Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F44C4_3
(1008 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17559068|ref|NP_504682.1| cysteine PRotease related (36.5 kD)... 671 0.0
gi|39594338|emb|CAE71916.1| Hypothetical protein CBG18978 [Caeno... 634 e-180
gi|17565164|ref|NP_503383.1| cysteine PRotease related, cathepsi... 451 e-125
gi|39588506|emb|CAE58029.1| Hypothetical protein CBG01103 [Caeno... 447 e-124
gi|39588507|emb|CAE58030.1| Hypothetical protein CBG01104 [Caeno... 413 e-114
gi|17565162|ref|NP_503382.1| cathepsin B precursor family member... 403 e-111
gi|39592147|emb|CAE75367.1| Hypothetical protein CBG23351 [Caeno... 355 9e-97
gi|17561570|ref|NP_506011.1| cathepsin B family member (5M483) [... 351 2e-95
gi|32566081|ref|NP_506002.2| cysteine PRotease related (35.4 kD)... 343 3e-93
gi|7497829|pir||T20148 probable cysteine proteinase (EC 3.4.22.-... 343 3e-93
gi|14582897|gb|AAK69705.1| procathepsin B [Oncorhynchus mykiss] 337 2e-91
gi|31872149|gb|AAP59456.1| cathepsin B precursor [Araneus ventri... 336 4e-91
gi|39592139|emb|CAE75359.1| Hypothetical protein CBG23343 [Caeno... 333 4e-90
gi|1777779|gb|AAB40605.1| cathepsin B-like cysteine proteinase 329 5e-89
gi|31209737|ref|XP_313835.1| ENSANGP00000003981 [Anopheles gambi... 325 1e-87
gi|50745158|ref|XP_429301.1| PREDICTED: hypothetical protein XP_... 321 2e-86
gi|25146613|ref|NP_741818.1| cysteine PRotease related (42.4 kD)... 320 2e-86
gi|21392648|gb|AAM51519.1| Cysteine protease related protein 6, ... 320 2e-86
gi|39586718|emb|CAE65760.1| Hypothetical protein CBG10849 [Caeno... 320 3e-86
gi|28302291|gb|AAH46667.1| Cg10992-prov protein [Xenopus laevis] 318 9e-86
gi|37788265|gb|AAO64472.1| cathepsin B precursor [Fundulus heter... 318 9e-86
gi|34979797|gb|AAQ83887.1| cathepsin B [Branchiostoma belcheri t... 317 3e-85
gi|28277314|gb|AAH44689.1| MGC53360 protein [Xenopus laevis] 315 8e-85
gi|45361295|ref|NP_989225.1| hypothetical protein MGC75969 [Xeno... 315 8e-85
gi|1168789|sp|P07688|CATB_BOVIN Cathepsin B precursor 315 1e-84
gi|41055001|ref|NP_957349.1| similar to cathepsin B [Danio rerio... 314 2e-84
gi|984958|gb|AAC46877.1| cathepsin B-like proteinase 314 2e-84
gi|27806671|ref|NP_776456.1| cathepsin B [Bos taurus] >gnl|BL_OR... 313 3e-84
gi|17565158|ref|NP_503384.1| cathepsin precursor family member (... 313 3e-84
gi|50540542|ref|NP_998501.1| cathepsin B [Danio rerio] >gnl|BL_O... 313 4e-84
gi|14141821|gb|AAK07477.2| probable cathepsin B-like cysteine pr... 313 4e-84
gi|115711|sp|P07858|CATB_HUMAN Cathepsin B precursor (Cathepsin ... 313 5e-84
gi|6681079|ref|NP_031824.1| cathepsin B preproprotein [Mus muscu... 313 5e-84
gi|12018262|ref|NP_072119.1| cathepsin B preproprotein [Rattus n... 313 5e-84
gi|1181143|emb|CAA93278.1| cysteine proteinase [Haemonchus conto... 313 5e-84
gi|45822203|emb|CAE47498.1| cathepsin B-like proteinase [Diabrot... 312 7e-84
gi|4503139|ref|NP_001899.1| cathepsin B preproprotein; APP secre... 312 7e-84
gi|2982114|pdb|1PBH| Crystal Structure Of Human Recombinant Pro... 312 7e-84
gi|34874087|ref|XP_346478.1| hypothetical protein XP_346477 [Rat... 312 9e-84
gi|16307393|gb|AAH10240.1| Cathepsin B, preproprotein [Homo sapi... 312 9e-84
gi|39581137|emb|CAE70994.1| Hypothetical protein CBG17826 [Caeno... 312 9e-84
gi|30583753|gb|AAP36125.1| Homo sapiens cathepsin B [synthetic c... 312 9e-84
gi|25988674|gb|AAN76202.1| lysosomal cysteine proteinase catheps... 312 9e-84
gi|481614|pir||S38939 probable cathepsin B-like cysteine protein... 311 2e-83
gi|309202|gb|AAA37494.1| mouse preprocathepsin B 310 3e-83
gi|227293|prf||1701299A cathepsin B 309 7e-83
gi|39579201|emb|CAE56994.1| Hypothetical protein CBG24861 [Caeno... 309 7e-83
gi|46195455|ref|NP_990702.1| cathepsin B [Gallus gallus] >gnl|BL... 309 7e-83
gi|2134308|pir||S58770 cathepsin B (EC 3.4.22.1) precursor - chi... 309 7e-83
gi|39584563|emb|CAE74641.1| Hypothetical protein CBG22436 [Caeno... 308 1e-82
gi|39592833|emb|CAE62447.1| Hypothetical protein CBG06539 [Caeno... 308 2e-82
gi|47217183|emb|CAG11019.1| unnamed protein product [Tetraodon n... 306 4e-82
gi|1942645|pdb|1MIR|A Chain A, Rat Procathepsin B >gnl|BL_ORD_ID... 306 5e-82
gi|50657025|emb|CAH04630.1| cathepsin B [Suberites domuncula] 304 2e-81
gi|28373366|pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bo... 304 2e-81
gi|9955277|pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine... 304 2e-81
gi|203648|gb|AAA40993.1| cathepsin (EC 3.4.22.1) 303 4e-81
gi|24158605|pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipep... 303 4e-81
gi|39594884|emb|CAE70752.1| Hypothetical protein CBG17499 [Caeno... 302 9e-81
gi|29374025|gb|AAO73003.1| cathepsin B [Fasciola gigantica] 301 2e-80
gi|1311050|pdb|1CPJ|A Chain A, Thiol Protease Mol_id: 1; Molecul... 301 2e-80
gi|17560488|ref|NP_506310.1| cathepsin precursor family member (... 301 2e-80
gi|1127275|pdb|1CTE|A Chain A, Molecule: Cathepsin B; Ec: 3.4.22... 300 3e-80
gi|3087801|emb|CAA93277.1| cysteine proteinase [Haemonchus conto... 299 8e-80
gi|39582887|emb|CAE71663.1| Hypothetical protein CBG18635 [Caeno... 298 2e-79
gi|18921171|ref|NP_572920.1| CG10992-PA [Drosophila melanogaster... 298 2e-79
gi|17559066|ref|NP_506790.1| cysteine PRotease related, cathepsi... 295 1e-78
gi|29374027|gb|AAO73004.1| cathepsin B [Fasciola gigantica] 294 2e-78
gi|7537454|gb|AAF35867.2| cathepsin B-like cysteine proteinase [... 294 2e-78
gi|21930117|gb|AAM82155.1| cysteine proteinase [Ancylostoma ceyl... 293 6e-78
gi|22531387|emb|CAD44624.1| cathepsin B1 isotype 1 [Schistosoma ... 292 7e-78
gi|45822211|emb|CAE47502.1| cathepsin B-like proteinase [Diabrot... 291 1e-77
gi|4325188|gb|AAD17297.1| cysteine proteinase [Ancylostoma ceyla... 291 2e-77
gi|118153|sp|P25792|CYSP_SCHMA Cathepsin B-like cysteine protein... 290 3e-77
gi|22531389|emb|CAD44625.1| cathepsin B1 isotype 2 [Schistosoma ... 288 1e-76
gi|1169189|sp|P43157|CYSP_SCHJA Cathepsin B-like cysteine protei... 287 3e-76
gi|984960|gb|AAC46878.1| cathepsin B proteinase 287 3e-76
gi|18181863|emb|CAC85211.2| cathepsin B endopeptidase [Schistoso... 286 4e-76
gi|30995341|gb|AAO59414.2| cathepsin B endopeptidase [Schistosom... 286 4e-76
gi|27526823|emb|CAD32937.1| pro-cathepsin B2 [Fasciola hepatica] 286 5e-76
gi|25153428|ref|NP_507186.2| predicted CDS, cathepsin B family m... 285 9e-76
gi|477253|pir||A48454 cathepsin B-like cysteine proteinase (EC 3... 285 2e-75
gi|13548667|dbj|BAB40804.1| cathepsin B [Bombyx mori] 284 3e-75
gi|7500618|pir||T21856 probable cysteine proteinase (EC 3.4.22.-... 282 1e-74
gi|4204370|gb|AAD11445.1| cathepsin B protease [Fasciola hepatica] 281 2e-74
gi|345308|pir||S31909 cathepsin B-like cysteine proteinase (EC 3... 280 4e-74
gi|3912916|gb|AAC78691.1| thiol protease [Trichuris suis] 279 6e-74
gi|29374023|gb|AAO73002.1| cathepsin B [Fasciola gigantica] 278 1e-73
gi|2944340|gb|AAC05262.1| cathepsin B-like cysteine protease GCP... 278 2e-73
gi|1345924|sp|P25802|CYS1_OSTOS Cathepsin B-like cysteine protei... 278 2e-73
gi|5764077|emb|CAB53367.1| necpain [Necator americanus] 276 7e-73
gi|478099|pir||D48435 cysteine proteinase AC-3 - nematode (Haemo... 274 2e-72
gi|39588505|emb|CAE58028.1| Hypothetical protein CBG01102 [Caeno... 273 5e-72
gi|39582397|emb|CAE74781.1| Hypothetical protein CBG22612 [Caeno... 270 3e-71
gi|7507648|pir||T24819 hypothetical protein T10H4.12 - Caenorhab... 270 4e-71
gi|118118|sp|P19092|CYS1_HAECO Cathepsin B-like cysteine protein... 268 1e-70
gi|39582904|emb|CAE71680.1| Hypothetical protein CBG18654 [Caeno... 268 1e-70
gi|118122|sp|P25793|CYS2_HAECO Cathepsin B-like cysteine protein... 266 7e-70
gi|38373697|gb|AAR19103.1| cathepsin B [Uronema marinum] 264 2e-69
gi|14582576|gb|AAK69541.1| cathepsin B-like cysteine proteinase ... 259 5e-68
gi|18378947|ref|NP_563648.1| cathepsin B-like cysteine protease,... 259 9e-68
gi|6165885|gb|AAF04727.1| cathepsin B-like cysteine proteinase [... 258 2e-67
gi|48762476|dbj|BAD23809.1| cathepsin B-S [Tuberaphis styraci] 258 2e-67
gi|39592835|emb|CAE62449.1| Hypothetical protein CBG06541 [Caeno... 257 3e-67
gi|38639325|gb|AAR25800.1| cathepsin B-like cysteine proteinase ... 257 3e-67
gi|48762493|dbj|BAD23816.1| cathepsin B-N [Tuberaphis coreana] 256 6e-67
gi|478007|pir||C48435 cysteine proteinase AC-4 - nematode (Haemo... 255 1e-66
gi|48762485|dbj|BAD23812.1| cathepsin B-N [Tuberaphis styraci] 255 1e-66
gi|19526442|gb|AAL89717.1| cathepsin B [Apriona germari] 254 2e-66
gi|39582907|emb|CAE71683.1| Hypothetical protein CBG18657 [Caeno... 254 2e-66
gi|22535408|emb|CAC87118.1| cathepsin B-like protease [Nilaparva... 253 4e-66
gi|44965401|gb|AAS49537.1| cathepsin B [Latimeria chalumnae] 253 5e-66
gi|28971815|dbj|BAC65419.1| cathepsin B [Pandalus borealis] 253 6e-66
gi|3087803|emb|CAA93279.1| cysteine protease [Haemonchus contortus] 252 1e-65
gi|31209739|ref|XP_313836.1| ENSANGP00000012227 [Anopheles gambi... 252 1e-65
gi|18411686|ref|NP_567215.1| cathepsin B-like cysteine protease,... 251 2e-65
gi|5031250|gb|AAD38132.1| vitellogenic cathepsin-B like protease... 251 2e-65
gi|48762491|dbj|BAD23815.1| cathepsin B-S [Tuberaphis coreana] 250 4e-65
gi|7435783|pir||T06413 cathepsin B-like cysteine proteinase (EC ... 248 2e-64
gi|31209729|ref|XP_313831.1| ENSANGP00000012222 [Anopheles gambi... 247 3e-64
gi|3087799|emb|CAA93276.1| cysteine proteinase [Haemonchus conto... 246 5e-64
gi|477808|pir||B48435 cysteine proteinase AC-5 - nematode (Haemo... 246 5e-64
gi|40643250|emb|CAC83720.1| cathepsin B [Hordeum vulgare subsp. ... 246 8e-64
gi|609175|emb|CAA57522.1| cathepsin B-like cysteine proteinase [... 246 8e-64
gi|30678927|ref|NP_849281.1| cathepsin B-like cysteine protease,... 246 8e-64
gi|12005276|gb|AAG44365.1| cathepsin B-like cysteine protease [L... 246 8e-64
gi|17384033|emb|CAD12394.1| cysteine proteinase [Leishmania infa... 246 8e-64
gi|2129942|pir||S60479 cathepsin B-like cysteine proteinase (EC ... 245 1e-63
gi|1644295|emb|CAB03627.1| cysteine proteinase [Haemonchus conto... 244 2e-63
gi|999909|pdb|1HUC|B Chain B, Cathepsin B (E.C.3.4.22.1) >gnl|BL... 244 3e-63
gi|181178|gb|AAA52125.1| lysosomal proteinase cathepsin B 243 5e-63
gi|12004577|gb|AAG44098.1| cathepsin B cysteine protease [Leishm... 243 5e-63
gi|1848229|gb|AAB48119.1| cathepsin B-like protease [Leishmania ... 243 5e-63
gi|1008858|gb|AAA79004.1| cathepsin B-like thiol protease 243 7e-63
gi|44965462|gb|AAS49538.1| cathepsin B [Protopterus dolloi] 242 9e-63
gi|10803437|emb|CAC13131.1| putative cathepsin B.5 [Ostertagia o... 242 9e-63
gi|728602|emb|CAA88490.1| cathepsin B-like enzyme [Leishmania me... 242 1e-62
gi|48425700|pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In C... 242 1e-62
gi|28932700|gb|AAO60044.1| midgut cysteine proteinase 1 [Rhipice... 241 1e-62
gi|2317912|gb|AAC24376.1| cathepsin B-like cysteine proteinase [... 241 1e-62
gi|3087797|emb|CAA93275.1| cysteine proteinase [Haemonchus conto... 241 3e-62
gi|7435782|pir||T06466 cathepsin B-like cysteine proteinase (EC ... 234 2e-60
gi|18378945|ref|NP_563647.1| cathepsin B-like cysteine protease,... 234 3e-60
gi|3088522|gb|AAD03404.1| cathepsin B-like protease precursor [T... 234 3e-60
gi|40557577|gb|AAR88085.1| cathepsin B-like cysteine protease [T... 228 2e-58
gi|44968648|gb|AAS49594.1| cathepsin B [Scyliorhinus canicula] 226 5e-58
gi|3929733|emb|CAA77178.1| cathepsin B [Homo sapiens] 223 7e-57
gi|3929817|emb|CAA77181.1| cathepsin B [Mus musculus] 218 2e-55
gi|10803452|emb|CAB97365.2| putative cathepsin B.2 [Ostertagia o... 217 4e-55
gi|10803454|emb|CAB97366.2| putative cathepsin B.3 [Ostertagia o... 213 4e-54
gi|29840882|gb|AAP05883.1| similar to GenBank Accession Number X... 211 2e-53
gi|21700775|gb|AAL60053.1| cysteine proteinase [Toxoplasma gondii] 206 9e-52
gi|38074689|ref|XP_140905.2| similar to Cathepsin B precursor (C... 203 4e-51
gi|10803441|emb|CAC13133.1| putative cathepsin B.7 [Ostertagia o... 200 4e-50
gi|21695|emb|CAA46812.1| cathepsin B [Triticum aestivum] 199 6e-50
gi|10803443|emb|CAC13134.1| putative cathepsin B.8 [Ostertagia o... 199 8e-50
gi|10803450|emb|CAB97364.2| putative cathepsin B.1 [Ostertagia o... 199 8e-50
gi|15150360|gb|AAK85411.1| cathepsin B-like protease [Trypanosom... 198 1e-49
gi|508264|gb|AAA96833.1| cysteine protease 198 2e-49
gi|28974200|gb|AAO61484.1| cathepsin B [Sterkiella histriomuscorum] 197 3e-49
gi|603044|gb|AAA96832.1| cysteine protease homolog 196 9e-49
gi|10803439|emb|CAC13132.1| putative cathepsin B.6 [Ostertagia o... 195 2e-48
gi|15723276|gb|AAL06326.1| cathepsin B-like protease [Trypanosom... 194 4e-48
gi|15723280|gb|AAL06328.1| cathepsin B-like protease [Trypanosom... 193 6e-48
gi|15723272|gb|AAL06324.1| cathepsin B-like protease [Trypanosom... 192 1e-47
gi|15723274|gb|AAL06325.1| cathepsin B-like protease [Trypanosom... 191 2e-47
gi|10803435|emb|CAC13130.1| putative cathepsin B.4 [Ostertagia o... 187 3e-46
gi|729283|sp|Q06544|CYS3_OSTOS Cathepsin B-like cysteine protein... 187 4e-46
gi|17510377|ref|NP_490763.1| cathepsin B family member (48.2 kD)... 180 5e-44
gi|32129435|sp|P92133|CAL3_GIALA Cathepsin B-like CP3 precursor ... 178 2e-43
gi|741376|prf||2007265A cathepsin B 177 4e-43
gi|12330246|gb|AAG52660.1| cysteine proteinase [Metagonimus yoko... 174 2e-42
gi|29245813|gb|EAA37433.1| GLP_442_4888_3992 [Giardia lamblia AT... 174 2e-42
gi|6562772|emb|CAB62590.1| putative cathepsin B-like protease [P... 174 2e-42
gi|13469701|gb|AAK27318.1| cysteine proteinase [Clonorchis sinen... 174 4e-42
gi|4099305|gb|AAD00577.1| cysteine proteinase [Clonorchis sinensis] 172 1e-41
gi|29249541|gb|EAA41050.1| GLP_447_16146_15244 [Giardia lamblia ... 169 7e-41
gi|39585894|emb|CAE61308.1| Hypothetical protein CBG05143 [Caeno... 169 9e-41
gi|496968|gb|AAA96831.1| cysteine protease homologue 169 9e-41
gi|12330244|gb|AAG52659.1| cysteine proteinase [Metagonimus yoko... 167 3e-40
gi|32129434|sp|P92132|CAL2_GIALA Cathepsin B-like CP2 precursor ... 167 3e-40
gi|12658201|gb|AAK01061.1| cysteine proteinase [Metagonimus yoko... 165 2e-39
gi|39595196|emb|CAE60233.1| Hypothetical protein CBG03805 [Caeno... 164 3e-39
gi|162813|gb|AAA30434.1| cathepsin B 164 3e-39
gi|17506871|ref|NP_492593.1| tubulointerstitial nephritis antige... 164 4e-39
gi|39581138|emb|CAE70995.1| Hypothetical protein CBG17827 [Caeno... 160 3e-38
gi|29245436|gb|EAA37074.1| GLP_113_4299_5381 [Giardia lamblia AT... 160 4e-38
gi|552159|gb|AAA29434.1| cathepsin B-like cysteine protease 158 2e-37
gi|552158|gb|AAA29433.1| cathepsin B-like cysteine protease 158 2e-37
gi|2330009|gb|AAB66719.1| cysteine protease [Giardia muris] 154 2e-36
gi|39581140|emb|CAE70997.1| Hypothetical protein CBG17829 [Caeno... 154 2e-36
gi|29248841|gb|EAA40365.1| GLP_567_6496_7413 [Giardia lamblia AT... 154 3e-36
gi|48762481|dbj|BAD23810.1| cathepsin B-S [Tuberaphis taiwana] 154 4e-36
gi|16768502|gb|AAL28470.1| GM06507p [Drosophila melanogaster] 154 4e-36
gi|24657813|ref|NP_726176.1| CG3074-PA [Drosophila melanogaster]... 154 4e-36
gi|32129433|sp|P92131|CAL1_GIALA Cathepsin B-like CP1 precursor ... 152 1e-35
gi|1584943|prf||2123443A cathepsin C 150 3e-35
gi|2499875|sp|Q26563|CATC_SCHMA Cathepsin C precursor >gnl|BL_OR... 150 3e-35
gi|29248531|gb|EAA40062.1| GLP_162_1114_2025 [Giardia lamblia AT... 150 3e-35
gi|11691656|emb|CAC18646.1| cathepsin B-like protease 1 [Giardia... 150 3e-35
gi|312266|emb|CAA51531.1| cathepsin B-like enzyme [Gallus gallus] 150 6e-35
gi|50744850|ref|XP_419905.1| PREDICTED: similar to tubulointerst... 149 1e-34
gi|47212965|emb|CAF93376.1| unnamed protein product [Tetraodon n... 149 1e-34
gi|4929827|gb|AAD34171.1| tubulo-interstitial nephritis antigen ... 147 5e-34
gi|31981314|ref|NP_036163.2| tubulointerstitial nephritis antige... 147 5e-34
gi|47271446|ref|NP_055279.2| tubulointerstitial nephritis antige... 147 5e-34
gi|11360328|pir||JC7189 tubulointerstitial nephritis antigen - h... 147 5e-34
gi|45708820|gb|AAH67941.1| LOC407938 protein [Xenopus tropicalis] 146 6e-34
gi|1582221|prf||2118248A prepro-cathepsin C 145 1e-33
gi|17933069|gb|AAL48191.1| cathepsin C [Homo sapiens] 145 1e-33
gi|4503141|ref|NP_001805.1| cathepsin C isoform a preproprotein;... 145 1e-33
gi|22653678|sp|O97578|CATC_CANFA Dipeptidyl-peptidase I precurso... 145 1e-33
gi|33327024|gb|AAQ08887.1| cathepsin C [Homo sapiens] 145 1e-33
gi|17933071|gb|AAL48192.1| cathepsin C [Homo sapiens] 145 2e-33
gi|1763659|gb|AAB58258.1| cysteine protease [Giardia intestinalis] 144 3e-33
gi|34864376|ref|XP_236424.2| similar to tubulo-interstitial neph... 143 5e-33
gi|34098755|sp|Q9UJW2|TNAG_HUMAN Tubulointerstitial nephritis an... 143 5e-33
gi|29248113|gb|EAA39655.1| GLP_217_11853_10927 [Giardia lamblia ... 143 7e-33
gi|13543125|gb|AAH05738.1| Lcn7 protein [Mus musculus] >gnl|BL_O... 142 9e-33
gi|12963691|ref|NP_075965.1| lipocalin 7; androgen-regulated gen... 142 9e-33
gi|33417162|gb|AAH56109.1| Ctsc-prov protein [Xenopus laevis] 142 1e-32
gi|39592834|emb|CAE62448.1| Hypothetical protein CBG06540 [Caeno... 142 1e-32
gi|17933077|gb|AAL48195.1| cathepsin C [Homo sapiens] 141 2e-32
gi|1363085|pir||A57480 tubulointerstitial nephritis antigen prec... 141 2e-32
gi|29246290|gb|EAA37893.1| GLP_449_32565_31567 [Giardia lamblia ... 141 3e-32
gi|30038325|dbj|BAC75711.1| cathepsin C [Bos taurus] 140 5e-32
gi|11545918|ref|NP_071447.1| P3ECSL; glucocorticoid-inducible pr... 139 1e-31
gi|3023454|sp|P97821|CATC_MOUSE Dipeptidyl-peptidase I precursor... 138 2e-31
gi|31560607|ref|NP_034112.2| cathepsin C preproprotein; dipeptid... 138 2e-31
gi|50731191|ref|XP_417207.1| PREDICTED: similar to Dipeptidyl-pe... 137 5e-31
gi|16758354|ref|NP_446034.1| lipocalin 7; glucocorticoid-inducib... 136 7e-31
gi|2599293|gb|AAC32040.1| preprocathepsin C [Schistosoma japonicum] 136 7e-31
gi|12958837|gb|AAK09441.1| cathepsin b-like precursor protein [A... 135 1e-30
gi|8393218|ref|NP_058793.1| cathepsin C; Cathepsin C (dipeptidyl... 135 1e-30
gi|24987409|pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsi... 135 2e-30
gi|115716|sp|P80067|CATC_RAT Dipeptidyl-peptidase I precursor (D... 135 2e-30
gi|48762489|dbj|BAD23814.1| cathepsin B-N [Tuberaphis takenouchii] 134 3e-30
gi|31198479|ref|XP_308187.1| ENSANGP00000020785 [Anopheles gambi... 133 7e-30
gi|48762487|dbj|BAD23813.1| cathepsin B-N [Tuberaphis taiwana] 132 1e-29
gi|47550737|ref|NP_999887.1| cathepsin C; ik:tdsubc_1h2 [Danio r... 132 2e-29
gi|48762483|dbj|BAD23811.1| cathepsin B-S [Tuberaphis takenouchii] 130 6e-29
gi|37905530|gb|AAO64478.1| cathepsin C precursor [Fundulus heter... 129 1e-28
gi|159950|gb|AAA29435.1| cathepsin B-like cysteine protease 129 1e-28
gi|28804799|dbj|BAC57943.1| cathepsin C [Marsupenaeus japonicus] 129 1e-28
gi|1763661|gb|AAB58259.1| cysteine protease [Giardia intestinalis] 125 1e-27
gi|48126064|ref|XP_393283.1| similar to GM06507p [Apis mellifera] 121 3e-26
gi|12832450|dbj|BAB22112.1| unnamed protein product [Mus musculus] 119 8e-26
gi|7271891|gb|AAF44676.1| cathepsin L [Fasciola gigantica] 118 2e-25
gi|38045864|gb|AAR08900.1| cathepsin L [Fasciola gigantica] 115 2e-24
gi|5231178|gb|AAD41105.1| cysteine proteinase [Hypera postica] 114 3e-24
gi|38048307|gb|AAR10056.1| similar to Drosophila melanogaster CG... 112 1e-23
gi|38639319|gb|AAR25797.1| cathepsin B-like cysteine proteinase ... 112 2e-23
gi|7271889|gb|AAF44675.1| cathepsin L [Fasciola gigantica] 110 4e-23
gi|1680720|gb|AAC47348.1| cysteine protease precursor [Onchocerc... 110 4e-23
gi|46948158|gb|AAT07061.1| cathepsin Z-like cysteine proteinase ... 110 4e-23
gi|19909509|dbj|BAB86959.1| cathepsin L [Fasciola gigantica] 110 4e-23
gi|6562770|emb|CAB62589.1| putative cathepsin B-like protease [P... 110 7e-23
gi|41152538|gb|AAR99518.1| cathepsin L protein [Fasciola hepatica] 110 7e-23
gi|45738078|gb|AAS75836.1| fastuosain precursor [Bromelia fastuosa] 110 7e-23
gi|46561115|gb|AAT00789.1| cathepsin Z precursor [Onchocerca vol... 109 1e-22
gi|31558997|gb|AAP49831.1| cathepsin L [Fasciola hepatica] 108 1e-22
gi|4574304|gb|AAD23996.1| cathepsin [Fasciola gigantica] 108 2e-22
gi|14290553|gb|AAH09048.1| LCN7 protein [Homo sapiens] 108 3e-22
gi|21263041|gb|AAM44832.1| cathepsin L2 [Fasciola gigantica] 108 3e-22
gi|8547325|gb|AAF76330.1| cathepsin L [Fasciola hepatica] 108 3e-22
gi|452264|emb|CAA80449.1| cathepsin B-like protease [Fasciola he... 107 3e-22
gi|1809286|gb|AAB41670.1| secreted cathepsin L 1 [Fasciola hepat... 107 4e-22
gi|45822205|emb|CAE47499.1| cathepsin L-like proteinase [Diabrot... 107 4e-22
gi|203341|gb|AAA63484.1| cathepsin H 106 7e-22
gi|14042811|dbj|BAB55403.1| unnamed protein product [Homo sapiens] 106 7e-22
gi|47086663|ref|NP_997853.1| Unknown (protein for MGC:85774); wu... 106 7e-22
gi|6978721|ref|NP_037071.1| cathepsin H [Rattus norvegicus] >gnl... 106 7e-22
gi|20136379|gb|AAM11647.1| cathepsin L [Fasciola hepatica] 106 1e-21
gi|67653|pir||KHHUH cathepsin H (EC 3.4.22.16) precursor [valida... 105 1e-21
gi|16506813|gb|AAL23961.1| cathepsin H [Homo sapiens] 105 1e-21
gi|29708|emb|CAA30428.1| cathepsin H [Homo sapiens] 105 1e-21
gi|16506815|gb|AAL23962.1| truncated cathepsin H [Homo sapiens] 105 1e-21
gi|7271895|gb|AAF44678.1| cathepsin L [Fasciola gigantica] 105 1e-21
gi|29247428|gb|EAA38990.1| GLP_542_3431_1206 [Giardia lamblia AT... 105 2e-21
gi|29249287|gb|EAA40802.1| GLP_29_33036_32140 [Giardia lamblia A... 105 2e-21
gi|47224192|emb|CAG13112.1| unnamed protein product [Tetraodon n... 105 2e-21
gi|102074|pir||S12099 cysteine proteinase (EC 3.4.22.-) precurso... 105 2e-21
gi|10798511|emb|CAC12806.1| cathepsin L1 [Fasciola hepatica] 105 2e-21
gi|15485586|emb|CAC67416.1| cysteine protease [Trypanosoma bruce... 105 2e-21
gi|23344736|gb|AAN28681.1| cathepsin B [Theromyzon tessulatum] 104 3e-21
gi|7435828|pir||T10503 fruit bromelain (EC 3.4.22.33) FB18 precu... 104 3e-21
gi|34328540|ref|NP_899159.1| cathepsin Y [Rattus norvegicus] >gn... 104 3e-21
gi|34809309|gb|AAQ82649.1| cysteine protease [Tritrichomonas foe... 104 3e-21
gi|7489849|pir||T10518 fruit bromelain (EC 3.4.22.33) FB1035 pre... 104 4e-21
gi|545734|gb|AAB30089.1| cysteine protease [Fasciola sp.] >gnl|B... 104 4e-21
gi|48145879|emb|CAG33162.1| CTSH [Homo sapiens] 103 5e-21
gi|21264388|sp|P09668|CATH_HUMAN Cathepsin H precursor >gnl|BL_O... 103 5e-21
gi|23110955|ref|NP_004381.2| cathepsin H isoform a preproprotein... 103 5e-21
gi|630489|pir||S43991 cathepsin L-like proteinases (EC 3.4.22.-)... 103 5e-21
gi|23110957|ref|NP_683880.1| cathepsin H isoform b precursor; al... 103 5e-21
gi|7271897|gb|AAF44679.1| cathepsin L [Fasciola gigantica] 103 5e-21
gi|13905172|gb|AAH06878.1| Cathepsin H [Mus musculus] 103 5e-21
gi|7435779|pir||S71923 cysteine proteinase (EC 3.4.22.-) - garde... 103 6e-21
gi|14422331|emb|CAC41636.1| early leaf senescence abundant cyste... 103 6e-21
gi|13774082|gb|AAK38169.1| cathepsin L-like [Fasciola hepatica] 103 6e-21
gi|7106279|ref|NP_031827.1| cathepsin H; Cat H [Mus musculus] >g... 103 6e-21
gi|1141743|gb|AAB04162.1| putative cysteine proteinase 103 8e-21
gi|8347420|dbj|BAA96501.1| cysteine protease [Nicotiana tabacum] 102 1e-20
gi|41152540|gb|AAR99519.1| cathepsin L protein [Fasciola hepatica] 102 1e-20
gi|535600|gb|AAA29137.1| cathepsin [Fasciola hepatica] 102 1e-20
gi|39588844|emb|CAE69474.1| Hypothetical protein CBG15672 [Caeno... 102 1e-20
gi|8468607|gb|AAF75547.1| cruzipain [Trypanosoma cruzi] 102 1e-20
gi|7435827|pir||T10501 fruit bromelain (EC 3.4.22.33) FB13 precu... 102 1e-20
gi|7489850|pir||T10516 fruit bromelain (EC 3.4.22.33) FB22 precu... 102 1e-20
gi|118156|sp|P14658|CYSP_TRYBB Cysteine proteinase precursor >gn... 102 1e-20
gi|2351107|dbj|BAA21929.1| bromelain [Ananas comosus] 102 1e-20
gi|28192371|gb|AAK07729.1| NTCP23-like cysteine proteinase [Nico... 102 1e-20
gi|6851030|emb|CAB71032.1| cysteine protease [Lolium multiflorum] 102 1e-20
gi|39583812|emb|CAE74885.1| Hypothetical protein CBG22748 [Caeno... 102 1e-20
gi|6449324|gb|AAF08932.1| tubulointerstitial nephritis antigen i... 102 1e-20
gi|3294548|gb|AAC39839.1| cathepsin Z precursor; CTSZ [Homo sapi... 102 2e-20
gi|7245728|pdb|1DEU|A Chain A, Crystal Structure Of Human Procat... 102 2e-20
gi|19698255|dbj|BAB86770.1| cathepsin L-like [Engraulis japonicus] 102 2e-20
gi|67656|pir||KHBH aleurain (EC 3.4.22.-) precursor - barley 102 2e-20
gi|6562768|emb|CAB62588.1| putative cathepsin B-like protease [P... 102 2e-20
gi|22538442|ref|NP_001327.2| cathepsin Z preproprotein; cathepsi... 101 2e-20
gi|2499879|sp|Q40143|CYS3_LYCES Cysteine proteinase 3 precursor ... 101 2e-20
gi|4809232|gb|AAD30154.1| cathepsin Z1 preproprotein [Toxocara c... 101 2e-20
gi|23397070|gb|AAN31820.1| putative cysteine proteinase AALP [Ar... 101 2e-20
gi|18424347|ref|NP_568921.1| cysteine proteinase, putative / AAL... 101 2e-20
gi|37788267|gb|AAO64473.1| cathepsin H precursor [Fundulus heter... 101 2e-20
gi|3719219|gb|AAC63141.1| preprocathepsin P [Homo sapiens] 101 2e-20
gi|3650498|gb|AAC61477.1| cathepsin X precursor [Homo sapiens] 101 3e-20
gi|50758927|ref|XP_417483.1| PREDICTED: similar to cathepsin Y [... 101 3e-20
gi|47227517|emb|CAG04665.1| unnamed protein product [Tetraodon n... 101 3e-20
gi|37732137|gb|AAR02406.1| cysteine proteinase [Anthonomus grandis] 101 3e-20
gi|11968166|ref|NP_071720.1| cathepsin Z preproprotein; cathepsi... 101 3e-20
gi|113603|sp|P05167|ALEU_HORVU Thiol protease aleurain precursor... 100 4e-20
gi|19698257|dbj|BAB86771.1| cathepsin L-like [Engraulis japonicus] 100 4e-20
gi|47522632|ref|NP_999094.1| cathepsin H [Sus scrofa] >gnl|BL_OR... 100 7e-20
gi|7546545|pdb|1EF7|A Chain A, Crystal Structure Of Human Cathep... 100 7e-20
gi|11066226|gb|AAG28507.1| cathepsin Z [Mus musculus] 100 7e-20
gi|4139678|pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cath... 100 7e-20
gi|118157|sp|P25779|CYSP_TRYCR Cruzipain precursor (Major cystei... 100 9e-20
gi|11464864|gb|AAG35357.1| cruzipain [Trypanosoma cruzi] 100 9e-20
gi|323055|pir||A45629 cysteine proteinase cruzipain (EC 3.4.22.-... 100 9e-20
gi|11863537|emb|CAC18798.1| cathepsin Z [Cricetulus griseus] 100 9e-20
gi|1136308|gb|AAB41119.1| cruzipain 99 1e-19
gi|452268|emb|CAA80451.1| cathepsin B-like protease [Fasciola he... 99 1e-19
gi|50657031|emb|CAH04633.1| cathepsin X/O [Suberites domuncula] 99 2e-19
gi|19909511|dbj|BAB86960.1| cathepsin L [Fasciola gigantica] 99 2e-19
gi|7435820|pir||T10514 probable stem bromelain (EC 3.4.22.32) pr... 99 2e-19
gi|19747207|gb|AAL96762.1| Tcc1l8.8 [Trypanosoma cruzi] 99 2e-19
gi|8468605|gb|AAF75546.1| cruzipain [Trypanosoma cruzi] 99 2e-19
gi|18141289|gb|AAL60582.1| senescence-associated cysteine protea... 99 2e-19
gi|4521167|dbj|BAA76272.1| 26,29kDa proteinase [Sarcophaga pereg... 99 2e-19
gi|129233|sp|P25778|ORYC_ORYSA Oryzain gamma chain precursor >gn... 98 3e-19
gi|4972585|gb|AAD34707.1| cysteine proteinase [Paragonimus weste... 98 3e-19
gi|28974202|gb|AAO61485.1| cathepsin H [Sterkiella histriomuscorum] 98 3e-19
gi|1491774|emb|CAA68192.1| cysteine protease [Zea mays] 97 4e-19
gi|46948154|gb|AAT07059.1| cathepsin F-like cysteine proteinase ... 97 4e-19
gi|2624650|pdb|2AIM| Cruzain Inhibited With Benzoyl-Arginine-Al... 97 4e-19
gi|14602252|ref|NP_148795.1| ORF11 cathepsin [Cydia pomonella gr... 97 4e-19
gi|1706261|sp|Q10717|CYS2_MAIZE Cysteine proteinase 2 precursor ... 97 6e-19
gi|17569349|ref|NP_509408.1| cysteine proteinase AALP (43.7 kD) ... 97 6e-19
gi|577617|gb|AAC37213.1| cysteine proteinase 97 8e-19
gi|2677828|gb|AAB97142.1| cysteine protease [Prunus armeniaca] 97 8e-19
gi|13432122|sp|P80884|ANAN_ANACO Ananain precursor >gnl|BL_ORD_I... 97 8e-19
gi|15419587|gb|AAK97078.1| encystation-specific protease [Giardi... 96 1e-18
gi|2624670|pdb|1AIM| Cruzain Inhibited By Benzoyl-Tyrosine-Alan... 96 1e-18
gi|1136312|gb|AAB41118.1| cruzipain 96 1e-18
gi|14348750|emb|CAC41275.1| CPB2 protein [Leishmania mexicana] 96 1e-18
gi|7494569|pir||T37284 cysteine proteinase (EC 3.4.22.-) - Caeno... 96 1e-18
gi|1353726|gb|AAB01769.1| cysteine proteinase homolog 96 1e-18
gi|38683931|gb|AAR27011.1| cysteine protease [Periserrula leucop... 96 2e-18
gi|47222865|emb|CAF96532.1| unnamed protein product [Tetraodon n... 96 2e-18
gi|18408616|ref|NP_566901.1| cysteine proteinase, putative [Arab... 95 2e-18
gi|46309423|ref|YP_006313.1| cathepsin [Agrotis segetum granulov... 95 2e-18
gi|29245258|gb|EAA36907.1| GLP_41_8294_9919 [Giardia lamblia ATC... 95 2e-18
gi|29567137|ref|NP_818699.1| cathepsin [Adoxophyes honmai nucleo... 95 3e-18
gi|17507081|ref|NP_491023.1| cathepsin Z (1D256) [Caenorhabditis... 95 3e-18
gi|7435809|pir||T06529 cysteine proteinase (EC 3.4.22.-) - garde... 95 3e-18
gi|47270758|gb|AAB54210.2| Cathepsin z protein 1 [Caenorhabditis... 95 3e-18
gi|46395620|sp|O65039|CYSP_RICCO Vignain precursor (Cysteine end... 94 4e-18
gi|29165304|gb|AAO65603.1| cathepsin L precursor [Hydra vulgaris] 94 4e-18
gi|945081|gb|AAC49361.1| P21 94 4e-18
gi|7435811|pir||T06708 cysteine proteinase (EC 3.4.22.-) T29H11.... 94 4e-18
gi|42744610|gb|AAH66625.1| Zgc:66267 protein [Danio rerio] 94 4e-18
gi|50355615|dbj|BAD29956.1| cysteine protease [Daucus carota] 94 4e-18
gi|461905|sp|Q05094|CYS2_LEIPI Cysteine proteinase 2 precursor (... 94 4e-18
gi|41055337|ref|NP_956720.1| hypothetical protein MGC66267 [Dani... 94 5e-18
gi|11464866|gb|AAG35358.1| cruzipain [Trypanosoma cruzi] 94 5e-18
gi|12643318|sp|O70370|CATS_MOUSE Cathepsin S precursor >gnl|BL_O... 94 5e-18
gi|10946582|ref|NP_067256.1| cathepsin S preproprotein; Cat S [M... 94 5e-18
gi|33348834|gb|AAQ16117.1| cathepsin L-like cysteine proteinase ... 94 6e-18
gi|20147096|gb|AAM09951.1| 49 kDa cysteine proteinase Cysp1 [Cry... 94 6e-18
gi|39595452|emb|CAE60490.1| Hypothetical protein CBG04105 [Caeno... 94 6e-18
gi|1730100|sp|P36400|LCPB_LEIME Cysteine proteinase B precursor ... 93 8e-18
gi|29150712|gb|AAO64444.1| cathepsin Z-like cysteine proteinase ... 93 8e-18
gi|15705865|gb|AAL05851.1| cysteine proteinase precursor [Sander... 93 1e-17
gi|3850787|emb|CAA05360.1| cathepsin S [Mus musculus] 93 1e-17
gi|37907340|gb|AAO64476.1| cathepsin Z precursor [Fundulus heter... 93 1e-17
gi|26390492|dbj|BAC25906.1| unnamed protein product [Mus musculus] 93 1e-17
gi|12805315|gb|AAH02125.1| Ctss protein [Mus musculus] 93 1e-17
gi|13897890|gb|AAK48495.1| putative cysteine protease [Ipomoea b... 93 1e-17
gi|2352469|gb|AAC00067.1| cysteine protease [Trypanosoma cruzi] 93 1e-17
gi|1749812|emb|CAA90237.1| cysteine proteinase LmCPB1 [Leishmani... 93 1e-17
gi|7435824|pir||T07851 ananain (EC 3.4.22.31) precursor AN11 - p... 93 1e-17
gi|478768|pir||S29245 cysteine proteinase (EC 3.4.22.-) precurso... 92 1e-17
gi|37780047|gb|AAP32196.1| cysteine protease 8 [Trifolium repens] 92 1e-17
gi|47169030|pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of T... 92 2e-17
gi|14276828|gb|AAK58415.1| cysteine protease precursor [Blomia t... 92 2e-17
gi|2239109|emb|CAA70694.1| cathepsin S-like cysteine proteinase ... 92 2e-17
gi|22653679|sp|Q26636|CATL_SARPE Cathepsin L precursor >gnl|BL_O... 92 2e-17
gi|39594612|emb|CAE72190.1| Hypothetical protein CBG19298 [Caeno... 91 3e-17
gi|7435822|pir||T07840 ananain (EC 3.4.22.31) AN8 precursor - pi... 91 3e-17
gi|28971811|dbj|BAC65417.1| crustapain [Pandalus borealis] 91 3e-17
gi|24653514|ref|NP_523735.2| CG6692-PC [Drosophila melanogaster]... 91 3e-17
gi|24653516|ref|NP_725347.1| CG6692-PA [Drosophila melanogaster]... 91 3e-17
gi|1169186|sp|P43156|CYSP_HEMSP Thiol protease SEN102 precursor ... 91 4e-17
gi|40806500|gb|AAR92155.1| putative cysteine protease 2 [Iris ho... 91 4e-17
gi|1085124|pir||JX0366 cysteine endopeptidase (EC 3.4.22.-) prec... 91 5e-17
gi|1085687|pir||S53027 cathepsin L (EC 3.4.22.15) precursor - pe... 91 5e-17
gi|17562680|ref|NP_506318.1| cathepsin Z precursor (53.2 kD) (5N... 91 5e-17
gi|47939805|gb|AAH72275.1| MGC82409 protein [Xenopus laevis] 91 5e-17
gi|40556818|gb|AAR87763.1| fibroinase precursor [Bombyx mori] 91 5e-17
gi|47230018|emb|CAG10432.1| unnamed protein product [Tetraodon n... 90 7e-17
gi|34329348|gb|AAQ63885.1| putative cysteine proteinase [Medicag... 90 7e-17
gi|30141021|dbj|BAC75924.1| cysteine protease-2 [Helianthus annuus] 90 9e-17
gi|2780176|emb|CAA71085.1| cystein proteinase [Leishmania mexicana] 90 9e-17
gi|45822207|emb|CAE47500.1| cathepsin L-like proteinase [Diabrot... 90 9e-17
gi|7435816|pir||T08844 cysteine proteinase (EC 3.4.22.-) isoform... 90 9e-17
gi|46401612|dbj|BAD16614.1| cysteine proteinase [Dianthus caryop... 89 1e-16
gi|40806498|gb|AAR92154.1| putative cysteine protease 1 [Iris ho... 89 1e-16
gi|39592995|emb|CAE62609.1| Hypothetical protein CBG06727 [Caeno... 89 1e-16
gi|129232|sp|P25777|ORYB_ORYSA Oryzain beta chain precursor >gnl... 89 1e-16
gi|27372529|gb|AAO03565.1| cysteine protease 8 [Entamoeba histol... 89 1e-16
gi|42407937|dbj|BAD09076.1| putative cysteine proteinase [Oryza ... 89 2e-16
gi|18308182|gb|AAL67857.1| cysteine proteinase [Acanthamoeba hea... 89 2e-16
gi|39584558|emb|CAE74636.1| Hypothetical protein CBG22431 [Caeno... 89 2e-16
gi|1163075|emb|CAA81061.1| cysteine proteinase [Trypanosoma cong... 89 2e-16
gi|480567|pir||S37048 cysteine proteinase - Trypanosoma congolense 89 2e-16
gi|32488398|emb|CAE02823.1| OSJNBa0043A12.28 [Oryza sativa (japo... 89 2e-16
gi|6630972|gb|AAF19630.1| cysteine proteinase precursor [Myxine ... 88 3e-16
gi|40060518|gb|AAR37420.1| papain-like cysteine proteinase [Tric... 88 3e-16
gi|2765358|emb|CAA74241.1| cathepsin L [Litopenaeus vannamei] 88 3e-16
gi|34559455|gb|AAQ75437.1| cathepsin L-like protease [Helicoverp... 88 3e-16
gi|50753298|ref|XP_413946.1| PREDICTED: similar to RASGRF1 prote... 88 4e-16
gi|7381610|gb|AAF61565.1| cathepsin L-like proteinase precursor ... 88 4e-16
gi|50657029|emb|CAH04632.1| cathepsin L [Suberites domuncula] 88 4e-16
gi|1173630|gb|AAB37233.1| cysteine proteinase 88 4e-16
gi|29246183|gb|EAA37790.1| GLP_549_24108_24914 [Giardia lamblia ... 88 4e-16
gi|33873837|gb|AAH25419.1| Unknown (protein for IMAGE:3929674) [... 87 5e-16
gi|33417128|gb|AAH56059.1| Ctss-prov protein [Xenopus laevis] 87 5e-16
gi|7435793|pir||T09528 probable cysteine proteinase (EC 3.4.22.-... 87 6e-16
gi|7435775|pir||JC5443 cathepsin L-like cysteine proteinase (EC ... 87 6e-16
gi|20428641|ref|NP_620470.1| CG8947-PA [Drosophila melanogaster]... 87 6e-16
gi|27497538|gb|AAO13009.1| cathepsin S preproprotein [Canis fami... 87 8e-16
gi|1093503|prf||2104214A Cys protease 87 8e-16
gi|454890|emb|CAA54438.1| cysteine proteinase, putative [Trichom... 87 8e-16
gi|24638018|sp|P83443|MDO1_PSEMR Macrodontain I 86 1e-15
gi|32394728|gb|AAM96000.1| cathepsin L precursor [Metapenaeus en... 86 1e-15
gi|32394730|gb|AAM96001.1| cathepsin L precursor [Metapenaeus en... 86 1e-15
gi|4757570|gb|AAD29084.1| cysteine proteinase precursor [Solanum... 86 1e-15
gi|21218381|gb|AAM44058.1| cathepsin L1 [Schistosoma japonicum] 86 1e-15
gi|7381219|gb|AAF61440.1| papain-like cysteine proteinase isofor... 86 1e-15
gi|1185457|gb|AAA87848.1| cathepsin L 86 1e-15
gi|7211741|gb|AAF40414.1| papain-like cysteine proteinase isofor... 86 1e-15
gi|50539796|ref|NP_001002368.1| zgc:92089 [Danio rerio] >gnl|BL_... 86 1e-15
gi|7381221|gb|AAF61441.1| papain-like cysteine proteinase isofor... 86 1e-15
gi|7211745|gb|AAF40416.1| papain-like cysteine proteinase isofor... 86 1e-15
gi|1483570|emb|CAA68066.1| cathepsin l [Litopenaeus vannamei] 86 1e-15
gi|945054|gb|AAA74445.1| cathepsin B-like protease 86 2e-15
gi|419782|pir||S30150 cysteine proteinase (EC 3.4.22.-) precurso... 86 2e-15
gi|7211743|gb|AAF40415.1| papain-like cysteine proteinase isofor... 86 2e-15
gi|6650705|gb|AAF21977.1| thiolproteinase SmTP1 [Sarcocystis muris] 86 2e-15
gi|18423124|ref|NP_568722.1| cysteine proteinase, putative [Arab... 86 2e-15
gi|100069|pir||S24602 cysteine proteinase tpp (EC 3.4.22.-) - ga... 86 2e-15
gi|28192375|gb|AAK07731.1| CPR2-like cysteine proteinase [Nicoti... 86 2e-15
gi|5051468|emb|CAB44983.1| putative preprocysteine proteinase [N... 86 2e-15
gi|30685308|ref|NP_566634.2| cysteine proteinase, putative [Arab... 85 2e-15
gi|26452046|dbj|BAC43113.1| putative cysteine proteinase RD21A p... 85 2e-15
gi|419781|pir||S30149 cysteine proteinase (EC 3.4.22.-) precurso... 85 2e-15
gi|27497536|gb|AAO13008.1| cathepsin S preproprotein [Saimiri bo... 85 3e-15
gi|100203|pir||S24988 cysteine proteinase (EC 3.4.22.-) precurso... 84 4e-15
gi|23480960|gb|EAA17381.1| cathepsin c precursor [Plasmodium yoe... 84 4e-15
gi|1498185|dbj|BAA06738.1| cysteine proteinase-1 precursor [Dros... 84 5e-15
gi|115747|sp|P25326|CATS_BOVIN Cathepsin S >gnl|BL_ORD_ID|168691... 84 5e-15
gi|1929343|emb|CAA62835.1| cysteine proteinase [Entamoeba histol... 84 5e-15
gi|12803615|gb|AAH02642.1| Cathepsin S, preproprotein [Homo sapi... 84 7e-15
gi|23110962|ref|NP_004070.3| cathepsin S preproprotein [Homo sap... 84 7e-15
gi|30749499|pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Boun... 84 7e-15
gi|13518086|gb|AAK27384.1| cysteine proteinase-like protein [Lei... 83 9e-15
gi|284028|pir||A42482 cathepsin S (EC 3.4.22.27) precursor - hum... 83 9e-15
gi|21264393|sp|P25774|CATS_HUMAN Cathepsin S precursor 83 9e-15
gi|15824704|gb|AAL09448.1| cysteine protease [Leishmania donovani] 83 9e-15
gi|14349349|gb|AAC38833.2| cysteine protease [Leishmania donovan... 83 9e-15
gi|1706260|sp|Q10716|CYS1_MAIZE Cysteine proteinase 1 precursor ... 83 9e-15
gi|39579200|emb|CAE56993.1| Hypothetical protein CBG24860 [Caeno... 83 9e-15
gi|30749675|pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin ... 83 9e-15
gi|17384029|emb|CAD12392.1| cysteine proteinase [Leishmania infa... 83 1e-14
gi|20150649|pdb|1K3B|B Chain B, Crystal Structure Of Human Dipep... 83 1e-14
gi|49671274|gb|AAH75275.1| Unknown (protein for MGC:88904) [Xeno... 83 1e-14
gi|179957|gb|AAC37592.1| cathepsin S [Homo sapiens] 82 1e-14
gi|1841466|emb|CAA71892.1| putative pre-pro-cysteine proteinase ... 82 1e-14
>gi|17559068|ref|NP_504682.1| cysteine PRotease related (36.5 kD)
(cpr-4) [Caenorhabditis elegans]
gi|1169085|sp|P43508|CPR4_CAEEL Cathepsin B-like cysteine proteinase
4 precursor (Cysteine protease related 4)
gi|7511542|pir||T37280 probable cathepsin B (EC 3.4.22.1) cpr-4 -
Caenorhabditis elegans
gi|675500|gb|AAA98785.1| cathepsin B-like cysteine proteinase
[Caenorhabditis elegans]
gi|695293|gb|AAA98783.1| cathepsin B-like cysteine proteinase
gi|1226319|gb|AAA92327.1| Cysteine protease related protein 4
[Caenorhabditis elegans]
Length = 335
Score = 671 bits (1732), Expect = 0.0
Identities = 313/335 (93%), Positives = 313/335 (93%)
Frame = +1
Query: 1 MKYXXXXXXXXXXXXXXIPLVPKTQEAITEYVNSKQSLWKAEIPKDITIEQVKKRLMRTE 180
MKY IPLVPKTQEAITEYVNSKQSLWKAEIPKDITIEQVKKRLMRTE
Sbjct: 1 MKYLILAALVAVTAGLVIPLVPKTQEAITEYVNSKQSLWKAEIPKDITIEQVKKRLMRTE 60
Query: 181 FVAPHTPDVEVVKHDINEDTIPATFDARTQWPNCMSINNIRDQSDCGSCWXXXXXXXXSD 360
FVAPHTPDVEVVKHDINEDTIPATFDARTQWPNCMSINNIRDQSDCGSCW SD
Sbjct: 61 FVAPHTPDVEVVKHDINEDTIPATFDARTQWPNCMSINNIRDQSDCGSCWAFAAAEAASD 120
Query: 361 RFCIASNGAVNTLLSAEDVLSCCSNCGYGCEGGYPINAWKYLVKSGFCTGGSYEAQFGCK 540
RFCIASNGAVNTLLSAEDVLSCCSNCGYGCEGGYPINAWKYLVKSGFCTGGSYEAQFGCK
Sbjct: 121 RFCIASNGAVNTLLSAEDVLSCCSNCGYGCEGGYPINAWKYLVKSGFCTGGSYEAQFGCK 180
Query: 541 PYSLAPCGETVGNVTWPSCPDDGYDTPACVNKCTNKNYNVAYTADKHFGSTAYAVGKKVS 720
PYSLAPCGETVGNVTWPSCPDDGYDTPACVNKCTNKNYNVAYTADKHFGSTAYAVGKKVS
Sbjct: 181 PYSLAPCGETVGNVTWPSCPDDGYDTPACVNKCTNKNYNVAYTADKHFGSTAYAVGKKVS 240
Query: 721 QIQAEIIAHGPVEAAFTVYEDFYQYKTGVYVHTTGQELGGHAIRILGWGTDNGTPYWLVA 900
QIQAEIIAHGPVEAAFTVYEDFYQYKTGVYVHTTGQELGGHAIRILGWGTDNGTPYWLVA
Sbjct: 241 QIQAEIIAHGPVEAAFTVYEDFYQYKTGVYVHTTGQELGGHAIRILGWGTDNGTPYWLVA 300
Query: 901 NSWNVNWGENGYFRIIRGTNECGIEHAVVGGVPKV 1005
NSWNVNWGENGYFRIIRGTNECGIEHAVVGGVPKV
Sbjct: 301 NSWNVNWGENGYFRIIRGTNECGIEHAVVGGVPKV 335