Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F42H10_2
         (510 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17553408|ref|NP_498872.1| thioesterase superfamily member 2 (...   333   1e-90
gi|1078863|pir||S44652 f42h10.6 protein - Caenorhabditis elegans      323   1e-87
gi|39591671|emb|CAE71249.1| Hypothetical protein CBG18125 [Caeno...   308   3e-83
gi|13385260|ref|NP_080066.1| thioesterase superfamily member 2 [...   111   8e-24
gi|27685797|ref|XP_214475.1| similar to thioesterase superfamily...   111   8e-24
gi|8923812|ref|NP_060943.1| thioesterase superfamily member 2; h...   107   1e-22
gi|49900160|gb|AAH77030.1| Unknown (protein for MGC:89869) [Xeno...    97   2e-19
gi|50736242|ref|XP_419092.1| PREDICTED: similar to thioesterase ...    93   2e-18
gi|21357897|ref|NP_647730.1| CG16985-PA [Drosophila melanogaster...    86   5e-16
gi|32565865|ref|NP_872068.1| predicted CDS, thioesterase superfa...    83   2e-15
gi|31199225|ref|XP_308560.1| ENSANGP00000009567 [Anopheles gambi...    82   5e-15
gi|7496519|pir||T15630 hypothetical protein C25H3.3 - Caenorhabd...    80   3e-14
gi|32564734|ref|NP_495115.2| thioesterase superfamily (15.6 kD) ...    80   3e-14
gi|39596946|emb|CAE59173.1| Hypothetical protein CBG02480 [Caeno...    76   3e-13
gi|13605902|gb|AAK32936.1| At1g04290/F19P19_27 [Arabidopsis thal...    74   1e-12
gi|18379308|ref|NP_563705.1| thioesterase family protein [Arabid...    74   1e-12
gi|24656147|ref|NP_647732.1| CG16986-PA [Drosophila melanogaster...    70   3e-11
gi|46124291|ref|XP_386699.1| hypothetical protein FG06523.1 [Gib...    68   8e-11
gi|38109714|gb|EAA55543.1| hypothetical protein MG01194.4 [Magna...    66   3e-10
gi|33146522|dbj|BAC79655.1| unknown protein [Oryza sativa (japon...    59   5e-08
gi|49096964|ref|XP_409942.1| hypothetical protein AN5805.2 [Aspe...    59   6e-08
gi|21740488|emb|CAD40812.1| OSJNBa0006B20.3 [Oryza sativa (japon...    55   7e-07
gi|20808259|ref|NP_623430.1| uncharacterized protein, possibly i...    55   7e-07
gi|32412456|ref|XP_326708.1| predicted protein [Neurospora crass...    55   9e-07
gi|32408239|ref|XP_324601.1| hypothetical protein [Neurospora cr...    54   1e-06
gi|46127837|ref|XP_388472.1| hypothetical protein FG08296.1 [Gib...    54   1e-06
gi|47222274|emb|CAG11153.1| unnamed protein product [Tetraodon n...    54   1e-06
gi|49076658|ref|XP_402281.1| hypothetical protein UM04666.1 [Ust...    54   1e-06
gi|17546483|ref|NP_519885.1| CONSERVED HYPOTHETICAL PROTEIN [Ral...    53   3e-06
gi|49075526|ref|XP_401822.1| hypothetical protein UM04207.1 [Ust...    52   4e-06
gi|38110396|gb|EAA56121.1| hypothetical protein MG01772.4 [Magna...    51   1e-05
gi|32409793|ref|XP_325377.1| hypothetical protein [Neurospora cr...    51   1e-05
gi|20161439|dbj|BAB90363.1| B1065E10.13 [Oryza sativa (japonica ...    50   2e-05
gi|17546738|ref|NP_520140.1| PROBABLE SIGNAL PEPTIDE PROTEIN [Ra...    50   2e-05
gi|50260220|gb|EAL22879.1| hypothetical protein CNBA6480 [Crypto...    50   2e-05
gi|27382948|ref|NP_774477.1| bll7837 [Bradyrhizobium japonicum U...    49   6e-05
gi|19113356|ref|NP_596564.1| hypothetical protein [Schizosacchar...    48   8e-05
gi|49236387|ref|ZP_00330447.1| COG2050: Uncharacterized protein,...    47   1e-04
gi|32043665|ref|ZP_00140927.1| COG2050: Uncharacterized protein,...    47   1e-04
gi|15595671|ref|NP_249165.1| hypothetical protein [Pseudomonas a...    47   1e-04
gi|33596270|ref|NP_883913.1| conserved hypothetical protein [Bor...    47   1e-04
gi|33602070|ref|NP_889630.1| conserved hypothetical protein [Bor...    47   1e-04
gi|50084854|ref|YP_046364.1| conserved hypothetical protein; put...    47   2e-04
gi|48783914|ref|ZP_00280295.1| COG2050: Uncharacterized protein,...    47   2e-04
gi|38101835|gb|EAA48738.1| hypothetical protein MG00396.4 [Magna...    46   3e-04
gi|33592069|ref|NP_879713.1| conserved hypothetical protein [Bor...    46   3e-04
gi|47572866|ref|ZP_00242907.1| COG2050: Uncharacterized protein,...    46   4e-04
gi|28829911|gb|AAO52402.1| hypothetical protein [Dictyostelium d...    46   4e-04
gi|39934849|ref|NP_947125.1| Phenylacetic acid degradation-relat...    46   4e-04
gi|33597327|ref|NP_884970.1| Conserved hypothetical protein [Bor...    45   5e-04
gi|23501679|ref|NP_697806.1| conserved hypothetical protein [Bru...    45   7e-04
gi|48772644|ref|ZP_00276986.1| COG2050: Uncharacterized protein,...    45   7e-04
gi|46315424|ref|ZP_00216006.1| COG2050: Uncharacterized protein,...    45   7e-04
gi|46311006|ref|ZP_00211619.1| COG2050: Uncharacterized protein,...    45   9e-04
gi|46323913|ref|ZP_00224276.1| COG2050: Uncharacterized protein,...    45   9e-04
gi|46319013|ref|ZP_00219434.1| COG2050: Uncharacterized protein,...    45   9e-04
gi|23111682|ref|ZP_00097281.1| COG2050: Uncharacterized protein,...    44   0.001
gi|34904286|ref|NP_913490.1| unnamed protein product [Oryza sati...    44   0.002
gi|46136483|ref|XP_389933.1| hypothetical protein FG09757.1 [Gib...    44   0.002
gi|46199754|ref|YP_005421.1| acyl-CoA hydrolase [Thermus thermop...    44   0.002
gi|48769835|ref|ZP_00274179.1| COG2050: Uncharacterized protein,...    44   0.002
gi|15233053|ref|NP_191679.1| thioesterase family protein [Arabid...    43   0.003
gi|33593809|ref|NP_881453.1| conserved hypothetical protein [Bor...    42   0.006
gi|33595643|ref|NP_883286.1| conserved hypothetical protein [Bor...    42   0.006
gi|50085792|ref|YP_047302.1| conserved hypothetical protein [Aci...    42   0.006
gi|49066942|ref|XP_397761.1| hypothetical protein UM00146.1 [Ust...    42   0.008
gi|49081758|gb|AAT50279.1| PA4830 [synthetic construct]                42   0.008
gi|32044183|ref|ZP_00141284.1| COG2050: Uncharacterized protein,...    42   0.008
gi|15600023|ref|NP_253517.1| hypothetical protein [Pseudomonas a...    42   0.008
gi|17987450|ref|NP_540084.1| Hypothetical Protein BMEI1167 [Bruc...    41   0.010
gi|24373060|ref|NP_717103.1| cytosolic long-chain acyl-CoA thioe...    41   0.013
gi|46132194|ref|ZP_00170604.2| COG2050: Uncharacterized protein,...    41   0.013
gi|21219497|ref|NP_625276.1| hypothetical protein (fragment) [St...    40   0.022
gi|17986587|ref|NP_539221.1| Hypothetical Cytosolic Protein [Bru...    40   0.029
gi|15901679|ref|NP_346283.1| conserved hypothetical protein [Str...    39   0.049
gi|45546942|ref|ZP_00187006.1| COG2050: Uncharacterized protein,...    39   0.049
gi|48786293|ref|ZP_00282427.1| COG2050: Uncharacterized protein,...    39   0.049
gi|15903708|ref|NP_359258.1| Conserved hypothetical protein [Str...    39   0.049
gi|46314566|ref|ZP_00215151.1| COG2050: Uncharacterized protein,...    39   0.049
gi|22971015|ref|ZP_00018018.1| hypothetical protein [Chloroflexu...    39   0.064
gi|22093733|dbj|BAC07026.1| hypothetical protein [Oryza sativa (...    39   0.064
gi|11499845|ref|NP_071089.1| conserved hypothetical protein [Arc...    39   0.064
gi|34904288|ref|NP_913491.1| unnamed protein product [Oryza sati...    38   0.083
gi|16126326|ref|NP_420890.1| conserved hypothetical protein [Cau...    38   0.083
gi|24379250|ref|NP_721205.1| conserved hypothetical protein [Str...    38   0.083
gi|39937579|ref|NP_949855.1| Thioesterase superfamily [Rhodopseu...    38   0.11
gi|30022686|ref|NP_834317.1| Cytosolic protein containing multip...    38   0.11
gi|21402654|ref|NP_658639.1| CBS, Domain in cystathionine beta-s...    38   0.11
gi|42783790|ref|NP_981037.1| thioesterase family protein [Bacill...    38   0.11
gi|21221491|ref|NP_627270.1| putative acyl-CoA hydrolase [Strept...    38   0.11
gi|21244787|ref|NP_644369.1| conserved hypothetical protein [Xan...    38   0.11
gi|15807312|ref|NP_296042.1| phenylacetic acid degradation prote...    38   0.11
gi|34557126|ref|NP_906941.1| hypothetical protein WS0716 [Woline...    38   0.11
gi|478019|pir||C48956 thioesterase - Arthrobacter sp >gnl|BL_ORD...    38   0.11
gi|46202223|ref|ZP_00053569.2| COG2050: Uncharacterized protein,...    37   0.14
gi|47574278|ref|ZP_00244314.1| COG2050: Uncharacterized protein,...    37   0.14
gi|18402093|ref|NP_565683.1| thioesterase family protein [Arabid...    37   0.14
gi|46164593|ref|ZP_00137409.2| COG2050: Uncharacterized protein,...    37   0.14
gi|25408036|pir||B84698 hypothetical protein At2g29590 [imported...    37   0.14
gi|45515241|ref|ZP_00166796.1| COG2050: Uncharacterized protein,...    37   0.14
gi|48863594|ref|ZP_00317488.1| COG1607: Acyl-CoA hydrolase [Micr...    37   0.19
gi|22957851|ref|ZP_00005538.1| COG2050: Uncharacterized protein,...    37   0.19
gi|21233404|ref|NP_639321.1| conserved hypothetical protein [Xan...    37   0.19
gi|46192331|ref|ZP_00006868.2| COG2050: Uncharacterized protein,...    37   0.19
gi|30248836|ref|NP_840906.1| DUF157 [Nitrosomonas europaea ATCC ...    37   0.19
gi|28869418|ref|NP_792037.1| 4-hydroxybenzoyl-CoA thioesterase d...    37   0.24
gi|48730606|ref|ZP_00264353.1| COG2050: Uncharacterized protein,...    37   0.24
gi|29831572|ref|NP_826206.1| putative acyl-CoA hydrolase [Strept...    37   0.24
gi|48848295|ref|ZP_00302541.1| COG2050: Uncharacterized protein,...    36   0.32
gi|46131456|ref|ZP_00169675.2| COG2050: Uncharacterized protein,...    36   0.32
gi|15599166|ref|NP_252660.1| hypothetical protein [Pseudomonas a...    36   0.32
gi|48832595|ref|ZP_00289627.1| COG1607: Acyl-CoA hydrolase [Magn...    36   0.32
gi|46312009|ref|ZP_00212609.1| COG2050: Uncharacterized protein,...    36   0.41
gi|46201787|ref|ZP_00054343.2| COG2050: Uncharacterized protein,...    36   0.41
gi|27380831|ref|NP_772360.1| blr5720 [Bradyrhizobium japonicum U...    36   0.41
gi|15790368|ref|NP_280192.1| Vng1336c [Halobacterium sp. NRC-1] ...    36   0.41
gi|17545196|ref|NP_518598.1| CONSERVED HYPOTHETICAL PROTEIN [Ral...    35   0.54
gi|14521284|ref|NP_126759.1| nter region of initiation factor ei...    35   0.54
gi|13516853|dbj|BAB40578.1| 4-HBA-CoA thioesterase [Arthrobacter...    35   0.54
gi|25956126|emb|CAD58318.1| Acyl-CoA thioesterase [Azoarcus sp. ...    35   0.54
gi|45515786|ref|ZP_00167340.1| COG2050: Uncharacterized protein,...    35   0.71
gi|21674141|ref|NP_662206.1| ComA2 protein [Chlorobium tepidum T...    35   0.71
gi|18977545|ref|NP_578902.1| hypothetical protein PF1173 [Pyroco...    35   0.71
gi|16273085|ref|NP_439319.1| hypothetical protein HI1161 [Haemop...    35   0.71
gi|27379186|ref|NP_770715.1| blr4075 [Bradyrhizobium japonicum U...    35   0.71
gi|13472339|ref|NP_103906.1| probable acyl-CoA hydrolase [Mesorh...    35   0.71
gi|50556964|ref|XP_505890.1| hypothetical protein [Yarrowia lipo...    35   0.71
gi|10119873|dbj|BAB13495.1| function unknown [Bacillus subtilis]       35   0.71
gi|17935262|ref|NP_532052.1| two component sensor kinase [Agroba...    35   0.92
gi|15888688|ref|NP_354369.1| AGR_C_2521p [Agrobacterium tumefaci...    35   0.92
gi|11498531|ref|NP_069759.1| conserved hypothetical protein [Arc...    35   0.92
gi|38233804|ref|NP_939571.1| Conserved hypothetical protein [Cor...    35   0.92
gi|27657347|emb|CAD60256.1| acyl-CoA thioester-like hydrolase [D...    35   0.92
gi|46436093|gb|EAK95462.1| hypothetical protein CaO19.11110 [Can...    34   1.2
gi|50428638|gb|AAT76989.1| putative thioesterase family protein ...    34   1.2
gi|16124445|ref|NP_419009.1| cytosolic long-chain acyl-CoA thioe...    34   1.2
gi|46436037|gb|EAK95407.1| hypothetical protein CaO19.3627 [Cand...    34   1.2
gi|39934663|ref|NP_946939.1| Thioesterase superfamily [Rhodopseu...    34   1.6
gi|48846667|ref|ZP_00300927.1| COG1607: Acyl-CoA hydrolase [Geob...    34   1.6
gi|12230664|sp|O66120|YCIA_ZYMMO Hypothetical 16.2 kDa protein >...    34   1.6
gi|42631463|ref|ZP_00157001.1| COG2050: Uncharacterized protein,...    34   1.6
gi|1196924|gb|AAA88579.1| unknown [Streptococcus pneumoniae]           34   1.6
gi|48856215|ref|ZP_00310373.1| COG1607: Acyl-CoA hydrolase [Cyto...    34   1.6
gi|41723489|ref|ZP_00150416.1| COG2050: Uncharacterized protein,...    34   1.6
gi|46131567|ref|ZP_00202631.1| COG2050: Uncharacterized protein,...    34   1.6
gi|16127539|ref|NP_422103.1| conserved hypothetical protein [Cau...    34   1.6
gi|48848272|ref|ZP_00302518.1| COG2050: Uncharacterized protein,...    34   1.6
gi|16080218|ref|NP_391045.1| yuxO [Bacillus subtilis subsp. subt...    33   2.1
gi|15805310|ref|NP_294002.1| conserved hypothetical protein [Dei...    33   2.1
gi|15920495|ref|NP_376164.1| 307aa long hypothetical cytosolic a...    33   2.1
gi|31224454|ref|XP_317442.1| ENSANGP00000011787 [Anopheles gambi...    33   2.1
gi|50257000|gb|EAL19718.1| hypothetical protein CNBG3460 [Crypto...    33   2.1
gi|1171340|gb|AAB58959.1| ATP phosphoribosyltransferase [Brucell...    33   2.1
gi|50086142|ref|YP_047652.1| conserved hypothetical protein [Aci...    33   2.1
gi|15965555|ref|NP_385908.1| PUTATIVE SENSOR HISTIDINE KINASE TR...    33   2.1
gi|15613361|ref|NP_241664.1| acyl-CoA hydrolase [Bacillus halodu...    33   2.1
gi|41723568|ref|ZP_00150478.1| COG0824: Predicted thioesterase [...    33   2.1
gi|28971837|dbj|BAC65440.1| putative 2-hydroxypent-2,4-dienoate ...    33   2.7
gi|27376318|ref|NP_767847.1| bll1207 [Bradyrhizobium japonicum U...    33   2.7
gi|34498656|ref|NP_902871.1| conserved hypothetical protein [Chr...    33   2.7
gi|41408454|ref|NP_961290.1| hypothetical protein MAP2356 [Mycob...    33   2.7
gi|42780499|ref|NP_977746.1| maoC family protein [Bacillus cereu...    33   2.7
gi|4584856|gb|AAD25165.1| unknown [Arthrobacter sp. SU] >gnl|BL_...    33   2.7
gi|15889285|ref|NP_354966.1| AGR_C_3625p [Agrobacterium tumefaci...    33   2.7
gi|48730897|ref|ZP_00264643.1| COG1607: Acyl-CoA hydrolase [Pseu...    33   2.7
gi|27380876|ref|NP_772405.1| blr5765 [Bradyrhizobium japonicum U...    33   2.7
gi|21399224|ref|NP_655209.1| MaoC_dehydratas, MaoC like domain [...    33   3.5
gi|13516856|dbj|BAB40581.1| 4-HBA-CoA thioesterase [Arthrobacter...    33   3.5
gi|45267888|gb|AAS55787.1| hypothetical protein [Oryza sativa (j...    33   3.5
gi|31615739|pdb|1O0I|A Chain A, X-Ray Structure Of Yb61_haein No...    33   3.5
gi|17508925|ref|NP_493227.1| predicted CDS, putative nuclear pro...    33   3.5
gi|47096789|ref|ZP_00234371.1| CBS domain protein [Listeria mono...    33   3.5
gi|46907807|ref|YP_014196.1| CBS domain protein [Listeria monocy...    33   3.5
gi|34809570|pdb|1IXL|A Chain A, Crystal Structure Of Uncharacter...    33   3.5
gi|14590964|ref|NP_143039.1| hypothetical protein PH1136 [Pyroco...    33   3.5
gi|15965651|ref|NP_386004.1| CONSERVED HYPOTHETICAL PROTEIN [Sin...    33   3.5
gi|17548106|ref|NP_521508.1| HYPOTHETICAL PROTEIN RS05670 [Ralst...    32   4.6
gi|49388919|dbj|BAD26141.1| unknown protein [Oryza sativa (japon...    32   4.6
gi|15677335|ref|NP_274490.1| acyl CoA thioester hydrolase family...    32   4.6
gi|26991653|ref|NP_747078.1| long-chain acyl-CoA thioester hydro...    32   4.6
gi|29834038|ref|NP_828672.1| hypothetical protein SAV7496 [Strep...    32   4.6
gi|27377541|ref|NP_769070.1| acyl-CoA hydrolase [Bradyrhizobium ...    32   4.6
gi|34496611|ref|NP_900826.1| probable acy-CoA thioester hydrolas...    32   4.6
gi|6323337|ref|NP_013409.1| Enzyme that mediates the conjugation...    32   6.0
gi|15898097|ref|NP_342702.1| Conserved hypothetical protein [Sul...    32   6.0
gi|15891100|ref|NP_356772.1| AGR_L_1969p [Agrobacterium tumefaci...    32   6.0
gi|27366456|ref|NP_761984.1| Phopholipase D-family protein [Vibr...    32   6.0
gi|27367121|ref|NP_762648.1| Phosphatidylserine/phosphatidylglyc...    32   6.0
gi|28872180|ref|NP_794799.1| 4-hydroxybenzoyl-CoA thioesterase d...    32   6.0
gi|46188716|ref|ZP_00125126.2| COG1607: Acyl-CoA hydrolase [Pseu...    32   6.0
gi|15221148|ref|NP_175266.1| thioesterase family protein [Arabid...    32   6.0
gi|25028145|ref|NP_738199.1| conserved hypothetical protein [Cor...    32   6.0
gi|39995902|ref|NP_951853.1| acyl-CoA thioester hydrolase, putat...    32   6.0
gi|38347179|emb|CAE02401.2| OSJNBa0024J22.5 [Oryza sativa (japon...    32   7.8
gi|39998550|ref|NP_954501.1| thioesterase family protein [Geobac...    32   7.8
gi|16800679|ref|NP_470947.1| similar to unknown proteins [Lister...    32   7.8
gi|41723137|ref|ZP_00150080.1| COG1607: Acyl-CoA hydrolase [Dech...    32   7.8
gi|50121242|ref|YP_050409.1| putative acyl-CoA thioester hydrola...    32   7.8


>gi|17553408|ref|NP_498872.1| thioesterase superfamily member 2
           (18.3 kD) (3J568) [Caenorhabditis elegans]
 gi|21431868|sp|P34419|YLZ6_CAEEL Hypothetical UPF0152 protein
           F42H10.6 in chromosome III
 gi|15145345|gb|AAA28024.2| Hypothetical protein F42H10.6
           [Caenorhabditis elegans]
          Length = 169

 Score =  333 bits (853), Expect = 1e-90
 Identities = 169/169 (100%), Positives = 169/169 (100%)
 Frame = -1

Query: 510 MVGHSESSTDAVIEPTSEELLAEQVRVFNKMKGSTNFNRVAEDVYPVEVTKSKLVCEMVV 331
           MVGHSESSTDAVIEPTSEELLAEQVRVFNKMKGSTNFNRVAEDVYPVEVTKSKLVCEMVV
Sbjct: 1   MVGHSESSTDAVIEPTSEELLAEQVRVFNKMKGSTNFNRVAEDVYPVEVTKSKLVCEMVV 60

Query: 330 QHQHLNSKGTLHGGQTATLTDVITARAVGVTVKDKGMASVELAVSYLLPVKVGDVLEITA 151
           QHQHLNSKGTLHGGQTATLTDVITARAVGVTVKDKGMASVELAVSYLLPVKVGDVLEITA
Sbjct: 61  QHQHLNSKGTLHGGQTATLTDVITARAVGVTVKDKGMASVELAVSYLLPVKVGDVLEITA 120

Query: 150 HVLKVGRTMAFTDCEFRRKSDGKMSAKGKHTLAFLPNQPGISVENGTQF 4
           HVLKVGRTMAFTDCEFRRKSDGKMSAKGKHTLAFLPNQPGISVENGTQF
Sbjct: 121 HVLKVGRTMAFTDCEFRRKSDGKMSAKGKHTLAFLPNQPGISVENGTQF 169




[DB home][top]