Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F45D3_6
(770 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17559188|ref|NP_506145.1| mitochondrial ribosomal protein S5 ... 521 e-147
gi|39592292|emb|CAE75513.1| Hypothetical protein CBG23528 [Caeno... 491 e-138
gi|31207991|ref|XP_312962.1| ENSANGP00000020335 [Anopheles gambi... 160 3e-38
gi|48095980|ref|XP_394577.1| similar to ENSANGP00000020335 [Apis... 158 1e-37
gi|17945949|gb|AAL49019.1| RE47909p [Drosophila melanogaster] >g... 156 4e-37
gi|30923599|gb|EAA46076.1| CG40049-PB.3 [Drosophila melanogaster] 156 4e-37
gi|34858674|ref|XP_215833.2| similar to mitochondrial ribosomal ... 138 1e-31
gi|17157985|ref|NP_084239.1| mitochondrial ribosomal protein S5 ... 137 3e-31
gi|13994259|ref|NP_114108.1| mitochondrial ribosomal protein S5;... 135 1e-30
gi|50756073|ref|XP_415003.1| PREDICTED: similar to mitochondrial... 135 1e-30
gi|34783041|gb|AAH00219.2| MRPS5 protein [Homo sapiens] 113 4e-24
gi|19114611|ref|NP_593699.1| probable ribosomal protein [Schizos... 69 8e-11
gi|47204440|emb|CAG00379.1| unnamed protein product [Tetraodon n... 69 1e-10
gi|49071758|ref|XP_400168.1| hypothetical protein UM02553.1 [Ust... 67 5e-10
gi|13507921|ref|NP_109870.1| ribosomal protein S5 [Mycoplasma pn... 63 8e-09
gi|46107532|ref|XP_380825.1| hypothetical protein FG00649.1 [Gib... 61 3e-08
gi|50416960|ref|XP_457596.1| unnamed protein product [Debaryomyc... 60 4e-08
gi|6319728|ref|NP_009810.1| Mitochondrial ribosomal protein of t... 60 4e-08
gi|49084106|ref|XP_404279.1| hypothetical protein AN0142.2 [Aspe... 60 5e-08
gi|32415519|ref|XP_328239.1| hypothetical protein [Neurospora cr... 59 1e-07
gi|50286431|ref|XP_445644.1| unnamed protein product [Candida gl... 59 1e-07
gi|45184850|ref|NP_982568.1| AAR027Wp [Eremothecium gossypii] >g... 58 3e-07
gi|48831563|ref|ZP_00288623.1| COG0098: Ribosomal protein S5 [Ma... 58 3e-07
gi|50549661|ref|XP_502301.1| hypothetical protein [Yarrowia lipo... 57 4e-07
gi|16554223|dbj|BAB71695.1| unnamed protein product [Homo sapiens] 57 4e-07
gi|23014071|ref|ZP_00053908.1| COG0098: Ribosomal protein S5 [Ma... 56 1e-06
gi|32423690|gb|AAP81233.1| ribosomal protein S5 [Candidatus Port... 56 1e-06
gi|24371846|ref|NP_715888.1| ribosomal protein S5 [Shewanella on... 55 1e-06
gi|46432514|gb|EAK91992.1| hypothetical protein CaO19.8604 [Cand... 55 1e-06
gi|12045021|ref|NP_072831.1| ribosomal protein S5 (rpS5) [Mycopl... 55 1e-06
gi|48849955|ref|ZP_00304198.1| COG0098: Ribosomal protein S5 [No... 55 2e-06
gi|27380494|ref|NP_772023.1| 30s ribosomal protein S5 [Bradyrhiz... 55 2e-06
gi|50304181|ref|XP_452040.1| unnamed protein product [Kluyveromy... 55 2e-06
gi|42520513|ref|NP_966428.1| ribosomal protein S5 [Wolbachia end... 55 2e-06
gi|38109469|gb|EAA55338.1| hypothetical protein MG06995.4 [Magna... 54 4e-06
gi|15612287|ref|NP_223940.1| 30S RIBOSOMAL PROTEIN S5 [Helicobac... 54 5e-06
gi|48765727|ref|ZP_00270277.1| COG0098: Ribosomal protein S5 [Rh... 53 6e-06
gi|39936296|ref|NP_948572.1| ribosomal protein S5 [Rhodopseudomo... 53 6e-06
gi|29348119|ref|NP_811622.1| 30S ribosomal protein S5 [Bacteroid... 53 6e-06
gi|41690678|ref|ZP_00147210.1| COG0098: Ribosomal protein S5 [Ps... 53 8e-06
gi|33519675|ref|NP_878507.1| 30S ribosomal subunit protein S5 [C... 53 8e-06
gi|34541524|ref|NP_906003.1| ribosomal protein S5 [Porphyromonas... 52 1e-05
gi|22995991|ref|ZP_00040268.1| COG0098: Ribosomal protein S5 [Xy... 52 1e-05
gi|15837771|ref|NP_298459.1| 30S ribosomal protein S5 [Xylella f... 52 1e-05
gi|15618541|ref|NP_224827.1| S5 Ribosomal Protein [Chlamydophila... 52 2e-05
gi|46143638|ref|ZP_00204534.1| COG0098: Ribosomal protein S5 [Ac... 52 2e-05
gi|15603263|ref|NP_246337.1| RpS5 [Pasteurella multocida Pm70] >... 52 2e-05
gi|31544272|ref|NP_852850.1| RpsE [Mycoplasma gallisepticum R] >... 51 2e-05
gi|32475075|ref|NP_868069.1| 30S ribosomal protein S5 [Pirellula... 51 2e-05
gi|2766520|gb|AAB95404.1| ribosomal protein S5 [Mycoplasma galli... 51 2e-05
gi|33860200|sp|O52349|RS5_MYCGA 30S ribosomal protein S5 51 2e-05
gi|16272736|ref|NP_438954.1| ribosomal protein S5 [Haemophilus i... 51 3e-05
gi|37528526|ref|NP_931871.1| 30S ribosomal protein S5 [Photorhab... 51 3e-05
gi|46308722|ref|ZP_00210914.1| COG0098: Ribosomal protein S5 [Eh... 51 3e-05
gi|21230381|ref|NP_636298.1| 30S ribosomal protein S5 [Xanthomon... 50 4e-05
gi|33152937|ref|NP_874290.1| 30S ribosomal protein S5 [Haemophil... 50 4e-05
gi|46911978|emb|CAG18776.1| putative ribosomal subunit protein S... 50 5e-05
gi|13357808|ref|NP_078082.1| ribosomal protein S5 [Ureaplasma pa... 50 5e-05
gi|23119468|ref|ZP_00102543.1| COG0098: Ribosomal protein S5 [De... 50 5e-05
gi|29027495|gb|AAO61966.1| rp S5 [Aster yellows phytoplasma] 50 5e-05
gi|39997932|ref|NP_953883.1| ribosomal protein S5 [Geobacter sul... 50 5e-05
gi|29839877|ref|NP_828983.1| ribosomal protein S5 [Chlamydophila... 50 7e-05
gi|38074485|ref|XP_357178.1| similar to mitochondrial ribosomal ... 50 7e-05
gi|15642574|ref|NP_232207.1| ribosomal protein S5 [Vibrio choler... 49 9e-05
gi|27364197|ref|NP_759725.1| Ribosomal protein S5 [Vibrio vulnif... 49 9e-05
gi|50122934|ref|YP_052101.1| 30S ribosomal subunit protein S5 [E... 49 9e-05
gi|15676086|ref|NP_273217.1| 30s ribosomal protein S5 [Neisseria... 49 9e-05
gi|45917155|ref|ZP_00196300.2| COG0098: Ribosomal protein S5 [Me... 49 1e-04
gi|16120564|ref|NP_403877.1| 30S ribosomal protein S5 [Yersinia ... 49 1e-04
gi|15803830|ref|NP_289864.1| 30S ribosomal subunit protein S5 [E... 49 1e-04
gi|28897048|ref|NP_796653.1| ribosomal protein S5 [Vibrio paraha... 49 1e-04
gi|33357882|pdb|1P6G|E Chain E, Real Space Refined Coordinates O... 49 1e-04
gi|48855304|ref|ZP_00309463.1| COG0098: Ribosomal protein S5 [Cy... 49 1e-04
gi|46446062|ref|YP_007427.1| probable 30S ribosomal protein S5 [... 49 2e-04
gi|17987057|ref|NP_539691.1| SSU ribosomal protein S5P [Brucella... 49 2e-04
gi|27904925|ref|NP_778051.1| 30S ribosomal protein S5 [Buchnera ... 48 2e-04
gi|29653607|ref|NP_819299.1| ribosomal protein S5 [Coxiella burn... 48 2e-04
gi|34558012|ref|NP_907827.1| 30S RIBOSOMAL PROTEIN S5 [Wolinella... 48 2e-04
gi|18408151|ref|NP_564842.1| ribosomal protein S5 family protein... 48 3e-04
gi|47459087|ref|YP_015949.1| 30S ribosomal protein s5 [Mycoplasm... 48 3e-04
gi|26554448|ref|NP_758382.1| ribosomal protein S5 [Mycoplasma pe... 48 3e-04
gi|14334894|gb|AAK59625.1| unknown protein [Arabidopsis thaliana] 48 3e-04
gi|15792993|ref|NP_282816.1| 30S ribosomal protein S5 [Campyloba... 48 3e-04
gi|23104456|ref|ZP_00090920.1| COG0098: Ribosomal protein S5 [Az... 48 3e-04
gi|32266894|ref|NP_860926.1| ribosomal protein S5 [Helicobacter ... 48 3e-04
gi|17935819|ref|NP_532609.1| 30s ribosomal protein S5 [Agrobacte... 47 3e-04
gi|15617101|ref|NP_240314.1| 30S ribosomal protein S5 [Buchnera ... 47 3e-04
gi|49475777|ref|YP_033818.1| 30S ribosomal protein s5 [Bartonell... 47 3e-04
gi|26987212|ref|NP_742637.1| ribosomal protein S5 [Pseudomonas p... 47 3e-04
gi|49474387|ref|YP_032429.1| 30s ribosomal protein s5 [Bartonell... 47 3e-04
gi|15829041|ref|NP_326401.1| 30S RIBOSOMAL PROTEIN S5 [Mycoplasm... 47 3e-04
gi|50086198|ref|YP_047708.1| 30S ribosomal protein S5 [Acinetoba... 47 4e-04
gi|15965126|ref|NP_385479.1| PROBABLE 30S RIBOSOMAL PROTEIN S5 [... 47 4e-04
gi|23470622|ref|ZP_00125954.1| COG0098: Ribosomal protein S5 [Ps... 47 4e-04
gi|48728886|ref|ZP_00262639.1| COG0098: Ribosomal protein S5 [Ps... 47 4e-04
gi|13470568|ref|NP_102137.1| unknown protein [Mesorhizobium loti... 47 4e-04
gi|31077162|sp|Q98N40|RS5_RHILO 30S ribosomal protein S5 47 4e-04
gi|50257474|gb|EAL20181.1| hypothetical protein CNBF2570 [Crypto... 47 6e-04
gi|42524360|ref|NP_969740.1| 30S ribosomal protein S5 [Bdellovib... 47 6e-04
gi|23468114|ref|ZP_00123675.1| COG0098: Ribosomal protein S5 [Ha... 46 8e-04
gi|46193619|ref|ZP_00004331.2| COG0098: Ribosomal protein S5 [Rh... 46 8e-04
gi|2780218|emb|CAA11205.1| ribosomal protein S5 [Salmonella typh... 46 0.001
gi|15599442|ref|NP_252936.1| 30S ribosomal protein S5 [Pseudomon... 46 0.001
gi|41723126|ref|ZP_00150069.1| COG0098: Ribosomal protein S5 [De... 45 0.001
gi|48860658|ref|ZP_00314569.1| COG0098: Ribosomal protein S5 [Mi... 45 0.002
gi|46579731|ref|YP_010539.1| ribosomal protein S5 [Desulfovibrio... 44 0.003
gi|21672753|ref|NP_660820.1| 30S ribosomal protein S5 [Buchnera ... 44 0.003
gi|15606749|ref|NP_214129.1| ribosomal protein S05 [Aquifex aeol... 44 0.004
gi|42454061|ref|ZP_00153968.1| hypothetical protein Rick094301 [... 44 0.004
gi|15644231|ref|NP_229283.1| ribosomal protein S5 [Thermotoga ma... 44 0.005
gi|41052902|dbj|BAD07814.1| putative ribosomal protein S5 [Oryza... 44 0.005
gi|34499624|ref|NP_903839.1| 30s ribosomal protein S5 [Chromobac... 44 0.005
gi|42561253|ref|NP_975704.1| 30S ribosomal protein S5 [Mycoplasm... 43 0.006
gi|30248435|ref|NP_840505.1| Ribosomal protein S5 [Nitrosomonas ... 43 0.006
gi|15827985|ref|NP_302248.1| 30S ribosomal protein S5 [Mycobacte... 43 0.006
gi|50876031|emb|CAG35871.1| probable 30S ribosomal protein S5 [D... 42 0.011
gi|7404453|sp|P46183|RS5_BUCAK 30S ribosomal protein S5 42 0.011
gi|14278534|pdb|1I94|E Chain E, Crystal Structures Of The Small ... 42 0.011
gi|34811533|pdb|1PNS|E Chain E, Crystal Structure Of A Streptomy... 42 0.011
gi|46199613|ref|YP_005280.1| SSU ribosomal protein S5P [Thermus ... 42 0.011
gi|632237|pir||JC2283 ribosomal protein S5 - pea aphid symbiont ... 42 0.011
gi|19704948|ref|NP_602443.1| SSU ribosomal protein S5P [Fusobact... 42 0.019
gi|49235642|ref|ZP_00329709.1| COG0098: Ribosomal protein S5 [Mo... 42 0.019
gi|25404502|pir||B96672 hypothetical protein F13O11.18 [imported... 42 0.019
gi|37523479|ref|NP_926856.1| 30S ribosomal protein S5 [Gloeobact... 41 0.025
gi|15668652|ref|NP_247451.1| SSU ribosomal protein S5P (rpsE) [M... 41 0.025
gi|22297641|ref|NP_680888.1| 30S ribosomal protein S5 [Thermosyn... 41 0.025
gi|41718243|ref|ZP_00147300.1| COG0098: Ribosomal protein S5 [Me... 41 0.025
gi|47574136|ref|ZP_00244172.1| COG0098: Ribosomal protein S5 [Ru... 41 0.025
gi|41410282|ref|NP_963118.1| RpsE [Mycobacterium avium subsp. pa... 41 0.032
gi|15607861|ref|NP_215235.1| rpsE [Mycobacterium tuberculosis H3... 41 0.032
gi|22973610|ref|ZP_00020191.1| hypothetical protein [Chloroflexu... 41 0.032
gi|15674304|ref|NP_268477.1| 30S ribosomal protein S5 [Streptoco... 40 0.042
gi|32491309|ref|NP_871563.1| rpsE [Wigglesworthia glossinidia en... 40 0.042
gi|48835038|ref|ZP_00292040.1| COG0098: Ribosomal protein S5 [Th... 40 0.042
gi|38233136|ref|NP_938903.1| 30S ribosomal protein S5 [Corynebac... 40 0.055
gi|15807107|ref|NP_295836.1| ribosomal protein S5 [Deinococcus r... 40 0.055
gi|22995906|ref|ZP_00040194.1| COG0098: Ribosomal protein S5 [Xy... 40 0.055
gi|20093469|ref|NP_613316.1| Ribosomal protein S5 [Methanopyrus ... 40 0.055
gi|25027108|ref|NP_737162.1| putative 30S ribosomal protein S5 [... 40 0.071
gi|29250613|gb|EAA42104.1| GLP_254_53263_52535 [Giardia lamblia ... 39 0.093
gi|39938703|ref|NP_950469.1| ribosomal protein S5 [Onion yellows... 39 0.093
gi|133971|sp|P10128|RS5_MYCCA 30S ribosomal protein S5 >gnl|BL_O... 39 0.093
gi|133969|sp|P26815|RS5_HALMA 30S ribosomal protein S5P (HmaS5) ... 39 0.093
gi|19551777|ref|NP_599779.1| ribosomal protein S5 [Corynebacteri... 39 0.093
gi|23112489|ref|ZP_00097965.1| COG0098: Ribosomal protein S5 [De... 39 0.12
gi|17547721|ref|NP_521123.1| PROBABLE 30S RIBOSOMAL SUBUNIT PROT... 39 0.12
gi|46319580|ref|ZP_00219983.1| COG0098: Ribosomal protein S5 [Bu... 39 0.12
gi|33594498|ref|NP_882142.1| 30S ribosomal protein S5 [Bordetell... 39 0.12
gi|21674981|ref|NP_663046.1| ribosomal protein S5 [Chlorobium te... 39 0.12
gi|46311183|ref|ZP_00211793.1| COG0098: Ribosomal protein S5 [Bu... 39 0.12
gi|15594840|ref|NP_212629.1| ribosomal protein S5 (rpsE) [Borrel... 39 0.16
gi|48838703|ref|ZP_00295643.1| COG0098: Ribosomal protein S5 [Me... 39 0.16
gi|48767831|ref|ZP_00272184.1| COG0098: Ribosomal protein S5 [Ra... 39 0.16
gi|48781564|ref|ZP_00278155.1| COG0098: Ribosomal protein S5 [Bu... 39 0.16
gi|50843301|ref|YP_056528.1| 30S ribosomal protein S5 [Propionib... 39 0.16
gi|20089962|ref|NP_616037.1| ribosomal protein S5 [Methanosarcin... 38 0.21
gi|21228246|ref|NP_634168.1| SSU ribosomal protein S5P [Methanos... 38 0.21
gi|15896366|ref|NP_349715.1| Ribosomal protein S5 [Clostridium a... 38 0.21
gi|1076080|pir||S50003 ribosomal protein S5 - Streptomyces coeli... 38 0.21
gi|33772507|gb|AAQ54655.1| 40S ribosomal protein S2 [Oikopleura ... 38 0.21
gi|2924290|emb|CAA58136.1| S5 ribosomal protein [Streptomyces co... 38 0.21
gi|28493505|ref|NP_787666.1| 30S ribosomal protein S5 [Tropherym... 38 0.21
gi|28572383|ref|NP_789163.1| 30s ribosomal protein S5 [Tropherym... 38 0.21
gi|23466147|ref|NP_696750.1| ribosomal protein S5 [Bifidobacteri... 38 0.27
gi|15639199|ref|NP_218645.1| ribosomal protein S5 (rpsE) [Trepon... 38 0.27
gi|24380352|ref|NP_722307.1| 30S ribosomal protein S5 [Streptoco... 37 0.35
gi|23097591|ref|NP_691057.1| 30S ribosomal protein S5 [Oceanobac... 37 0.35
gi|19705360|ref|NP_602855.1| Cobyric acid synthase [Fusobacteriu... 37 0.35
gi|46364475|ref|ZP_00227090.1| COG0098: Ribosomal protein S5 [Ki... 37 0.35
gi|50590421|ref|ZP_00331804.1| COG0098: Ribosomal protein S5 [St... 37 0.46
gi|15900163|ref|NP_344767.1| ribosomal protein S5 [Streptococcus... 37 0.46
gi|23024311|ref|ZP_00063527.1| COG0098: Ribosomal protein S5 [Le... 37 0.60
gi|21223099|ref|NP_628878.1| 30S ribosomal protein S5 [Streptomy... 37 0.60
gi|45525097|ref|ZP_00176345.1| COG0098: Ribosomal protein S5 [Cr... 37 0.60
gi|46130375|ref|ZP_00164082.2| COG0098: Ribosomal protein S5 [Sy... 36 0.79
gi|29831486|ref|NP_826120.1| putative ribosomal protein S5 [Stre... 36 0.79
gi|3122822|sp|O24705|RS5_SYNP6 30S ribosomal protein S5 >gnl|BL_... 36 0.79
gi|11362585|pir||T44831 probable emulsan repeating unit flippase... 36 0.79
gi|42526296|ref|NP_971394.1| ribosomal protein S5 [Treponema den... 36 0.79
gi|22536260|ref|NP_687111.1| ribosomal protein S5 [Streptococcus... 36 1.0
gi|50426483|ref|XP_461838.1| unnamed protein product [Debaryomyc... 36 1.0
gi|48857563|ref|ZP_00311557.1| COG0098: Ribosomal protein S5 [Cl... 36 1.0
gi|45531576|ref|ZP_00182616.1| COG0098: Ribosomal protein S5 [Ex... 36 1.0
gi|16329925|ref|NP_440653.1| 30S ribosomal protein S5 [Synechocy... 36 1.0
gi|50553066|ref|XP_503943.1| hypothetical protein [Yarrowia lipo... 35 1.8
gi|18311370|ref|NP_563304.1| 30S ribosomal protein S5 [Clostridi... 35 2.3
gi|15920622|ref|NP_376291.1| 214aa long hypothetical 30S ribosom... 35 2.3
gi|11499489|ref|NP_070730.1| SSU ribosomal protein S5P (rps5P) [... 35 2.3
gi|27468724|ref|NP_765361.1| 30S ribosomal protein S5 [Staphyloc... 35 2.3
gi|23124112|ref|ZP_00106123.1| COG0098: Ribosomal protein S5 [No... 35 2.3
gi|17231691|ref|NP_488239.1| 30S ribosomal protein S5 [Nostoc sp... 35 2.3
gi|15609452|ref|NP_216831.1| hypothetical protein Rv2315c [Mycob... 30 2.8
gi|38488727|ref|NP_057709.2| BM-011 protein [Homo sapiens] >gnl|... 34 3.0
gi|11465438|ref|NP_045171.1| ribosomal protein S5 [Cyanidium cal... 34 3.0
gi|30018397|ref|NP_830028.1| SSU ribosomal protein S5P [Bacillus... 34 3.0
gi|21398085|ref|NP_654070.1| Ribosomal_S5, Ribosomal protein S5 ... 34 3.0
gi|133970|sp|P14036|RS5_METVA 30S ribosomal protein S5P >gnl|BL_... 34 3.9
gi|15925223|ref|NP_372757.1| 30S ribosomal protein S5 [Staphyloc... 34 3.9
gi|15612714|ref|NP_241017.1| 30S ribosomal protein S5; ribosomal... 34 3.9
gi|49258825|pdb|1S1H|E Chain E, Structure Of The Ribosomal 80s-E... 33 5.1
gi|6321315|ref|NP_011392.1| Protein component of the small (40S)... 33 5.1
gi|45358982|ref|NP_988539.1| SSU ribosomal protein S5P [Methanoc... 33 5.1
gi|26327683|dbj|BAC27585.1| unnamed protein product [Mus musculus] 33 5.1
gi|31745185|ref|NP_084225.1| small nuclear RNA activating comple... 33 5.1
gi|34869019|ref|XP_342856.1| similar to small nuclear RNA activa... 33 5.1
gi|50657681|gb|AAT79666.1| 30S ribosomal protein S5 [Gracilaria ... 33 5.1
gi|50287693|ref|XP_446276.1| unnamed protein product [Candida gl... 33 5.1
gi|48864639|ref|ZP_00318525.1| COG0098: Ribosomal protein S5 [Oe... 33 6.7
gi|48824739|ref|ZP_00286078.1| COG0098: Ribosomal protein S5 [En... 33 6.7
gi|23491215|gb|EAA22806.1| hypothetical protein [Plasmodium yoel... 33 6.7
gi|2127291|pir||I40588 transposase (Tn5401) - Bacillus thuringie... 33 8.7
gi|11467454|ref|NP_043600.1| ribosomal protein S5 [Odontella sin... 33 8.7
gi|50311007|ref|XP_455527.1| unnamed protein product [Kluyveromy... 33 8.7
gi|33864015|ref|NP_895575.1| 30S ribosomal protein S5 [Prochloro... 33 8.7
gi|143575|gb|AAB59115.1| spc ORF1; S5 33 8.7
gi|15674063|ref|NP_268238.1| 30S ribosomal protein S5 [Lactococc... 33 8.7
gi|50259616|gb|EAL22287.1| hypothetical protein CNBC0010 [Crypto... 33 8.7
gi|46123515|ref|XP_386311.1| hypothetical protein FG06135.1 [Gib... 33 8.7
>gi|17559188|ref|NP_506145.1| mitochondrial ribosomal protein S5
(5N45) [Caenorhabditis elegans]
gi|2842724|sp|Q93425|RT05_CAEEL Putative mitochondrial 40S
ribosomal protein S5
gi|7498290|pir||T20412 hypothetical protein E02A10.1 -
Caenorhabditis elegans
gi|3875443|emb|CAB02879.1| Hypothetical protein E02A10.1
[Caenorhabditis elegans]
gi|3877100|emb|CAB01506.1| Hypothetical protein E02A10.1
[Caenorhabditis elegans]
Length = 418
Score = 521 bits (1341), Expect = e-147
Identities = 256/256 (100%), Positives = 256/256 (100%)
Frame = +1
Query: 1 MRRSGPELWKTLTSVSKSGQKKGRRNTRQPVRPLNRFYRIGSSPMKIEFAGLNAPIRMRE 180
MRRSGPELWKTLTSVSKSGQKKGRRNTRQPVRPLNRFYRIGSSPMKIEFAGLNAPIRMRE
Sbjct: 1 MRRSGPELWKTLTSVSKSGQKKGRRNTRQPVRPLNRFYRIGSSPMKIEFAGLNAPIRMRE 60
Query: 181 TENQNLMSIAEQTEDEIRDSMGGTKKILEERDTGKKKRNREKLHPMERGFSGTQLVGQKL 360
TENQNLMSIAEQTEDEIRDSMGGTKKILEERDTGKKKRNREKLHPMERGFSGTQLVGQKL
Sbjct: 61 TENQNLMSIAEQTEDEIRDSMGGTKKILEERDTGKKKRNREKLHPMERGFSGTQLVGQKL 120
Query: 361 GAPPPLDGVNFDDFETYCLEVKRTSNMTNVFGRVHTMSALVVTGNGRGLAGYAVGKAPIH 540
GAPPPLDGVNFDDFETYCLEVKRTSNMTNVFGRVHTMSALVVTGNGRGLAGYAVGKAPIH
Sbjct: 121 GAPPPLDGVNFDDFETYCLEVKRTSNMTNVFGRVHTMSALVVTGNGRGLAGYAVGKAPIH 180
Query: 541 RTTTAIINGMGMASRKLFHVELHEGRTIYQDFYAECRNTRVFAQRRPRGFGLTCHPRLIK 720
RTTTAIINGMGMASRKLFHVELHEGRTIYQDFYAECRNTRVFAQRRPRGFGLTCHPRLIK
Sbjct: 181 RTTTAIINGMGMASRKLFHVELHEGRTIYQDFYAECRNTRVFAQRRPRGFGLTCHPRLIK 240
Query: 721 ICEAIGIKDIYVKVEG 768
ICEAIGIKDIYVKVEG
Sbjct: 241 ICEAIGIKDIYVKVEG 256