetical protein CaO19.12843 [Can... 32 3.2
gi|28523341|ref|XP_145240.4| RIKEN cDNA 9530020G05 [Mus musculus... 32 3.2
gi|12053375|emb|CAB66874.1| hypothetical protein [Homo sapiens] ... 32 3.2
gi|50259271|gb|EAL21944.1| hypothetical protein CNBC0840 [Crypto... 32 4.1
gi|39594024|emb|CAE70134.1| Hypothetical protein CBG16596 [Caeno... 32 4.1
gi|19075450|ref|NP_587950.1| similar to guanine nucleotide-bindi... 32 4.1
gi|47606203|sp|Q99973|TEP1_HUMAN Telomerase protein component 1 ... 32 4.1
gi|21536371|ref|NP_009041.2| telomerase-associated protein 1; te... 32 4.1
gi|45198513|ref|NP_985542.1| AFL006Cp [Eremothecium gossypii] >g... 32 4.1
gi|31209853|ref|XP_313893.1| ENSANGP00000003345 [Anopheles gambi... 32 4.1
gi|34876801|ref|XP_217441.2| similar to angio-associated migrato... 32 4.1
gi|50557378|ref|XP_506097.1| hypothetical protein [Yarrowia lipo... 32 4.1
gi|49087078|ref|XP_405524.1| hypothetical protein AN1387.2 [Aspe... 32 4.1
gi|28899553|ref|NP_799158.1| conserved hypothetical protein [Vib... 32 4.1
gi|49085686|ref|XP_404945.1| hypothetical protein AN0808.2 [Aspe... 32 4.1
gi|37859208|gb|AAK29933.2| Hypothetical protein Y54F10AM.10 [Cae... 32 4.1
gi|50302897|ref|XP_451386.1| unnamed protein product [Kluyveromy... 32 4.1
gi|17556176|ref|NP_497572.1| predicted CDS, WD repeat domain 7 (... 32 4.1
gi|31209851|ref|XP_313892.1| ENSANGP00000021722 [Anopheles gambi... 32 4.1
gi|31239581|ref|XP_320204.1| ENSANGP00000020028 [Anopheles gambi... 32 4.1
gi|50546481|ref|XP_500710.1| hypothetical protein [Yarrowia lipo... 32 4.1
gi|50754097|ref|XP_414243.1| PREDICTED: similar to U3 small nucl... 31 5.4
gi|17551766|ref|NP_498555.1| i-48 protein (47.8 kD) (3I212) [Cae... 31 5.4
gi|23124056|ref|ZP_00106072.1| COG2319: FOG: WD40 repeat [Nostoc... 31 5.4
gi|7512053|pir||T09455 vacuolar assembly protein VPS41 homolog l... 31 5.4
gi|16944644|emb|CAD11404.1| hypothetical protein [Neurospora cra... 31 5.4
gi|30923556|gb|EAA46034.1| CG18028-PA.3 [Drosophila melanogaster] 31 5.4
gi|15809828|gb|AAL06842.1| AT3g16650/MGL6_10 [Arabidopsis thaliana] 31 5.4
gi|25408536|pir||C84789 hypothetical protein At2g37160 [imported... 31 5.4
gi|50255645|gb|EAL18378.1| hypothetical protein CNBJ3010 [Crypto... 31 5.4
gi|42569691|ref|NP_181253.2| transducin family protein / WD-40 r... 31 5.4
gi|3406654|gb|AAC29438.1| transcriptional repressor TUP1 [Dictyo... 31 5.4
gi|32405794|ref|XP_323510.1| hypothetical protein [Neurospora cr... 31 5.4
gi|1076382|pir||S49821 PRL2 protein - Arabidopsis thaliana (frag... 31 5.4
gi|39582817|emb|CAE74280.1| Hypothetical protein CBG21976 [Caeno... 31 5.4
gi|19113785|ref|NP_592873.1| WD repeat protein; related to tup1 ... 31 5.4
gi|49094584|ref|XP_408753.1| hypothetical protein AN4616.2 [Aspe... 31 5.4
gi|6678285|ref|NP_033377.1| telomerase associated protein 1 [Mus... 31 5.4
gi|18401203|ref|NP_566557.1| PP1/PP2A phosphatases pleiotropic r... 31 5.4
gi|30923557|gb|EAA46035.1| CG18028-PB.3 [Drosophila melanogaster] 31 5.4
gi|50421067|ref|XP_459078.1| unnamed protein product [Debaryomyc... 31 5.4
gi|50259697|gb|EAL22367.1| hypothetical protein CNBB5400 [Crypto... 31 7.0
gi|50425399|ref|XP_461293.1| unnamed protein product [Debaryomyc... 31 7.0
gi|50752740|ref|XP_413728.1| PREDICTED: similar to U3 small nucl... 31 7.0
gi|15607594|ref|NP_214967.1| PPE [Mycobacterium tuberculosis H37... 31 7.0
gi|23129632|ref|ZP_00111458.1| COG2319: FOG: WD40 repeat [Nostoc... 31 7.0
gi|15839841|ref|NP_334878.1| PPE family protein [Mycobacterium t... 31 7.0
gi|34879136|ref|XP_223647.2| similar to Spred-2 [Rattus norvegicus] 31 7.0
gi|2130260|pir||S62544 hypothetical protein SPAC12G12.13c - fiss... 31 7.0
gi|29247640|gb|EAA39196.1| GLP_160_23307_22402 [Giardia lamblia ... 31 7.0
gi|50407506|ref|XP_456716.1| unnamed protein product [Debaryomyc... 31 7.0
gi|38422258|emb|CAA96682.3| Hypothetical protein T11A5.2 [Caenor... 31 7.0
gi|23112505|ref|ZP_00097980.1| COG1775: Benzoyl-CoA reductase/2-... 31 7.0
gi|45509197|ref|ZP_00161532.1| COG2319: FOG: WD40 repeat [Anabae... 31 7.0
gi|23130484|ref|ZP_00112299.1| hypothetical protein [Nostoc punc... 31 7.0
gi|17505895|ref|NP_492363.1| pre-mRNA factor (55.9 kD) (1J310) [... 31 7.0
gi|17227779|ref|NP_484327.1| WD-40 repeat protein [Nostoc sp. PC... 31 7.0
gi|7460004|pir||A71104 hypothetical protein PH1092 - Pyrococcus ... 31 7.0
gi|19113796|ref|NP_592884.1| hypothetical trp-asp repeats contai... 31 7.0
gi|17564254|ref|NP_505544.1| putative protein family member, wit... 31 7.0
gi|47679343|gb|AAT36652.1| Tup1p [Exophiala dermatitidis] 31 7.0
gi|13174235|gb|AAK14409.1| putative angio-associated migratory c... 30 9.2
gi|41352888|gb|AAS01057.1| orf1ab polyprotein [SARS coronavirus ... 30 9.2
gi|50872460|gb|AAT85060.1| WD domain, G-beta repeat containing p... 30 9.2
gi|50418219|gb|AAH77271.1| Unknown (protein for MGC:80037) [Xeno... 30 9.2
gi|28828539|gb|AAO51147.1| hypothetical protein [Dictyostelium d... 30 9.2
gi|10434612|dbj|BAB14316.1| unnamed protein product [Homo sapiens] 30 9.2
gi|34902194|ref|NP_912443.1| Hypothetical protein [Oryza sativa ... 30 9.2
gi|40457449|gb|AAR86774.1| orf1ab [SARS coronavirus ShanghaiQXC2] 30 9.2
gi|23128236|ref|ZP_00110089.1| COG2319: FOG: WD40 repeat [Nostoc... 30 9.2
gi|32454353|gb|AAP82975.1| orf1ab polyprotein [SARS coronavirus ... 30 9.2
gi|42518480|ref|NP_964410.1| hypothetical protein LJ0386 [Lactob... 30 9.2
gi|23488745|gb|EAA21389.1| hypothetical protein [Plasmodium yoel... 30 9.2
gi|417122|sp|P32479|HIR1_YEAST Histone transcription regulator 1 30 9.2
gi|34555776|ref|NP_828862.2| nsp3-pp1a/pp1ab [SARS coronavirus] 30 9.2
gi|34899294|ref|NP_910993.1| zinc finger transcription factor-li... 30 9.2
gi|32454354|gb|AAP82976.1| orf1a polyprotein [SARS coronavirus S... 30 9.2
gi|31223396|ref|XP_317303.1| ENSANGP00000010438 [Anopheles gambi... 30 9.2
gi|48855892|ref|ZP_00310050.1| COG1597: Sphingosine kinase and e... 30 9.2
gi|50286763|ref|XP_445811.1| unnamed protein product [Candida gl... 30 9.2
gi|6319463|ref|NP_009545.1| Non-essential transcriptional corepr... 30 9.2
gi|12018250|ref|NP_072113.1| telomerase associated protein 1; te... 30 9.2
gi|20129749|ref|NP_610282.1| CG11141-PB [Drosophila melanogaster... 30 9.2
gi|42415435|gb|AAS15687.1| GH02593p [Drosophila melanogaster] 30 9.2
gi|34854120|ref|XP_344843.1| similar to putative protein kinase ... 30 9.2
gi|40548922|gb|AAR87543.1| putative polyprotein [SARS coronaviru... 30 9.2
gi|40548887|gb|AAR87511.1| orf1a polyprotein [SARS coronavirus T... 30 9.2
gi|30275668|gb|AAP30029.1| orf1a polyprotein [SARS coronavirus B... 30 9.2
gi|40548970|gb|AAR87587.1| putative polyprotein [SARS coronaviru... 30 9.2
gi|30124074|ref|NP_828849.2| orf1ab polyprotein (pp1ab) [SARS co... 30 9.2
gi|40795746|gb|AAR91585.1| orf1a polyprotein [SARS coronavirus N... 30 9.2
gi|38231938|gb|AAR14810.1| putative orf1ab polyprotein [SARS cor... 30 9.2
gi|40557708|gb|AAP82978.2| orf1ab [SARS coronavirus ShanghaiQXC1] 30 9.2
gi|40548910|gb|AAR87532.1| putative polyprotein [SARS coronaviru... 30 9.2
gi|30027621|gb|AAP13442.1| nonstructural polyprotein pp1ab [SARS... 30 9.2
gi|38505492|gb|AAR23251.1| orf1ab polyprotein [SARS coronavirus ... 30 9.2
gi|50365701|gb|AAT76146.1| replicase 1ab [SARS coronavirus TJF] 30 9.2
gi|31581503|gb|AAP33695.1| polyprotein 1a [SARS coronavirus Fran... 30 9.2
gi|40548983|gb|AAR87599.1| orf1a polyprotein [SARS coronavirus TW9] 30 9.2
gi|30023962|gb|AAP13575.1| orf1a polyprotein [SARS coronavirus C... 30 9.2
gi|31416294|gb|AAP51226.1| orf1a polyprotein [SARS coronavirus G... 30 9.2
gi|29836495|ref|NP_828850.1| orf1a polyprotein (pp1a) [SARS coro... 30 9.2
gi|38324306|gb|AAP49011.4| orf1ab polyprotein [SARS coronavirus ... 30 9.2
gi|38304882|gb|AAR16181.1| orf1a polyprotein [SARS coronavirus Z... 30 9.2
gi|40795745|gb|AAR91584.1| nonstructural polyprotein [SARS coron... 30 9.2
gi|40548923|gb|AAR87544.1| orf1a polyprotein [SARS coronavirus TW4] 30 9.2
gi|30027618|gb|AAP13439.1| nonstructural polyprotein pp1a [SARS ... 30 9.2
gi|38505484|gb|AAR23244.1| orf1a polyprotein [SARS coronavirus S... 30 9.2
gi|30023953|gb|AAP13566.1| putative orf1ab polyprotein [SARS cor... 30 9.2
gi|40548982|gb|AAR87598.1| putative polyprotein [SARS coronaviru... 30 9.2
gi|38231928|gb|AAR14802.1| putative orf1ab polyprotein [SARS cor... 30 9.2
gi|30795144|gb|AAP41036.1| replicase 1AB [SARS coronavirus Tor2] 30 9.2
gi|41323720|gb|AAS00002.1| nonstructural polyprotein [SARS coron... 30 9.2
gi|30275667|gb|AAP30028.1| orf1ab [SARS coronavirus BJ01] 30 9.2
gi|38505493|gb|AAR23252.1| orf1a polyprotein [SARS coronavirus S... 30 9.2
gi|40548886|gb|AAR87510.1| putative polyprotein [SARS coronaviru... 30 9.2
gi|40548911|gb|AAR87533.1| orf1a polyprotein [SARS coronavirus TW3] 30 9.2
gi|31581504|gb|AAP33696.1| polyprotein 1ab [SARS coronavirus Fra... 30 9.2
gi|33114215|gb|AAP94757.1| putative orf1ab polyprotein [SARS cor... 30 9.2
gi|38505483|gb|AAR23243.1| orf1ab polyprotein [SARS coronavirus ... 30 9.2
gi|31416293|gb|AAP51225.1| orf1ab [SARS coronavirus GD01] 30 9.2
gi|50365703|gb|AAT76148.1| Orf1a polyprotein [SARS coronavirus TJF] 30 9.2
>gi|17506867|ref|NP_492591.1| PP2A-B regulatory subunit PR55/B,
SUppressor of activated let-60 Ras SUR-6 (57.1 kD)
(sur-6) [Caenorhabditis elegans]
gi|7499919|pir||T21422 hypothetical protein F26E4.1 -
Caenorhabditis elegans
gi|3876423|emb|CAB03008.1| Hypothetical protein F26E4.1
[Caenorhabditis elegans]
gi|3878156|emb|CAA99882.1| Hypothetical protein F26E4.1
[Caenorhabditis elegans]
gi|5805392|gb|AAD51977.1| PP2A-B regulatory subunit PR55/B
[Caenorhabditis elegans]
Length = 495
Score = 229 bits (583), Expect = 1e-59
Identities = 110/110 (100%), Positives = 110/110 (100%)
Frame = +1
Query: 1 MVMEVDEPAVAATTSQNQPQEHANDFDMDTSEGPIENDETFEPVDQINWKFNQVKGNIDA 180
MVMEVDEPAVAATTSQNQPQEHANDFDMDTSEGPIENDETFEPVDQINWKFNQVKGNIDA
Sbjct: 1 MVMEVDEPAVAATTSQNQPQEHANDFDMDTSEGPIENDETFEPVDQINWKFNQVKGNIDA 60
Query: 181 DVHTEADVISCVEFSHDGEYLATGDKGGRVVIFQRDQSGKYVKGVRSREY 330
DVHTEADVISCVEFSHDGEYLATGDKGGRVVIFQRDQSGKYVKGVRSREY
Sbjct: 61 DVHTEADVISCVEFSHDGEYLATGDKGGRVVIFQRDQSGKYVKGVRSREY 110