Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= K01A2_4
(795 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17534791|ref|NP_493703.1| putative protein family member (2A6... 442 e-123
gi|7505040|pir||T33642 hypothetical protein K01A2.4 - Caenorhabd... 347 2e-94
gi|38176024|gb|AAR12970.1| Hypothetical protein K01A2.4 [Caenorh... 339 5e-92
gi|7505039|pir||T33645 hypothetical protein K01A2.3 - Caenorhabd... 204 1e-51
gi|17534793|ref|NP_493706.1| putative protein (2A605) [Caenorhab... 181 2e-44
gi|17534801|ref|NP_493705.1| putative protein family member (2A6... 57 3e-07
gi|17534803|ref|NP_493704.1| putative protein family member (18.... 57 3e-07
gi|39586930|emb|CAE62865.1| Hypothetical protein CBG07048 [Caeno... 55 2e-06
gi|17534805|ref|NP_493707.1| putative protein family member (2A6... 55 2e-06
gi|32565122|ref|NP_872029.1| putative protein family member (2A6... 45 0.001
gi|50311997|ref|XP_456030.1| unnamed protein product [Kluyveromy... 44 0.004
gi|24646853|ref|NP_650373.1| CG14852-PA [Drosophila melanogaster... 44 0.005
gi|50422291|ref|XP_459708.1| unnamed protein product [Debaryomyc... 41 0.026
gi|23485335|gb|EAA20366.1| hypothetical protein [Plasmodium yoel... 41 0.034
gi|47225482|emb|CAG11965.1| unnamed protein product [Tetraodon n... 40 0.044
gi|50416378|gb|AAH77238.1| FLJ10006 protein [Xenopus laevis] 40 0.057
gi|27370980|gb|AAH41492.1| FLJ10006 protein [Xenopus laevis] 40 0.057
gi|126670|sp|P08089|M6_STRPY M protein, serotype 6 precursor >gn... 39 0.13
gi|23482894|gb|EAA18742.1| dentin phosphoryn [Plasmodium yoelii ... 39 0.17
gi|27692727|ref|XP_223182.1| similar to 85 kDa protein [Rattus n... 38 0.22
gi|23508015|ref|NP_700685.1| hypothetical protein [Plasmodium fa... 38 0.28
gi|31241541|ref|XP_321201.1| ENSANGP00000020136 [Anopheles gambi... 38 0.28
gi|46048571|ref|NP_976077.1| hypothetical gene supported by M310... 37 0.37
gi|47570497|ref|ZP_00241127.1| polypeptide with collagen binding... 37 0.48
gi|16445033|ref|NP_443189.1| ACRC protein; putative nuclear prot... 37 0.48
gi|45185293|ref|NP_983010.1| ABR064Wp [Eremothecium gossypii] >g... 37 0.48
gi|8132107|gb|AAF73220.1| glutamine/glutamic acid-rich protein B... 37 0.48
gi|50548381|ref|XP_501660.1| hypothetical protein [Yarrowia lipo... 37 0.48
gi|23619548|ref|NP_705510.1| hypothetical protein [Plasmodium fa... 37 0.63
gi|1170022|sp|P08568|GRPA_RAT Submandibular gland secretory Glx-... 37 0.63
gi|31126963|ref|NP_852105.1| glutamine/glutamic acid-rich protei... 37 0.63
gi|23488517|gb|EAA21339.1| hypothetical protein [Plasmodium yoel... 37 0.63
gi|31201363|ref|XP_309629.1| ENSANGP00000011118 [Anopheles gambi... 36 0.83
gi|48870355|ref|ZP_00323079.1| hypothetical protein PpenA0100100... 36 0.83
gi|92319|pir||A29573 Glx-rich protein - rat (fragment) >gnl|BL_O... 36 0.83
gi|13365913|dbj|BAB39330.1| hypothetical protein [Macaca fascicu... 36 0.83
gi|459931|gb|AAA40971.1| contiguous repeat polypeptide [Rattus n... 36 0.83
gi|37595252|gb|AAQ94511.1| M protein [Streptococcus pyogenes] 36 0.83
gi|14388513|dbj|BAB60783.1| hypothetical protein [Macaca fascicu... 36 0.83
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 36 0.83
gi|37550319|ref|XP_291141.3| KIAA0303 protein [Homo sapiens] 36 1.1
gi|30023388|ref|NP_835019.1| Collagen adhesion protein [Bacillus... 36 1.1
gi|45387737|ref|NP_991220.1| hypothetical protein zgc:77221 [Dan... 36 1.1
gi|2224547|dbj|BAA20762.1| KIAA0303 [Homo sapiens] 36 1.1
gi|23478899|gb|EAA15864.1| U5 snRNP 100 kD protein [Plasmodium y... 36 1.1
gi|6324372|ref|NP_014442.1| Anchorage subunit of a-agglutinin of... 35 1.4
gi|23613074|ref|NP_703396.1| hypothetical protein [Plasmodium fa... 35 1.4
gi|23613621|ref|NP_704642.1| hypothetical protein [Plasmodium fa... 35 1.4
gi|48824054|ref|ZP_00285484.1| hypothetical protein Efae03002600... 35 1.4
gi|30681697|ref|NP_850024.1| NOL1/NOP2/sun family protein [Arabi... 35 1.4
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 35 1.4
gi|25412103|pir||B84612 hypothetical protein At2g22400 [imported... 35 1.4
gi|133328|sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II la... 35 1.8
gi|6685540|sp|Q9XHM1|IF38_MEDTR Eukaryotic translation initiatio... 35 1.8
gi|23508863|ref|NP_701531.1| GTP-binding protein, putative [Plas... 35 1.8
gi|23508756|ref|NP_701424.1| hypothetical protein, conserved [Pl... 35 1.8
gi|50420277|ref|XP_458671.1| unnamed protein product [Debaryomyc... 35 1.8
gi|49091626|ref|XP_407274.1| hypothetical protein AN3137.2 [Aspe... 35 1.8
gi|27469313|ref|NP_765950.1| Ser-Asp rich fibrinogen-binding,bon... 35 1.8
gi|23509381|ref|NP_702048.1| hypothetical protein [Plasmodium fa... 35 1.8
gi|32416248|ref|XP_328602.1| predicted protein [Neurospora crass... 35 1.8
gi|29834039|ref|NP_828673.1| putative protease precursor [Strept... 35 1.8
gi|10383775|ref|NP_009914.2| Protein involved in bud-site select... 35 2.4
gi|32041587|ref|ZP_00139170.1| hypothetical protein [Pseudomonas... 35 2.4
gi|49080426|gb|AAT50018.1| PA1545 [synthetic construct] 35 2.4
gi|8101005|gb|AAF72509.1| putative cell-surface adhesin SdrF [St... 35 2.4
gi|2146831|pir||S74285 BUD3 protein - yeast (Saccharomyces cerev... 35 2.4
gi|21392392|dbj|BAC00846.1| AcylCoA:Cholesterol Acyltransferase ... 35 2.4
gi|39595869|emb|CAE67372.1| Hypothetical protein CBG12848 [Caeno... 35 2.4
gi|15596742|ref|NP_250236.1| hypothetical protein [Pseudomonas a... 35 2.4
gi|23491068|gb|EAA22696.1| CCAAT-box DNA binding protein subunit... 35 2.4
gi|32410787|ref|XP_325874.1| predicted protein [Neurospora crass... 34 3.1
gi|15227326|ref|NP_181664.1| glutaredoxin family protein [Arabid... 34 3.1
gi|23509866|ref|NP_702533.1| hypothetical protein [Plasmodium fa... 34 3.1
gi|45382753|ref|NP_990008.1| extracellular matrix protein F22 [G... 34 3.1
gi|85170|pir||JN0015 trp protein - fruit fly (Drosophila melanog... 34 3.1
gi|600514|gb|AAA56928.1| photoreceptor membrane-associated protein 34 3.1
gi|7021194|dbj|BAA91402.1| unnamed protein product [Homo sapiens] 34 3.1
gi|50546481|ref|XP_500710.1| hypothetical protein [Yarrowia lipo... 34 3.1
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 34 3.1
gi|158711|gb|AAA28977.1| transient receptor potential B; putative 34 3.1
gi|46488716|gb|AAS99598.1| latent membrane protein 1 [Human herp... 34 3.1
gi|85171|pir||JU0092 trp protein - fruit fly (Drosophila melanog... 34 3.1
gi|1174798|sp|P19334|TRP_DROME Transient receptor potential prot... 34 3.1
gi|17136554|ref|NP_476768.1| CG7875-PA [Drosophila melanogaster]... 34 3.1
gi|19424358|gb|AAL88720.1| hypothetical protein [Dictyostelium d... 34 3.1
gi|49092454|ref|XP_407688.1| hypothetical protein AN3551.2 [Aspe... 34 4.1
gi|23612245|ref|NP_703825.1| hypothetical protein [Plasmodium fa... 34 4.1
gi|1352417|sp|P20811|ICAL_BOVIN Calpain inhibitor (Calpastatin) ... 34 4.1
gi|46438216|gb|EAK97550.1| hypothetical protein CaO19.1237 [Cand... 34 4.1
gi|190406|gb|AAA36487.1| profilaggrin 34 4.1
gi|46438160|gb|EAK97495.1| hypothetical protein CaO19.8822 [Cand... 34 4.1
gi|23613775|ref|NP_704796.1| hypothetical protein [Plasmodium fa... 34 4.1
gi|50260405|gb|EAL23062.1| hypothetical protein CNBA5870 [Crypto... 34 4.1
gi|23619129|ref|NP_705091.1| hypothetical protein [Plasmodium fa... 34 4.1
gi|38079996|ref|XP_287445.2| expressed sequence AF013969 [Mus mu... 34 4.1
gi|50552384|ref|XP_503602.1| hypothetical protein [Yarrowia lipo... 33 5.4
gi|28193937|gb|AAO33323.1| structural polyprotein precursor [Hig... 33 5.4
gi|50543314|ref|XP_499823.1| hypothetical protein [Yarrowia lipo... 33 5.4
gi|50540766|gb|AAT77922.1| expressed protein [Oryza sativa (japo... 33 5.4
gi|38106510|gb|EAA52804.1| hypothetical protein MG05932.4 [Magna... 33 5.4
gi|31209323|ref|XP_313628.1| ENSANGP00000013166 [Anopheles gambi... 33 5.4
gi|23613114|ref|NP_703436.1| chromosome condensation protein, pu... 33 5.4
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 33 5.4
gi|46365603|ref|ZP_00228063.1| hypothetical protein Krad06002254... 33 5.4
gi|15230910|ref|NP_191357.1| DNA-binding bromodomain-containing ... 33 5.4
gi|45332244|gb|AAS58046.1| thrombospondin-related anonymous prot... 33 5.4
gi|42519023|ref|NP_964953.1| hypothetical protein LJ1097 [Lactob... 33 5.4
gi|687634|gb|AAA62504.1| collagen 33 5.4
gi|23510055|ref|NP_702721.1| hypothetical protein [Plasmodium fa... 33 5.4
gi|130581|sp|P13897|POLS_WEEV Structural polyprotein (P130) [Con... 33 7.0
gi|23507862|ref|NP_700532.1| hypothetical protein [Plasmodium fa... 33 7.0
gi|23612315|ref|NP_703895.1| protein kinase, putative [Plasmodiu... 33 7.0
gi|39595117|emb|CAE60154.1| Hypothetical protein CBG03706 [Caeno... 33 7.0
gi|31544742|ref|NP_853320.1| conserved hypothetical [Mycoplasma ... 33 7.0
gi|23613325|ref|NP_703647.1| hypothetical protein, conserved [Pl... 33 7.0
gi|46108158|ref|XP_381137.1| hypothetical protein FG00961.1 [Gib... 33 7.0
gi|23619449|ref|NP_705411.1| hypothetical protein, conserved [Pl... 33 7.0
gi|32405014|ref|XP_323120.1| hypothetical protein [Neurospora cr... 33 7.0
gi|15613259|ref|NP_241562.1| prepro-alkaline protease [Bacillus ... 33 7.0
gi|39597356|emb|CAE59584.1| Hypothetical protein CBG02984 [Caeno... 33 7.0
gi|40254723|ref|NP_714950.2| sterol O-acyltransferase 2 [Rattus ... 33 7.0
gi|50543316|ref|XP_499824.1| hypothetical protein [Yarrowia lipo... 33 7.0
gi|46435796|gb|EAK95170.1| hypothetical protein CaO19.4072 [Cand... 33 7.0
gi|38110533|gb|EAA56237.1| hypothetical protein MG01889.4 [Magna... 33 7.0
gi|46435639|gb|EAK95016.1| hypothetical protein CaO19.11553 [Can... 33 7.0
gi|31240323|ref|XP_320575.1| ENSANGP00000015243 [Anopheles gambi... 33 7.0
gi|46116158|ref|XP_384097.1| hypothetical protein FG03921.1 [Gib... 33 7.0
gi|39588015|emb|CAE57246.1| Hypothetical protein CBG00124 [Caeno... 33 9.1
gi|16805266|ref|NP_473294.1| DNA-directed RNA polymerase II, put... 33 9.1
gi|4165154|gb|AAD08711.1| topoisomerase I [Nicotiana tabacum] >g... 33 9.1
gi|38566532|gb|AAR24156.1| At5g43580 [Arabidopsis thaliana] 33 9.1
gi|21238456|ref|NP_640331.1| structural polyprotein [Western equ... 33 9.1
gi|50738728|ref|XP_429829.1| PREDICTED: hypothetical protein XP_... 33 9.1
gi|23510077|ref|NP_702743.1| hypothetical protein [Plasmodium fa... 33 9.1
gi|23003571|ref|ZP_00047229.1| hypothetical protein [Lactobacill... 33 9.1
gi|22970264|ref|ZP_00017376.1| hypothetical protein [Chloroflexu... 33 9.1
gi|24653671|ref|NP_610972.2| CG12864-PA [Drosophila melanogaster... 33 9.1
gi|23612658|ref|NP_704219.1| hypothetical protein, conserved [Pl... 33 9.1
gi|50422113|ref|XP_459619.1| unnamed protein product [Debaryomyc... 33 9.1
gi|29611990|ref|NP_818938.1| C protein; capsid protein [Western ... 33 9.1
gi|23505397|gb|AAN37687.1| elicitin-like mating protein M25 [Phy... 33 9.1
gi|23481077|gb|EAA17463.1| Leishmania major ppg3 [Plasmodium yoe... 33 9.1
gi|23509909|ref|NP_702576.1| hypothetical protein [Plasmodium fa... 33 9.1
gi|27665636|ref|XP_238528.1| hypothetical protein XP_238528 [Rat... 33 9.1
>gi|17534791|ref|NP_493703.1| putative protein family member (2A605)
[Caenorhabditis elegans]
Length = 264
Score = 442 bits (1136), Expect = e-123
Identities = 223/264 (84%), Positives = 223/264 (84%)
Frame = +1
Query: 1 MSDDQKDTQASGTDPKNDATDPSKTPTDGNKDATDQKKTSSNENKDATDPKQTPTDHKDE 180
MSDDQKDTQASGTDPKNDATDPSKTPTDGNKDATDQKKTSSNENKDATDPKQTPTDHKDE
Sbjct: 1 MSDDQKDTQASGTDPKNDATDPSKTPTDGNKDATDQKKTSSNENKDATDPKQTPTDHKDE 60
Query: 181 HIPQNIASVLQHIRDPKLIKDFSAALQSFSLGRHTSNGHSASETVQASNGEKEHAKMQYN 360
HIPQNIASVLQHIRDPKLIKDFSAALQSFSLGRHTSNGHSASETVQASNGEKEHAKMQYN
Sbjct: 61 HIPQNIASVLQHIRDPKLIKDFSAALQSFSLGRHTSNGHSASETVQASNGEKEHAKMQYN 120
Query: 361 XXXXXXXXXXXXXIGHGISFLIHVIMTYTLFLEWYNAIDPKITVVGAIIXXXXXXXXXXX 540
IGHGISFLIHVIMTYTLFLEWYNAIDPKITVVGAII
Sbjct: 121 LPPDVKDKKKKLLIGHGISFLIHVIMTYTLFLEWYNAIDPKITVVGAIILMVFVLCLLLL 180
Query: 541 XXXXXXWMLHGKYKNEKAETEFFILLPLFNIACATIYQFVVQLLASQLSIKVPNLXXXXX 720
WMLHGKYKNEKAETEFFILLPLFNIACATIYQFVVQLLASQLSIKVPNL
Sbjct: 181 AFGGFVWMLHGKYKNEKAETEFFILLPLFNIACATIYQFVVQLLASQLSIKVPNLASSIA 240
Query: 721 XXXXXXTHMILHTFALFWKSPLIK 792
THMILHTFALFWKSPLIK
Sbjct: 241 ASISVATHMILHTFALFWKSPLIK 264