Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F48E8_8
(939 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17553496|ref|NP_498166.1| glioma pathogenesis-related protein... 554 e-157
gi|17553494|ref|NP_498167.1| glioma pathogenesis-related protein... 525 e-148
gi|39580672|emb|CAE61354.1| Hypothetical protein CBG05195 [Caeno... 511 e-144
gi|25152554|ref|NP_741138.1| venom allergen 5, LONg body length ... 488 e-137
gi|21357507|ref|NP_650264.1| CG8483-PA [Drosophila melanogaster]... 97 7e-19
gi|50728356|ref|XP_416104.1| PREDICTED: similar to Glioma pathog... 93 1e-17
gi|34530413|dbj|BAC85892.1| unnamed protein product [Homo sapiens] 92 2e-17
gi|22761577|dbj|BAC11640.1| unnamed protein product [Homo sapiens] 92 2e-17
gi|31560776|ref|NP_076223.2| RIKEN cDNA 1200009H11 [Mus musculus... 91 3e-17
gi|9558479|dbj|BAB03453.1| cysteine-rich protease inhibitor [Mus... 91 3e-17
gi|50760281|ref|XP_417954.1| PREDICTED: similar to RIKEN cDNA 12... 91 4e-17
gi|23503319|ref|NP_699201.1| hypothetical protein MGC45378 [Homo... 91 4e-17
gi|48428843|sp|Q8AVA3|CRVP_PSEPO Pseudecin precursor >gnl|BL_ORD... 91 4e-17
gi|1085313|pir||JC4131 glioma pathogenesis-related protein - human 90 6e-17
gi|34852277|ref|XP_215351.2| similar to cysteine-rich protease i... 90 6e-17
gi|2500710|sp|Q60477|CRS2_CAVPO Cysteine-rich secretory protein-... 90 8e-17
gi|48474524|sp|Q8UW11|CRV2_LAPHA Cysteine-rich venom protein 2 p... 90 8e-17
gi|24270816|gb|AAA82731.3| glioma pathogenesis-related protein [... 89 1e-16
gi|5803151|ref|NP_006842.1| glioma pathogenesis-related protein;... 89 1e-16
gi|27735198|sp|P48060|GLIP_HUMAN Glioma pathogenesis-related pro... 89 1e-16
gi|48474525|sp|Q8UW25|CRV1_LAPHA Cysteine-rich venom protein 1 p... 89 1e-16
gi|6136165|sp|P81657|VA5_VESMA Venom allergen 5 (Antigen 5) (Ag5... 89 1e-16
gi|37181969|gb|AAQ88788.1| HGSC289 [Homo sapiens] 89 1e-16
gi|37574025|gb|AAH22399.2| PI16 protein [Homo sapiens] 89 1e-16
gi|2136189|pir||S68691 neutrophil granules matrix glycoprotein S... 89 2e-16
gi|3023562|sp|O19010|CRS3_HORSE Cysteine-rich secretory protein-... 89 2e-16
gi|26189922|emb|CAD31227.1| cysteine-rich secretory protein 3 [E... 89 2e-16
gi|5174675|ref|NP_006052.1| cysteine-rich secretory protein 3; s... 89 2e-16
gi|11990878|emb|CAC19654.1| dJ417L20.1 (cysteine-rich secretory ... 89 2e-16
gi|37182699|gb|AAQ89150.1| trypsin inhibitor [Homo sapiens] 88 2e-16
gi|21312072|ref|NP_082884.1| GLI pathogenesis-related 1 (glioma)... 88 2e-16
gi|13899332|ref|NP_113664.1| hypothetical protein DKFZp434B044 [... 88 2e-16
gi|14042040|dbj|BAB55081.1| unnamed protein product [Homo sapiens] 88 2e-16
gi|38614471|gb|AAH63012.1| Unknown (protein for MGC:74865) [Homo... 88 3e-16
gi|18000269|gb|AAL54896.1| cysteine-rich venom protein precursor... 88 3e-16
gi|48474866|sp|Q8JI38|CRVP_LATSE Latisemin precursor >gnl|BL_ORD... 88 3e-16
gi|34851731|ref|XP_346524.1| hypothetical protein XP_346523 [Rat... 85 2e-15
gi|85299|pir||B31085 antigen 5-3 precursor - bald-faced hornet (... 85 2e-15
gi|552080|gb|AAA28302.1| antigen 5 precursor [Dolichovespula mac... 85 2e-15
gi|549186|sp|P10737|VA53_DOLMA Venom allergen 5.02 precursor (An... 85 2e-15
gi|48428841|sp|Q7ZZN8|CRV2_NAJAT Natrin 2 precursor (Cysteine-ri... 85 3e-15
gi|465052|sp|Q05108|VA5_DOLAR Venom allergen 5 (Antigen 5) (Ag5)... 85 3e-15
gi|465053|sp|Q05109|VA5_POLAN Venom allergen 5 precursor (Antige... 84 5e-15
gi|50745274|ref|XP_420051.1| PREDICTED: similar to cysteine-rich... 84 5e-15
gi|19924045|ref|NP_612527.1| late gestation lung protein 1 [Ratt... 84 6e-15
gi|549184|sp|P35781|VA51_VESCR Venom allergen 5.01 (Antigen 5-1)... 84 6e-15
gi|47209394|emb|CAF91962.1| unnamed protein product [Tetraodon n... 84 6e-15
gi|48428844|sp|Q8AVA4|CRVP_PSEAU Pseudechetoxin precursor (PsTx)... 84 6e-15
gi|549187|sp|P35759|VA5_POLEX Venom allergen 5 (Antigen 5) (Ag5)... 83 8e-15
gi|32965153|gb|AAP91764.1| HrTT-1-like [Ciona intestinalis] 83 8e-15
gi|549185|sp|P35782|VA52_VESCR Venom allergen 5.02 (Antigen 5-2)... 83 1e-14
gi|12838657|dbj|BAB24280.1| unnamed protein product [Mus musculus] 82 2e-14
gi|50401874|sp|P79845|CRVP_TRIMU Cysteine-rich venom protein pre... 82 2e-14
gi|47230411|emb|CAF99604.1| unnamed protein product [Tetraodon n... 82 2e-14
gi|417753|sp|Q03401|AEG1_MOUSE Sperm-coating glycoprotein 1 prec... 82 2e-14
gi|24657486|gb|AAH39124.1| 1200009H11Rik protein [Mus musculus] 82 2e-14
gi|27229267|ref|NP_084485.1| RIKEN cDNA 1810049K24 [Mus musculus... 81 3e-14
gi|549188|sp|P35780|VA5_POLFU Venom allergen 5 (Antigen 5) (Ag5)... 81 4e-14
gi|26189920|emb|CAD31226.1| cystein-rich secretory protein 2 [Eq... 80 5e-14
gi|37182583|gb|AAQ89093.1| ALKN2972 [Homo sapiens] 80 7e-14
gi|12408314|ref|NP_074050.1| epididymal glycoprotein [Rattus nor... 80 7e-14
gi|31981914|ref|NP_033768.2| cysteine-rich secretory protein 1; ... 80 7e-14
gi|27718249|ref|XP_216892.1| similar to GLI pathogenesis-related... 80 7e-14
gi|6678423|ref|NP_033446.1| cysteine-rich secretory protein 2; t... 80 7e-14
gi|13676849|ref|NP_112519.1| testis specific protein 1 [Rattus n... 80 7e-14
gi|34874256|ref|XP_346849.1| hypothetical protein XP_346848 [Rat... 80 7e-14
gi|26329519|dbj|BAC28498.1| unnamed protein product [Mus musculus] 80 7e-14
gi|549190|sp|P35784|VA5_VESGE Venom allergen 5 (Antigen 5) (Ag5)... 80 9e-14
gi|137395|sp|P10736|VA52_DOLMA Venom allergen 5.01 precursor (An... 80 9e-14
gi|50728354|ref|XP_416103.1| PREDICTED: similar to Glioma pathog... 79 1e-13
gi|6136164|sp|P81656|VA5_POLDO Venom allergen 5 (Antigen 5) (Ag5... 79 1e-13
gi|26334089|dbj|BAC30762.1| unnamed protein product [Mus musculus] 79 2e-13
gi|34865667|ref|XP_237257.2| similar to protease inhibitor 15; c... 79 2e-13
gi|16716491|ref|NP_444421.1| protease inhibitor 15; cysteine-ric... 79 2e-13
gi|45383490|ref|NP_989665.1| protease inhibitor 15 [Gallus gallu... 79 2e-13
gi|4507671|ref|NP_003287.1| testis specific protein 1; glycerald... 78 2e-13
gi|22749527|ref|NP_689992.1| hypothetical protein MGC26856 [Homo... 78 3e-13
gi|48428845|sp|Q8JGT9|CRVP_RHATT Tigrin precursor >gnl|BL_ORD_ID... 78 3e-13
gi|549191|sp|P35760|VA5_VESMC Venom allergen 5 (Antigen 5) (Ag5)... 78 3e-13
gi|549192|sp|P35785|VA5_VESPE Venom allergen 5 (Antigen 5) (Ag5)... 78 3e-13
gi|549193|sp|P35786|VA5_VESSQ Venom allergen 5 (Antigen 5) (Ag5)... 77 4e-13
gi|50728450|ref|XP_425443.1| PREDICTED: similar to glioma pathog... 77 4e-13
gi|48428842|sp|Q7ZZN9|CRVP_TRIJE Cysteine-rich venom protein pre... 77 4e-13
gi|7705676|ref|NP_056970.1| protease inhibitor 15 preproprotein;... 77 4e-13
gi|33150842|gb|AAP97299.1| hypothetical protein [Homo sapiens] 77 6e-13
gi|18000318|gb|AAL54918.1| cysteine-rich venom protein [Lapemis ... 77 6e-13
gi|4826574|emb|CAB42887.1| allergen 5; antigen 5 [Vespula vulgaris] 77 6e-13
gi|33504575|ref|NP_872425.1| secretory protein LOC348174 [Homo s... 77 6e-13
gi|22760438|dbj|BAC11199.1| unnamed protein product [Homo sapiens] 77 6e-13
gi|48474867|sp|Q8JI39|CRVP_TRIFL Triflin precursor >gnl|BL_ORD_I... 77 6e-13
gi|45382819|ref|NP_989985.1| CocoaCrisp [Gallus gallus] >gnl|BL_... 77 6e-13
gi|47117356|sp|Q7Z156|VA5_POLSR Venom allergen 5 (Antigen 5) (Ag... 77 7e-13
gi|49118639|gb|AAH73666.1| Unknown (protein for IMAGE:5570266) [... 77 7e-13
gi|31747352|gb|AAP57536.1| venom allergen 5 [Polybia scutellaris] 77 7e-13
gi|2500711|sp|Q91055|HELO_HELHO Helothermine precursor (HLTx) >g... 76 9e-13
gi|37181871|gb|AAQ88739.1| LHPE306 [Homo sapiens] 76 9e-13
gi|42660902|ref|XP_375369.1| similar to LHPE306 [Homo sapiens] 76 9e-13
gi|549189|sp|P35783|VA5_VESFL Venom allergen 5 (Antigen 5) (Ag5)... 76 9e-13
gi|33518699|gb|AAQ20832.1| antigen-5-like protein precursor [Rho... 76 9e-13
gi|50418413|gb|AAH78143.1| Secretory protein LOC348174 [Homo sap... 76 9e-13
gi|11514279|pdb|1QNX|A Chain A, Ves V 5, An Allergen From Vespul... 76 1e-12
gi|465054|sp|Q05110|VA5_VESVU Venom allergen 5 precursor (Antige... 76 1e-12
gi|45476808|sp|P60623|CRVP_TRIST Cysteine-rich secretory protein... 75 2e-12
gi|15987513|gb|AAL12003.1| allurin [Xenopus laevis] 75 2e-12
gi|27734736|ref|NP_775890.1| hypothetical protein MGC34761 [Homo... 75 2e-12
gi|48428837|sp|Q7T1K6|CRV1_NAJAT Natrin 1 precursor (Cysteine-ri... 75 2e-12
gi|50306407|ref|XP_453177.1| unnamed protein product [Kluyveromy... 75 2e-12
gi|25091511|sp|P83377|VA5_POLGA Venom allergen 5 (Antigen 5) (Ag... 75 2e-12
gi|32423812|gb|AAP81292.1| opharin precursor [Ophiophagus hannah] 75 2e-12
gi|48428839|sp|Q7ZT99|CRVP_CROAT Catrin 1/2 precursor >gnl|BL_OR... 75 3e-12
gi|48428840|sp|Q7ZTA0|CRVP_AGKPI Piscivorin precursor >gnl|BL_OR... 75 3e-12
gi|17540532|ref|NP_502498.1| secreted protein ASP-2 precursor fa... 75 3e-12
gi|29568408|gb|AAO84055.1| cysteine rich secretory protein [Xeno... 75 3e-12
gi|48428838|sp|Q7ZT98|CRVP_OPHHA Ophanin precursor (Opharin) >gn... 75 3e-12
gi|48428846|sp|Q8JI40|CRVP_AGKHA Ablomin precursor >gnl|BL_ORD_I... 74 4e-12
gi|6136163|sp|P35779|VA3_SOLRI Venom allergen III (Allergen Sol ... 74 5e-12
gi|549194|sp|P35787|VA5_VESVI Venom allergen 5 (Antigen 5) (Ag5)... 74 5e-12
gi|34851929|ref|XP_226473.2| similar to mannose receptor precurs... 74 6e-12
gi|6322383|ref|NP_012457.1| Protein of unknown function, has sim... 73 8e-12
gi|34865643|ref|XP_237258.2| similar to CocoaCrisp [Rattus norve... 73 8e-12
gi|50753922|ref|XP_414180.1| PREDICTED: similar to hypothetical ... 73 8e-12
gi|31322506|gb|AAP22983.1| mannose receptor precursor-like isofo... 73 1e-11
gi|31559797|ref|NP_853527.1| mannose receptor-like [Mus musculus... 73 1e-11
gi|31376251|gb|AAP44113.1| testis-specific protein TPX1 c isofor... 73 1e-11
gi|31322514|gb|AAP22987.1| mannose receptor precursor-like isofo... 73 1e-11
gi|31322510|gb|AAP22985.1| mannose receptor precursor-like isofo... 73 1e-11
gi|1778013|gb|AAB48565.1| prepro-cysteine-rich venom protein [Pr... 72 1e-11
gi|13899303|ref|NP_113649.1| CocoaCrisp [Homo sapiens] >gnl|BL_O... 72 1e-11
gi|3549887|emb|CAA07160.1| cysteine-rich secretory protein-2 [Eq... 72 2e-11
gi|6322382|ref|NP_012456.1| Protein of unknown function, has sim... 72 2e-11
gi|1246085|gb|AAB35899.1| acidic epididymal glycoprotein homolog... 72 2e-11
gi|25121982|ref|NP_001122.2| acidic epididymal glycoprotein-like... 72 2e-11
gi|30425410|ref|NP_848586.1| R3H domain (binds single-stranded n... 71 3e-11
gi|39581697|emb|CAE71030.1| Hypothetical protein CBG17870 [Caeno... 71 3e-11
gi|41054828|ref|NP_956764.1| hypothetical protein MGC63636 [Dani... 71 4e-11
gi|48096643|ref|XP_392492.1| similar to acetylcholinesterase [Ap... 71 4e-11
gi|13878237|ref|NP_113579.1| Cocoacrisp protein [Mus musculus] >... 71 4e-11
gi|33284916|emb|CAE17614.1| SI:bZ1M12.1 (novel protein similar t... 70 5e-11
gi|17539738|ref|NP_502532.1| allergen V5/Tpx-1 related precursor... 70 5e-11
gi|7442176|pir||T08154 pathogenesis-related protein PR1 - rape >... 70 7e-11
gi|21998567|emb|CAC86394.2| cystein rich secretory protein 1 [Eq... 70 7e-11
gi|12860902|dbj|BAB32077.1| unnamed protein product [Mus musculus] 70 9e-11
gi|13676427|dbj|BAB41141.1| hypothetical protein [Macaca fascicu... 70 9e-11
gi|39579905|emb|CAE56329.1| Hypothetical protein CBG23994 [Caeno... 70 9e-11
gi|13560653|gb|AAK30143.1| pathogenesis-related protein PR-1 pre... 70 9e-11
gi|47223528|emb|CAF98015.1| unnamed protein product [Tetraodon n... 70 9e-11
gi|47497545|dbj|BAD19617.1| putative pathogenesis-related protei... 69 2e-10
gi|50288531|ref|XP_446695.1| unnamed protein product [Candida gl... 69 2e-10
gi|39587728|emb|CAE58666.1| Hypothetical protein CBG01835 [Caeno... 69 2e-10
gi|26996572|gb|AAH40768.1| Cocoacrisp protein [Mus musculus] 68 3e-10
gi|45361475|ref|NP_989314.1| hypothetical protein MGC76177 [Xeno... 68 3e-10
gi|3549885|emb|CAA07159.1| cysteine-rich secretory protein-1 [Eq... 68 3e-10
gi|50306405|ref|XP_453176.1| unnamed protein product [Kluyveromy... 68 3e-10
gi|2696794|dbj|BAA24011.1| HrTT-1 [Halocynthia roretzi] 68 3e-10
gi|1336808|gb|AAB36116.1| Sol i 3=antigen [Solenopsis invicta=im... 68 3e-10
gi|50345391|gb|AAT74668.1| cysteine-rich secreted protein 2 [Mes... 68 3e-10
gi|6322864|ref|NP_012938.1| Protein of unknown function, has sim... 68 3e-10
gi|1582766|prf||2119294B YFW12 gene 68 3e-10
gi|17539076|ref|NP_502506.1| allergen V5/Tpx-1 related precursor... 68 3e-10
gi|548588|sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1... 68 3e-10
gi|14424466|sp|P35778|VA3_SOLIN Venom allergen III precursor (Al... 68 3e-10
gi|17540542|ref|NP_502503.1| allergen V5/Tpx-1 related precursor... 67 6e-10
gi|49069060|ref|XP_398819.1| hypothetical protein UM01204.1 [Ust... 67 6e-10
gi|17539080|ref|NP_502508.1| allergen V5/Tpx-1 related family me... 67 6e-10
gi|34395115|dbj|BAC84831.1| putative pathogenesis-related protei... 67 6e-10
gi|130846|sp|P11670|PRB1_TOBAC Basic form of pathogenesis-relate... 67 6e-10
gi|6753004|ref|NP_033769.1| cysteine-rich secretory protein 3; a... 67 6e-10
gi|38075238|ref|XP_355362.1| similar to R3H domain (binds single... 67 8e-10
gi|50287531|ref|XP_446195.1| unnamed protein product [Candida gl... 67 8e-10
gi|17221641|dbj|BAB78476.1| PR-1 [Solanum torvum] 67 8e-10
gi|50304613|ref|XP_452262.1| unnamed protein product [Kluyveromy... 66 1e-09
gi|548589|sp|P35793|PR13_HORVU Pathogenesis-related protein PRB1... 66 1e-09
gi|50726421|dbj|BAD34031.1| putative pathogenesis related protei... 66 1e-09
gi|3702665|emb|CAA07474.1| pathogenisis-related protein 1.2 [Tri... 66 1e-09
gi|2129798|pir||S65777 pathogenesis-related protein 1a homolog p... 66 1e-09
gi|34393704|dbj|BAC83017.1| putative Pathogenesis-related protei... 66 1e-09
gi|548592|sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 pre... 66 1e-09
gi|34900744|ref|NP_911718.1| putative type-1 pathogenesis-relate... 66 1e-09
gi|47497544|dbj|BAD19616.1| putative pathogenesis-related protei... 65 2e-09
gi|34900740|ref|NP_911716.1| putative pathogenesis-related prote... 65 2e-09
gi|1709754|sp|Q08697|PR1A_LYCES Pathogenesis-related protein 1A1... 65 2e-09
gi|23630526|gb|AAN37409.1| pathogenesis-related protein 1 [Brass... 65 2e-09
gi|17539082|ref|NP_502509.1| allergen V5/Tpx-1 related family me... 65 2e-09
gi|29840988|gb|AAP06001.1| similar to GenBank Accession Number A... 65 2e-09
gi|480679|pir||S37166 pathogenesis-related protein 1a - barley >... 65 2e-09
gi|25121984|ref|NP_733758.1| acidic epididymal glycoprotein-like... 65 2e-09
gi|50258547|gb|EAL21234.1| hypothetical protein CNBD2890 [Crypto... 65 3e-09
gi|39582258|emb|CAE64209.1| Hypothetical protein CBG08842 [Caeno... 65 3e-09
gi|34395117|dbj|BAC84833.1| putative pathogenesis-related protei... 64 4e-09
gi|47497162|dbj|BAD19210.1| putative pathogenesis related protei... 64 4e-09
gi|3702663|emb|CAA07473.1| pathogenisis-related protein 1.1 [Tri... 64 4e-09
gi|15235056|ref|NP_195098.1| pathogenesis-related protein, putat... 64 5e-09
gi|2796175|gb|AAB97282.1| vespid allergen antigen homolog [Oncho... 64 6e-09
gi|282959|pir||S22531 pathogenesis-related protein 1b - common t... 64 6e-09
gi|41055626|ref|NP_956869.1| hypothetical protein MGC65887 [Dani... 64 6e-09
gi|15225974|ref|NP_179068.1| pathogenesis-related protein 1 (PR-... 63 8e-09
gi|31322508|gb|AAP22984.1| mannose receptor precursor-like isofo... 63 8e-09
gi|34395102|dbj|BAC84818.1| putative pathogenesis-related protei... 63 1e-08
gi|112558|pir||B37330 venom allergen III - red imported fire ant... 63 1e-08
gi|34395121|dbj|BAC84837.1| putative pathogenesis-related protei... 63 1e-08
gi|14334165|gb|AAK60565.1| pathogenesis-related protein 1 [Triti... 63 1e-08
gi|17540530|ref|NP_502497.1| venom allergen-like protein precurs... 62 1e-08
gi|47605560|sp|Q9XSD3|CRS1_MACMU Cysteine-rich secretory protein... 62 1e-08
gi|41018458|sp|Q7YT83|TX31_CONTE Substrate-specific endoprotease... 62 1e-08
gi|50745336|ref|XP_426225.1| PREDICTED: similar to ophanin [Gall... 62 1e-08
gi|39587738|emb|CAE58676.1| Hypothetical protein CBG01850 [Caeno... 62 1e-08
gi|1228950|emb|CAA65420.1| pathogenesis-related protein 1 [Arabi... 62 2e-08
gi|130940|sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS... 62 2e-08
gi|15235081|ref|NP_195099.1| pathogenesis-related protein, putat... 62 2e-08
gi|15239598|ref|NP_197985.1| pathogenesis-related protein, putat... 62 2e-08
gi|19073340|gb|AAL84768.1| pathogenesis-related protein 1-1a [Cu... 62 2e-08
gi|2500715|sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1... 62 2e-08
gi|15225280|ref|NP_179589.1| pathogenesis-related protein 1 (PR-... 62 2e-08
gi|13625885|gb|AAK35187.1| activation associated secreted protei... 62 2e-08
gi|48527854|gb|AAT46023.1| pathogenesis-related protein 1 [Brass... 61 3e-08
gi|39587727|emb|CAE58665.1| Hypothetical protein CBG01834 [Caeno... 61 3e-08
gi|6066750|emb|CAB58263.1| pathogenesis related protein PR-1 [So... 61 3e-08
gi|15625250|gb|AAL01594.1| pathogenesis-related protein 1b precu... 61 3e-08
gi|21726980|emb|CAD38276.1| pathogenesis related protein isoform... 61 3e-08
gi|38107344|gb|EAA53530.1| hypothetical protein MG07807.4 [Magna... 61 3e-08
gi|17540540|ref|NP_502502.1| SCP-Like extracellular protein (scl... 61 4e-08
gi|7442178|pir||S71554 pathogenesis-related protein bpr1-1 precu... 61 4e-08
gi|4324680|gb|AAD16985.1| vespid allergen antigen homolog [Wuche... 61 4e-08
gi|21726982|emb|CAD38277.1| pathogenesis related protein isoform... 61 4e-08
gi|7442179|pir||T02054 pathogenesis related protein-1 - maize >g... 61 4e-08
gi|1469932|gb|AAB05225.1| pathogenesis-related protein-1 61 4e-08
gi|11277195|pir||JC7330 acidic pathogenesis-related protein 1a p... 61 4e-08
gi|100907|pir||A33155 pathogenesis-related protein 1 - maize >gn... 61 4e-08
gi|7768107|emb|CAB90614.1| cysteine-rich secretory protein-2 [Bo... 60 5e-08
gi|16751565|gb|AAL27696.1| pathogenesis-related protein PR1 [Bra... 60 5e-08
gi|17561866|ref|NP_504056.1| allergen V5/Tpx-1 related family me... 60 5e-08
gi|39579904|emb|CAE56328.1| Hypothetical protein CBG23993 [Caeno... 60 7e-08
gi|40646968|gb|AAQ19681.1| cytoplasmic small heat shock protein ... 60 7e-08
gi|39587736|emb|CAE58674.1| Hypothetical protein CBG01847 [Caeno... 60 7e-08
gi|46436621|gb|EAK95980.1| hypothetical protein CaO19.7218 [Cand... 60 9e-08
gi|15235992|ref|NP_194308.1| pathogenesis-related protein, putat... 60 9e-08
gi|47497163|dbj|BAD19211.1| putative Pathogenesis-related protei... 60 9e-08
gi|34914926|ref|NP_918810.1| rice pathogenesis-related protein c... 60 9e-08
gi|536789|emb|CAA29023.1| PR-1c protein [Nicotiana tabacum] 59 1e-07
gi|37531954|ref|NP_920279.1| putative type-1 pathogenesis-relate... 59 1e-07
gi|34914936|ref|NP_918815.1| putative pathogenesis-related prote... 59 1e-07
gi|130828|sp|P09042|PR1C_TOBAC Pathogenesis-related protein 1C p... 59 1e-07
gi|39590516|emb|CAE66256.1| Hypothetical protein CBG11500 [Caeno... 59 1e-07
gi|536788|emb|CAA31010.1| PR1c preprotein [Nicotiana tabacum] 59 1e-07
gi|28201315|dbj|BAC56823.1| putative pathogenesis-related protei... 59 1e-07
gi|100370|pir||S10205 pathogenesis-related protein 1 - common to... 59 2e-07
gi|39588585|emb|CAE58108.1| Hypothetical protein CBG01194 [Caeno... 59 2e-07
gi|3719257|gb|AAD13339.1| ancylostoma-secreted protein 1 precurs... 59 2e-07
gi|548586|sp|Q04108|PR04_LYCES Pathogenesis-related leaf protein... 59 2e-07
gi|15232719|ref|NP_187570.1| pathogenesis-related protein, putat... 59 2e-07
gi|34395063|dbj|BAC84725.1| putative pathogenesis-related protei... 59 2e-07
gi|39584502|emb|CAE74580.1| Hypothetical protein CBG22345 [Caeno... 59 2e-07
gi|23268455|gb|AAN11402.1| secreted-protein 1 precursor [Ancylos... 59 2e-07
gi|45184646|ref|NP_982364.1| AAL178Wp [Eremothecium gossypii] >g... 59 2e-07
gi|34865028|ref|XP_345822.1| similar to RIKEN cDNA 4921508O11 [R... 59 2e-07
gi|42557353|dbj|BAD11072.1| pathogenesis-related protein 1 [Caps... 59 2e-07
gi|46440579|gb|EAK99883.1| hypothetical protein CaO19.6200 [Cand... 59 2e-07
gi|5305210|gb|AAD41529.1| acidic epididymal glycoprotein D/E [Ra... 59 2e-07
gi|30144637|gb|AAP14676.1| pathogenesis related-1 [Triticum aest... 58 3e-07
gi|42561586|ref|NP_171638.2| allergen V5/Tpx-1-related family pr... 58 3e-07
gi|25518458|pir||D86143 hypothetical protein F6F3.11 - Arabidops... 58 3e-07
gi|19944|emb|CAA30017.1| unnamed protein product [Nicotiana taba... 58 3e-07
gi|13625909|gb|AAK35199.1| activation associated secreted protei... 58 3e-07
gi|46440490|gb|EAK99795.1| hypothetical protein CaO19.13580 [Can... 58 3e-07
gi|13625879|gb|AAK35184.1| activation associated secreted protei... 58 3e-07
gi|7596932|gb|AAB97283.2| vespid allergen antigen homolog [Brugi... 58 3e-07
gi|17539084|ref|NP_502510.1| allergen V5/Tpx-1 related precursor... 58 3e-07
gi|688429|dbj|BAA05473.1| tumor-related protein [Nicotiana glauc... 58 3e-07
gi|21304633|gb|AAM45439.1| pathogenesis-related protein 1 [Oryza... 58 3e-07
gi|34395126|dbj|BAC84842.1| PR-1 type pathogenesis-related prote... 58 3e-07
gi|46440493|gb|EAK99798.1| hypothetical protein CaO19.13583 [Can... 57 5e-07
gi|5868902|gb|AAB69625.2| activation-associated secreted protein... 57 5e-07
gi|17532893|ref|NP_494496.1| vespid allergen antigen homolog lik... 57 5e-07
gi|39588596|emb|CAE58120.1| Hypothetical protein CBG01207 [Caeno... 57 5e-07
gi|34395111|dbj|BAC84827.1| putative pathogenesis-related protei... 57 5e-07
gi|9963986|gb|AAG09789.1| repressed by TUP1 protein 4; Rbt4p [Ca... 57 6e-07
gi|39581270|emb|CAE60016.1| Hypothetical protein CBG03518 [Caeno... 57 6e-07
gi|48475149|gb|AAT44218.1| unknown protein [Oryza sativa (japoni... 57 6e-07
gi|15225965|ref|NP_179064.1| pathogenesis-related protein, putat... 57 6e-07
gi|4704758|gb|AAD28256.1| vespid allergen antigen homolog [Wuche... 57 8e-07
gi|17569627|ref|NP_509802.1| allergen V5/Tpx-1 related (XL408) [... 57 8e-07
gi|39587737|emb|CAE58675.1| Hypothetical protein CBG01849 [Caeno... 57 8e-07
gi|13625881|gb|AAK35185.1| activation associated secreted protei... 57 8e-07
gi|13625877|gb|AAK35183.1| activation associated secreted protei... 57 8e-07
gi|17540544|ref|NP_502504.1| allergen V5/Tpx-1 related precursor... 57 8e-07
gi|34395114|dbj|BAC84830.1| putative pathogenesis-related protei... 56 1e-06
gi|548587|sp|P04284|PR06_LYCES Pathogenesis-related leaf protein... 56 1e-06
gi|548901|sp|P35795|SC14_SCHCO Fruiting body protein SC14 precur... 56 1e-06
gi|45184645|ref|NP_982363.1| AAL179Wp [Eremothecium gossypii] >g... 56 1e-06
gi|30911057|gb|AAP41924.1| hypothetical protein [Homo sapiens] 56 1e-06
gi|3396070|gb|AAD13340.1| ancylostoma secreted protein 1 precurs... 56 1e-06
gi|2414525|emb|CAA04881.1| pathogenesis-related protein [Lycoper... 56 1e-06
gi|4884851|gb|AAD31839.1| ancylostoma-secreted protein 1 precurs... 56 1e-06
gi|15234704|ref|NP_194761.1| allergen V5/Tpx-1-related family pr... 56 1e-06
gi|13385730|ref|NP_080499.1| RIKEN cDNA 4921508O11 [Mus musculus... 56 1e-06
gi|2624502|pdb|1CFE| P14a, Nmr, 20 Structures 56 1e-06
gi|7442185|pir||T08126 pathogenesis-related protein 1 precursor ... 55 2e-06
gi|579402|emb|CAA31008.1| PR1a preprotein [Nicotiana tabacum] 55 2e-06
gi|2500713|sp|Q16937|ASP_ANCCA Ancylostoma secreted protein prec... 55 2e-06
gi|130826|sp|P08299|PR1A_TOBAC Pathogenesis-related protein 1A p... 55 2e-06
gi|15235962|ref|NP_194875.1| pathogenesis-related protein, putat... 55 2e-06
gi|21751967|dbj|BAC04085.1| unnamed protein product [Homo sapiens] 55 2e-06
gi|50549999|ref|XP_502472.1| hypothetical protein [Yarrowia lipo... 55 2e-06
gi|15230919|ref|NP_188603.1| pathogenesis-related protein, putat... 55 2e-06
gi|22748923|ref|NP_689649.1| hypothetical protein MGC39497 [Homo... 55 2e-06
gi|18765762|dbj|BAB85217.1| PR-1 like protein [Volvox carteri f.... 55 2e-06
gi|728622|emb|CAA29022.1| PR-1b protein [Nicotiana tabacum] 55 3e-06
gi|19948|emb|CAA31009.1| PR1b preprotein [Nicotiana tabacum] 55 3e-06
gi|3608493|gb|AAC35986.1| secreted protein ASP-2 precursor [Ancy... 55 3e-06
gi|15241922|ref|NP_195893.1| allergen V5/Tpx-1-related family pr... 55 3e-06
gi|32567250|ref|NP_506396.2| allergen V5/Tpx-1 related family me... 55 3e-06
gi|33413141|emb|CAD60273.1| putative pathogenesis related protei... 55 3e-06
gi|130827|sp|P07053|PR1B_TOBAC Pathogenesis-related protein 1B p... 55 3e-06
gi|4928711|gb|AAD33696.1| PR1a precursor [Glycine max] 55 3e-06
gi|218304|dbj|BAA14220.1| PR1a protein precursor [Nicotiana taba... 55 3e-06
gi|47205351|emb|CAF91801.1| unnamed protein product [Tetraodon n... 54 4e-06
gi|47497165|dbj|BAD19213.1| putative Pathogenesis-related protei... 54 4e-06
gi|17540534|ref|NP_502499.1| vap-1 like family member (4N815) [C... 54 4e-06
gi|46433051|gb|EAK92507.1| hypothetical protein CaO19.2787 [Cand... 54 5e-06
gi|46433074|gb|EAK92529.1| hypothetical protein CaO19.10303 [Can... 54 5e-06
gi|7513369|pir||JC5309 testis-specific, vespid, and pathogenesis... 54 7e-06
gi|15235994|ref|NP_194309.1| allergen V5/Tpx-1-related family pr... 54 7e-06
gi|39584312|emb|CAE65476.1| Hypothetical protein CBG10443 [Caeno... 53 9e-06
gi|28201322|dbj|BAC56830.1| putative pathogenesis-related protei... 53 9e-06
gi|33440014|gb|AAQ19031.1| Prb1 [Oryza sativa (japonica cultivar... 53 9e-06
gi|31075035|gb|AAP41952.1| secreted protein ASP-2 [Necator ameri... 53 9e-06
gi|7442177|pir||T07146 pathogenesis-related protein 1a2 - tomato... 53 9e-06
gi|49084626|ref|XP_404495.1| hypothetical protein AN0358.2 [Aspe... 53 9e-06
gi|3986149|dbj|BAA34937.1| PR-1 like protein [Camellia sinensis] 53 1e-05
gi|15240015|ref|NP_201460.1| allergen V5/Tpx-1-related family pr... 53 1e-05
gi|15225273|ref|NP_179587.1| pathogenesis-related protein, putat... 53 1e-05
gi|39588543|emb|CAE58066.1| Hypothetical protein CBG01145 [Caeno... 53 1e-05
gi|50425691|ref|XP_461442.1| unnamed protein product [Debaryomyc... 53 1e-05
gi|22327916|ref|NP_680450.1| allergen V5/Tpx-1-related family pr... 53 1e-05
gi|31217576|ref|XP_316453.1| ENSANGP00000020404 [Anopheles gambi... 53 1e-05
gi|39594953|emb|CAE70821.1| Hypothetical protein CBG17592 [Caeno... 52 1e-05
gi|21554246|gb|AAM63321.1| sts14 [Arabidopsis thaliana] 52 1e-05
gi|45199219|ref|NP_986248.1| AFR700Wp [Eremothecium gossypii] >g... 52 1e-05
gi|50550175|ref|XP_502560.1| hypothetical protein [Yarrowia lipo... 52 2e-05
gi|17566862|ref|NP_507655.1| CocoaCrisp precursor family member ... 52 2e-05
gi|50345393|gb|AAT74669.1| cysteine-rich secreted protein 3 [Mes... 52 2e-05
gi|34860759|ref|XP_345468.1| similar to dJ881L22.3 (novel protei... 52 3e-05
gi|2500716|sp|Q41359|PR1_SAMNI Pathogenesis-related protein PR-1... 52 3e-05
gi|50427127|ref|XP_462174.1| unnamed protein product [Debaryomyc... 52 3e-05
gi|28573995|ref|NP_608668.2| CG16995-PA [Drosophila melanogaster... 51 3e-05
gi|39587729|emb|CAE58667.1| Hypothetical protein CBG01836 [Caeno... 51 3e-05
gi|15222865|ref|NP_175428.1| pathogenesis-related protein, putat... 51 3e-05
gi|39581263|emb|CAE60009.1| Hypothetical protein CBG03511 [Caeno... 51 4e-05
gi|31223763|ref|XP_317349.1| ENSANGP00000010508 [Anopheles gambi... 51 4e-05
gi|15225275|ref|NP_179588.1| allergen V5/Tpx-1-related family pr... 51 4e-05
gi|50425713|ref|XP_461453.1| unnamed protein product [Debaryomyc... 51 4e-05
gi|548902|sp|P35794|SC7_SCHCO Fruiting body protein SC7 precurso... 50 6e-05
gi|46111725|ref|XP_382920.1| hypothetical protein FG02744.1 [Gib... 50 6e-05
gi|7500502|pir||T21763 hypothetical protein F35E12.1 - Caenorhab... 50 6e-05
gi|8698923|gb|AAF78527.1| pathogenesis-related proteins [Pyrus p... 50 6e-05
gi|39587730|emb|CAE58668.1| Hypothetical protein CBG01837 [Caeno... 50 6e-05
gi|11762066|gb|AAG40311.1| activation-associated secreted protei... 50 6e-05
gi|17561870|ref|NP_504055.1| allergen V5/Tpx-1 related family me... 50 7e-05
gi|34395120|dbj|BAC84836.1| putative pathogenesis-related protei... 50 7e-05
gi|50411137|ref|XP_457020.1| unnamed protein product [Debaryomyc... 50 7e-05
gi|31217584|ref|XP_316455.1| ENSANGP00000021046 [Anopheles gambi... 50 7e-05
gi|27372895|gb|AAO06821.1| salivary antigen-5 related protein [A... 50 1e-04
gi|8698925|gb|AAF78528.1| pathogenesis-related protein [Pyrus py... 50 1e-04
gi|31205369|ref|XP_311633.1| ENSANGP00000015042 [Anopheles gambi... 50 1e-04
gi|50414969|gb|AAH77873.1| Unknown (protein for MGC:80621) [Xeno... 50 1e-04
gi|46136065|ref|XP_389724.1| hypothetical protein FG09548.1 [Gib... 50 1e-04
gi|49086272|ref|XP_405195.1| hypothetical protein AN1058.2 [Aspe... 50 1e-04
gi|15235052|ref|NP_195097.1| pathogenesis-related protein, putat... 50 1e-04
gi|46435461|gb|EAK94842.1| hypothetical protein CaO19.2336 [Cand... 50 1e-04
gi|17558778|ref|NP_504963.1| glioma pathogenesis-related protein... 49 1e-04
gi|34395064|dbj|BAC84726.1| putative acidic PR-1 type pathogenes... 49 1e-04
gi|30027144|gb|AAP06732.1| ASP-2 protein [Onchocerca volvulus] 49 1e-04
gi|39588579|emb|CAE58102.1| Hypothetical protein CBG01188 [Caeno... 49 2e-04
gi|31213101|ref|XP_315494.1| ENSANGP00000021178 [Anopheles gambi... 49 2e-04
gi|2329928|gb|AAC47714.1| 24 kDa excretory/secretory protein [Ha... 49 2e-04
gi|31075037|gb|AAP41953.1| secreted protein ASP-2 [Ancylostoma c... 49 2e-04
gi|18389885|gb|AAL68779.1| antigen 5-related 2 protein [Anophele... 49 2e-04
gi|50758699|ref|XP_417377.1| PREDICTED: similar to R3H domain (b... 48 3e-04
gi|7407641|gb|AAF62171.1| pathogenesis-related protein 1 [Betula... 48 4e-04
gi|13562128|gb|AAK29126.1| activation-associated secreted protei... 48 4e-04
gi|46440581|gb|EAK99885.1| hypothetical protein CaO19.6202 [Cand... 47 6e-04
gi|2245508|gb|AAB62535.1| venom allergen antigen 5-like protein ... 47 6e-04
gi|21450576|gb|AAM54195.1| Venom allergen-like protein protein 1... 47 6e-04
gi|17565656|ref|NP_507793.1| testis specific protein like precur... 47 8e-04
gi|14326230|gb|AAK60209.1| vap-1 [Heterodera glycines] 47 8e-04
gi|39588597|emb|CAE58121.1| Hypothetical protein CBG01208 [Caeno... 46 0.001
gi|32409985|ref|XP_325473.1| hypothetical protein [Neurospora cr... 46 0.001
gi|50419877|ref|XP_458471.1| unnamed protein product [Debaryomyc... 46 0.001
gi|7768109|emb|CAB90615.1| cysteine-rich secretory protein-1 [Bo... 46 0.001
gi|48475147|gb|AAT44216.1| unknown protein [Oryza sativa (japoni... 46 0.001
gi|2914024|dbj|BAA24993.1| FSG 120k Cys-rich protein [Hemicentro... 46 0.001
gi|17542330|ref|NP_502228.1| secreted protein ASP-2 family membe... 46 0.001
gi|33359651|gb|AAQ17073.1| antigen 5-related salivary protein [A... 46 0.001
gi|39588550|emb|CAE58073.1| Hypothetical protein CBG01152 [Caeno... 46 0.001
gi|47213001|emb|CAF95393.1| unnamed protein product [Tetraodon n... 45 0.002
gi|38100752|gb|EAA47842.1| hypothetical protein MG03085.4 [Magna... 45 0.002
gi|31203615|ref|XP_310756.1| ENSANGP00000021983 [Anopheles gambi... 45 0.002
gi|49075842|ref|XP_401958.1| hypothetical protein UM04343.1 [Ust... 45 0.002
gi|2500717|sp|Q41495|ST14_SOLTU STS14 protein precursor >gnl|BL_... 45 0.002
gi|20129165|ref|NP_608663.1| CG4270-PA [Drosophila melanogaster]... 45 0.002
gi|39588582|emb|CAE58105.1| Hypothetical protein CBG01191 [Caeno... 45 0.003
gi|24656989|ref|NP_611582.1| CG17974-PA [Drosophila melanogaster... 45 0.003
gi|39588541|emb|CAE58064.1| Hypothetical protein CBG01143 [Caeno... 45 0.003
gi|38082490|ref|XP_355014.1| similar to acidic epididymal glycop... 45 0.003
gi|42733845|gb|AAS38763.1| similar to Dictyostelium discoideum (... 45 0.003
gi|25150837|ref|NP_741951.1| Venom-Allergen-like Protein VAP-1, ... 44 0.004
gi|38350629|gb|AAR18424.1| putative salivary antigen 5 family pr... 44 0.004
gi|31210575|ref|XP_314254.1| ENSANGP00000018746 [Anopheles gambi... 44 0.004
gi|31211113|ref|XP_314523.1| ENSANGP00000016942 [Anopheles gambi... 44 0.005
gi|31198689|ref|XP_308292.1| ENSANGP00000010752 [Anopheles gambi... 44 0.005
gi|31075033|gb|AAP41951.1| secreted protein ASP-2 [Ancylostoma d... 44 0.005
gi|31217681|ref|XP_316479.1| ENSANGP00000004285 [Anopheles gambi... 44 0.007
gi|47223529|emb|CAF98016.1| unnamed protein product [Tetraodon n... 44 0.007
gi|17538308|ref|NP_499859.1| allergen V5/Tpx-1 related family me... 44 0.007
gi|41615448|tpg|DAA03482.1| TPA: HDC00353 [Drosophila melanogaster] 44 0.007
gi|29124853|gb|AAO63576.1| secreted protein 4 precursor [Ancylos... 44 0.007
gi|39587558|emb|CAE58496.1| Hypothetical protein CBG01643 [Caeno... 44 0.007
gi|34556108|emb|CAA76822.2| putative gVAG protein precursor [Ano... 44 0.007
gi|31205367|ref|XP_311632.1| ENSANGP00000024498 [Anopheles gambi... 44 0.007
gi|31210577|ref|XP_314255.1| ENSANGP00000018751 [Anopheles gambi... 44 0.007
gi|31217598|ref|XP_316459.1| ENSANGP00000021028 [Anopheles gambi... 44 0.007
gi|39579940|emb|CAE74287.1| Hypothetical protein CBG21986 [Caeno... 43 0.009
gi|31203315|ref|XP_310606.1| ENSANGP00000019483 [Anopheles gambi... 43 0.009
gi|33945409|emb|CAD44296.1| pr-1-like protein [Physcomitrella pa... 43 0.009
gi|39596039|emb|CAE69675.1| Hypothetical protein CBG15925 [Caeno... 43 0.009
gi|18568316|gb|AAL76028.1| putative secreted protein [Aedes aegy... 43 0.012
gi|39588588|emb|CAE58111.1| Hypothetical protein CBG01197 [Caeno... 43 0.012
gi|13447461|gb|AAK21961.1| secreted venom allergen-like protein ... 43 0.012
gi|4102596|gb|AAD01511.1| secreted protein MSP-1 [Meloidogyne in... 42 0.015
gi|39588544|emb|CAE58067.1| Hypothetical protein CBG01146 [Caeno... 42 0.015
gi|7638032|gb|AAF65314.1| salivary allergen 2 [Ctenocephalides f... 42 0.015
gi|50803868|ref|XP_428688.1| PREDICTED: similar to hypothetical ... 42 0.015
gi|47225467|emb|CAG11950.1| unnamed protein product [Tetraodon n... 42 0.015
gi|14211968|gb|AAK55116.1| venom allergen-like protein [Heterode... 42 0.015
gi|17559376|ref|NP_507429.1| predicted CDS, glioma pathogenesis-... 42 0.015
gi|2905792|gb|AAC03562.1| putative secretory protein precursor; ... 42 0.020
gi|39587249|emb|CAE57717.1| Hypothetical protein CBG00725 [Caeno... 42 0.026
gi|46114940|ref|XP_383488.1| hypothetical protein FG03312.1 [Gib... 42 0.026
gi|4887102|gb|AAD32191.1| antigen 5-related protein [Lutzomyia l... 42 0.026
gi|38344687|emb|CAD40249.2| OSJNBb0096E05.9 [Oryza sativa (japon... 42 0.026
gi|17550220|ref|NP_509707.1| allergen V5/Tpx-1 related family me... 42 0.026
gi|2664196|emb|CAA05868.1| PR-1 protein [Vitis vinifera] 41 0.034
gi|13562122|gb|AAK29123.1| activation-associated secreted protei... 41 0.044
gi|39588614|emb|CAE58138.1| Hypothetical protein CBG01226 [Caeno... 41 0.044
gi|38344688|emb|CAE02369.2| OSJNBb0096E05.10 [Oryza sativa (japo... 41 0.044
gi|13562124|gb|AAK29124.1| activation-associated secreted protei... 40 0.058
gi|18568284|gb|AAL76012.1| putative secreted protein [Aedes aegy... 40 0.058
gi|32395295|gb|AAO72734.1| antigen 5 precursor [Stomoxys calcitr... 40 0.058
gi|17537371|ref|NP_493975.1| allergen V5/Tpx-1 related family me... 40 0.075
gi|46229593|gb|EAK90411.1| extracellular protein with a signal p... 40 0.075
gi|13562126|gb|AAK29125.1| activation-associated secreted protei... 40 0.075
gi|39581266|emb|CAE60012.1| Hypothetical protein CBG03514 [Caeno... 40 0.075
gi|17564430|ref|NP_507364.1| predicted CDS, glioma pathogenesis-... 40 0.075
gi|32406422|ref|XP_323824.1| hypothetical protein [Neurospora cr... 40 0.075
gi|31217593|ref|XP_316457.1| ENSANGP00000025115 [Anopheles gambi... 39 0.13
gi|17566860|ref|NP_507654.1| CocoaCrisp precursor family member ... 39 0.13
gi|25296205|pir||A96537 hypothetical protein F2J10.7 [imported] ... 39 0.17
gi|24656985|ref|NP_611581.1| CG9822-PA [Drosophila melanogaster]... 39 0.17
gi|39581269|emb|CAE60015.1| Hypothetical protein CBG03517 [Caeno... 39 0.17
gi|39588578|emb|CAE58101.1| Hypothetical protein CBG01185 [Caeno... 39 0.17
gi|31217579|ref|XP_316454.1| ENSANGP00000020471 [Anopheles gambi... 39 0.22
gi|31205375|ref|XP_311636.1| ENSANGP00000014974 [Anopheles gambi... 39 0.22
gi|46227116|gb|EAK88066.1| extracellular protein with signal pep... 38 0.29
gi|29841084|gb|AAP06097.1| similar to GenBank Accession Number A... 38 0.29
gi|46395674|sp|P81993|CRVP_BUNCA Bucarin 38 0.29
gi|24642010|ref|NP_524689.2| CG9540-PA [Drosophila melanogaster]... 38 0.37
gi|3342152|gb|AAD03844.1| antigen 5-related 2 [Drosophila melano... 38 0.37
gi|20978369|gb|AAM33434.1| pathogenesis-related protein 1 [Malus... 38 0.37
gi|21954552|dbj|BAC06345.1| gamete and mating-type specific prot... 38 0.37
gi|38078337|ref|XP_357369.1| similar to chromosome 9 open readin... 38 0.37
gi|33347401|gb|AAQ15283.1| pathogenesis-related protein 1 [Pyrus... 37 0.49
gi|50736221|ref|XP_419085.1| PREDICTED: similar to chromosome 9 ... 37 0.49
gi|15222863|ref|NP_175427.1| pathogenesis-related protein, putat... 37 0.49
gi|28573842|ref|NP_725234.2| CG30486-PA [Drosophila melanogaster... 37 0.64
gi|20269910|gb|AAM18099.1| pathogenesis-related protein 1 [Pyrus... 37 0.64
gi|33991824|gb|AAH56553.1| LOC407645 protein [Danio rerio] 37 0.83
gi|18568308|gb|AAL76024.1| putative secreted protein [Aedes aegy... 37 0.83
gi|50252720|dbj|BAD28946.1| transcription factor EIL1-like [Oryz... 36 1.1
gi|39588594|emb|CAE58117.1| Hypothetical protein CBG01204 [Caeno... 36 1.1
gi|31217588|ref|XP_316456.1| ENSANGP00000025316 [Anopheles gambi... 36 1.1
gi|11641247|ref|NP_071738.1| chromosome 9 open reading frame 19;... 36 1.1
gi|47059151|ref|NP_081726.1| GLI pathogenesis-related 2 [Mus mus... 36 1.1
gi|12751380|gb|AAK07633.1| vespid allergen antigen-like protein ... 36 1.4
gi|17402228|emb|CAD13385.1| bA421H8.2 (novel protein) [Homo sapi... 36 1.4
gi|31979121|gb|AAP68776.1| antigen 5-related 2 salivary protein ... 36 1.4
gi|29248186|gb|EAA39726.1| GLP_14_5908_12108 [Giardia lamblia AT... 35 1.9
gi|34501467|gb|AAK74120.3| mucin 16 [Homo sapiens] 35 1.9
gi|28573640|ref|NP_611888.2| CG13569-PA [Drosophila melanogaster... 35 1.9
gi|24419041|gb|AAL65133.2| ovarian cancer related tumor marker C... 35 1.9
gi|46439042|gb|EAK98364.1| hypothetical protein CaO19.470 [Candi... 35 1.9
gi|46439136|gb|EAK98457.1| hypothetical protein CaO19.8101 [Cand... 35 1.9
gi|19309414|emb|CAD27313.1| Possible pathogenesis-related protei... 35 2.4
gi|38103281|gb|EAA49996.1| hypothetical protein MG03755.4 [Magna... 35 2.4
gi|2853293|gb|AAC02268.1| intestinal mucin [Homo sapiens] 35 2.4
gi|1523780|emb|CAA68959.1| putative transposase [Ascobolus immer... 35 3.2
gi|29124855|gb|AAO63577.1| secreted protein 5 precursor [Ancylos... 35 3.2
gi|38344686|emb|CAD40250.2| OSJNBb0096E05.8 [Oryza sativa (japon... 35 3.2
gi|41406326|ref|NP_959162.1| EmbB [Mycobacterium avium subsp. pa... 35 3.2
gi|13625901|gb|AAK35195.1| activation associated secreted protei... 34 4.1
gi|18478862|gb|AAL73347.1| putative esophageal gland cell secret... 34 4.1
>gi|17553496|ref|NP_498166.1| glioma pathogenesis-related protein,
LONg body length LON-1 (35.1 kD) (lon-1) [Caenorhabditis
elegans]
gi|2500714|sp|Q09566|YR81_CAEEL Hypothetical protein F48E8.1 in
chromosome III
gi|7503756|pir||T16415 hypothetical protein F48E8.1 -
Caenorhabditis elegans
gi|746485|gb|AAC46538.1| Long protein 1, isoform a [Caenorhabditis
elegans]
Length = 312
Score = 554 bits (1428), Expect = e-157
Identities = 251/261 (96%), Positives = 251/261 (96%)
Frame = +1
Query: 1 MNYXXXXXXXXXXPISVAYNVPHGFLTGEAVTSHSGPNDLDGELPATDEVKREKRGYFFP 180
MNY PISVAYNVPHGFLTGEAVTSHSGPNDLDGELPATDEVKREKRGYFFP
Sbjct: 1 MNYLLTALIALLAPISVAYNVPHGFLTGEAVTSHSGPNDLDGELPATDEVKREKRGYFFP 60
Query: 181 SHFQSDSGLLSRSEHPNEYLKKWITHEHNRYRRMVPASDMNMLYWSDELAASAQRHADTC 360
SHFQSDSGLLSRSEHPNEYLKKWITHEHNRYRRMVPASDMNMLYWSDELAASAQRHADTC
Sbjct: 61 SHFQSDSGLLSRSEHPNEYLKKWITHEHNRYRRMVPASDMNMLYWSDELAASAQRHADTC 120
Query: 361 DFRHSRGRINVGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKT 540
DFRHSRGRINVGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKT
Sbjct: 121 DFRHSRGRINVGENIWAAPYSNYSDAISIWFNEVHNPRCGCNHAYKHCCGHYVQVVWAKT 180
Query: 541 NLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGNTVFVTARGQLYAMPAFTWASGDNGKC 720
NLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGNTVFVTARGQLYAMPAFTWASGDNGKC
Sbjct: 181 NLVGCGFSRCRDVQGVWGRGHRNVFVCHYNPQGNTVFVTARGQLYAMPAFTWASGDNGKC 240
Query: 721 SNCPANAPACYQGLCYMPKNY 783
SNCPANAPACYQGLCYMPKNY
Sbjct: 241 SNCPANAPACYQGLCYMPKNY 261