Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F55C12_2
         (336 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17534425|ref|NP_495170.1| putative secreted or extracellular ...   209   1e-53
gi|39596985|emb|CAE59212.1| Hypothetical protein CBG02525 [Caeno...    80   1e-14
gi|39596986|emb|CAE59213.1| Hypothetical protein CBG02526 [Caeno...    78   4e-14
gi|39582020|emb|CAE64451.1| Hypothetical protein CBG09158 [Caeno...    74   9e-13
gi|17544322|ref|NP_502885.1| predicted CDS, putative protein, wi...    62   4e-09
gi|7509257|pir||T31575 hypothetical protein Y105C5A.r - Caenorha...    62   4e-09
gi|17551550|ref|NP_508284.1| putative protein (XC114) [Caenorhab...    54   6e-07
gi|7504264|pir||T34307 hypothetical protein F55C12.3 - Caenorhab...    54   8e-07
gi|17561568|ref|NP_504627.1| GEI-4(Four) Interacting protein GFI...    42   0.002
gi|17561820|ref|NP_504626.1| GEI-4(Four) Interacting protein GFI...    42   0.002
gi|7498722|pir||T15989 hypothetical protein F09E10.6 - Caenorhab...    42   0.002
gi|5596350|dbj|BAA82606.1| sALK-6 [Ephydatia fluviatilis]              42   0.003
gi|39596376|emb|CAE70014.1| Hypothetical protein CBG16428 [Caeno...    41   0.005
gi|39583488|emb|CAE73946.1| Hypothetical protein CBG21570 [Caeno...    41   0.007
gi|39589473|emb|CAE74502.1| Hypothetical protein CBG22253 [Caeno...    40   0.015
gi|39594294|emb|CAE71872.1| Hypothetical protein CBG18927 [Caeno...    39   0.026
gi|39593443|emb|CAE64913.1| Hypothetical protein CBG09733 [Caeno...    39   0.026
gi|42733652|gb|AAS38615.1| similar to Plasmodium falciparum. Hyp...    39   0.034
gi|27662046|ref|XP_216966.1| similar to ARS component B precurso...    38   0.044
gi|10048458|ref|NP_065265.1| Ars component B; secreted Ly-6/uPAR...    38   0.044
gi|17510843|ref|NP_492668.1| kinase protein PROT family member (...    38   0.057
gi|38422766|emb|CAE54927.1| Hypothetical protein Y106G6D.8 [Caen...    38   0.057
gi|17561616|ref|NP_505786.1| putative endoplasmic reticulum prot...    37   0.098
gi|39588477|emb|CAE72828.1| Hypothetical protein CBG20110 [Caeno...    37   0.098
gi|17560672|ref|NP_503505.1| TGF-beta receptor/activin receptor,...    37   0.13
gi|32567025|ref|NP_872189.1| putative protein, with a transmembr...    36   0.22
gi|39579418|emb|CAE56724.1| Hypothetical protein CBG24511 [Caeno...    36   0.22
gi|21392056|gb|AAM48382.1| RE01052p [Drosophila melanogaster]          35   0.28
gi|39592192|emb|CAE75412.1| Hypothetical protein CBG23402 [Caeno...    35   0.28
gi|47215436|emb|CAG05723.1| unnamed protein product [Tetraodon n...    35   0.37
gi|34555866|emb|CAB03061.2| Hypothetical protein F35C5.11 [Caeno...    35   0.48
gi|17560674|ref|NP_503504.1| TGF-beta receptor/activin receptor,...    34   0.63
gi|39581852|emb|CAE60745.1| Hypothetical protein CBG04431 [Caeno...    34   0.83
gi|49035162|gb|AAB66091.3| Hypothetical protein F36H9.1 [Caenorh...    34   0.83
gi|33589356|gb|AAQ22445.1| RE55648p [Drosophila melanogaster]          33   1.1
gi|17542830|ref|NP_500316.1| putative protein (4E71) [Caenorhabd...    33   1.1
gi|39578882|emb|CAE56235.1| Hypothetical protein CBG23870 [Caeno...    33   1.4
gi|47223592|emb|CAF99201.1| unnamed protein product [Tetraodon n...    33   1.4
gi|39583084|emb|CAE60624.1| Hypothetical protein CBG04267 [Caeno...    33   1.4
gi|128971|sp|P01424|NXS1_NAJME Short neurotoxin 1 (Neurotoxin D)...    33   1.4
gi|32394502|gb|AAM93949.1| cobrin precursor [Griffithsia japonica]     33   1.4
gi|128964|sp|P01425|NXS1_HEMHA Short neurotoxin 1 (Toxin II) >gn...    33   1.8
gi|28828528|gb|AAO51136.1| similar to Boophilus microplus (Cattl...    32   2.4
gi|17551272|ref|NP_508281.1| predicted CDS, putative protein (XC...    32   2.4
gi|47229646|emb|CAG06842.1| unnamed protein product [Tetraodon n...    32   2.4
gi|17542788|ref|NP_500736.1| putative membrane protein (4F950) [...    32   2.4
gi|39587541|emb|CAE58479.1| Hypothetical protein CBG01621 [Caeno...    32   2.4
gi|38110555|gb|EAA56254.1| hypothetical protein MG06225.4 [Magna...    32   2.4
gi|128983|sp|P25675|NXS2_NAJHH Short neurotoxin 2 (Toxin CM-10a)       32   3.1
gi|128974|sp|P01426|NXS1_NAJPA Short neurotoxin 1 (Neurotoxin al...    32   3.1
gi|6680492|ref|NP_032431.1| integrin beta 2-like [Mus musculus] ...    32   4.1
gi|16555889|dbj|BAB71720.1| bone morphogenetic protein type II r...    32   4.1
gi|33300377|emb|CAE17835.1| Hypothetical protein F58B4.6 [Caenor...    32   4.1
gi|32417416|ref|XP_329186.1| hypothetical protein [Neurospora cr...    32   4.1
gi|547810|sp|Q02958|KRHA_SHEEP Keratin, glycine/tyrosine-rich of...    32   4.1
gi|15451918|ref|NP_203132.1| bone morphogenetic protein receptor...    32   4.1
gi|9966907|ref|NP_065160.1| ARS component B precursor; anti-neop...    32   4.1
gi|46578131|gb|AAT01436.1| SLURP1 [Homo sapiens]                       32   4.1
gi|1009410|emb|CAA88759.1| BMPR-II precursor [Homo sapiens]            32   4.1
gi|6680804|ref|NP_031587.1| bone morphogenic protein receptor, t...    32   4.1
gi|15451916|ref|NP_001195.2| bone morphogenetic protein receptor...    32   4.1
gi|38082161|ref|XP_139863.3| similar to Cytochrome P450 4F6 (CYP...    32   4.1
gi|17560288|ref|NP_505231.1| putative protein (5J118) [Caenorhab...    32   4.1
gi|47218656|emb|CAG04985.1| unnamed protein product [Tetraodon n...    31   5.4
gi|206322|gb|AAA41920.1| phospholipase A2 precursor (EC 3.1.1.4)       31   5.4
gi|129493|sp|P14423|PA2A_RAT Phospholipase A2, membrane associat...    31   5.4
gi|13928814|ref|NP_113786.1| phospholipase A2, group IIA; eted e...    31   5.4
gi|128969|sp|P01429|NXS1_NAJHA Short neurotoxin 1 (Neurotoxin al...    31   5.4
gi|31791028|ref|NP_853641.1| keratin associated protein 19-4 [Ho...    31   5.4
gi|40217949|gb|AAR82897.1| high glycine/tyrosine type II keratin...    31   5.4
gi|32565978|ref|NP_872094.1| putative secreted or extracellular ...    31   5.4
gi|17543734|ref|NP_502767.1| predicted CDS, putative protein (4P...    31   7.0
gi|34912344|ref|NP_917519.1| putative Ser/Thr specific protein p...    31   7.0
gi|48112643|ref|XP_393150.1| similar to CG33196-PB [Apis mellifera]    31   7.0
gi|34763145|ref|ZP_00144113.1| hypothetical protein [Fusobacteri...    31   7.0
gi|32329264|gb|AAP74770.1| high-glycine tyrosine keratin type II...    31   7.0
gi|128980|sp|P01433|NXS2_HEMHA Short neurotoxin 2 (Toxin IV) >gn...    31   7.0
gi|128986|sp|P01420|NXS3_NAJHA Short neurotoxin 3 (Toxin CM-10) ...    31   7.0
gi|128989|sp|P01421|NXS4_NAJHA Short neurotoxin 4 (Toxin CM-12) ...    31   7.0
gi|5230707|gb|AAD40971.1| short neurotoxin precursor [Pseudonaja...    31   7.0
gi|39593360|emb|CAE64830.1| Hypothetical protein CBG09626 [Caeno...    31   7.0
gi|17552582|ref|NP_497519.1| predicted CDS, putative cytoplasmic...    31   7.0
gi|1237202|emb|CAA65612.1| histidine kinase [Dictyostelium disco...    31   7.0
gi|47228422|emb|CAG05242.1| unnamed protein product [Tetraodon n...    31   7.0
gi|7489908|pir||S71628 sensory transduction histidine kinase dok...    31   7.0
gi|28829987|gb|AAO52477.1| similar to Dictyostelium discoideum (...    31   7.0
gi|15227497|ref|NP_181736.1| CHP-rich zinc finger protein, putat...    30   9.1
gi|49333363|gb|AAT64006.1| cellobiohydrolase I-I [Volvariella vo...    30   9.1
gi|50878437|gb|AAT85211.1| hypothetical protein [Oryza sativa (j...    30   9.1
gi|46948836|gb|AAT07317.1| wishful thinking [Anopheles gambiae]        30   9.1
gi|50748630|ref|XP_421333.1| PREDICTED: similar to KIAA1525 prot...    30   9.1
gi|23482460|gb|EAA18439.1| cysteine repeat modular protein 3 PbC...    30   9.1
gi|23612740|ref|NP_704279.1| hypothetical protein [Plasmodium fa...    30   9.1
gi|741696|prf||2007441A viscotoxin                                     30   9.1
gi|136561|sp|P25677|TXW3_NAJHA Weak toxin CM-3                         30   9.1
gi|24638079|sp|Q9W7K2|NXS1_PSETE Short neurotoxin 1/5 precursor ...    30   9.1
gi|22164198|gb|AAM93604.1| putative secreted protein [Ixodes sca...    30   9.1
gi|34862844|ref|XP_234862.2| similar to zinc finger protein [Rat...    30   9.1
gi|39585743|emb|CAE59945.1| Hypothetical protein CBG03432 [Caeno...    30   9.1
gi|31213261|ref|XP_315574.1| ENSANGP00000017662 [Anopheles gambi...    30   9.1
gi|32399031|emb|CAD98271.1| ubiquitin-specific protease, probabl...    30   9.1


>gi|17534425|ref|NP_495170.1| putative secreted or extracellular
           protein precursor (2G155) [Caenorhabditis elegans]
 gi|14916314|gb|AAK73880.1| Hypothetical protein F55C12.7
           [Caenorhabditis elegans]
          Length = 111

 Score =  209 bits (532), Expect = 1e-53
 Identities = 97/111 (87%), Positives = 97/111 (87%)
 Frame = +1

Query: 1   MSSKXXXXXXXXXXXXXXYSLQCYYGQIVNGQTTVPFVSEPCPFSKYCMKIFQTGSYNNI 180
           MSSK              YSLQCYYGQIVNGQTTVPFVSEPCPFSKYCMKIFQTGSYNNI
Sbjct: 1   MSSKLLFLAVLLTVVTVAYSLQCYYGQIVNGQTTVPFVSEPCPFSKYCMKIFQTGSYNNI 60

Query: 181 YATYGCGTNQCSSSGCSTNKNGYGTCCCTRDLCNSGFDFSKTTLSSIVQIL 333
           YATYGCGTNQCSSSGCSTNKNGYGTCCCTRDLCNSGFDFSKTTLSSIVQIL
Sbjct: 61  YATYGCGTNQCSSSGCSTNKNGYGTCCCTRDLCNSGFDFSKTTLSSIVQIL 111




[DB home][top]