Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F41G4_3
(1104 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17569501|ref|NP_510715.1| stomatin (sto-5) [Caenorhabditis el... 657 0.0
gi|39596264|emb|CAE69902.1| Hypothetical protein CBG16252 [Caeno... 626 e-178
gi|32453010|gb|AAP82654.1| Stomatin protein 5, isoform b [Caenor... 551 e-155
gi|32453011|gb|AAP82655.1| Stomatin protein 5, isoform c [Caenor... 309 9e-83
gi|21450569|gb|AAM54192.1| Mechanosensory abnormality protein 2,... 290 4e-77
gi|25153583|ref|NP_741797.1| MEChanosensory abnormality MEC-2, s... 290 4e-77
gi|39598155|emb|CAE68847.1| Hypothetical protein CBG14809 [Caeno... 290 4e-77
gi|17569499|ref|NP_509944.1| stomatin (30.8 kD) (sto-4) [Caenorh... 289 9e-77
gi|39594736|emb|CAE70604.1| Hypothetical protein CBG17279 [Caeno... 289 9e-77
gi|7494583|pir||T34324 erythrocyte band 7 intergral membrane pro... 284 3e-75
gi|17570161|ref|NP_508202.1| UNCoordinated locomotion UNC-1, sto... 284 3e-75
gi|39592500|emb|CAE63577.1| Hypothetical protein CBG08066 [Caeno... 284 3e-75
gi|17570459|ref|NP_509943.1| stomatin (33.2 kD) (sto-6) [Caenorh... 283 4e-75
gi|39594737|emb|CAE70605.1| Hypothetical protein CBG17281 [Caeno... 283 5e-75
gi|24657857|ref|NP_729018.1| CG32245-PB [Drosophila melanogaster... 271 2e-71
gi|17861728|gb|AAL39341.1| GH25458p [Drosophila melanogaster] 271 2e-71
gi|24657837|ref|NP_729016.1| CG32245-PC [Drosophila melanogaster... 271 2e-71
gi|24657844|ref|NP_647917.2| CG32245-PA [Drosophila melanogaster... 271 2e-71
gi|47227112|emb|CAG00474.1| unnamed protein product [Tetraodon n... 270 3e-71
gi|16767908|gb|AAL28172.1| GH04632p [Drosophila melanogaster] 269 8e-71
gi|31210697|ref|XP_314315.1| ENSANGP00000001172 [Anopheles gambi... 268 1e-70
gi|18859437|ref|NP_571833.1| stomatin; erythrocyte protein band ... 267 4e-70
gi|32450645|gb|AAH54307.1| Stom-prov protein [Xenopus laevis] 265 1e-69
gi|27769149|gb|AAH42356.1| Epb7.2-prov protein [Xenopus laevis] 265 2e-69
gi|1103842|gb|AAC50296.1| band 7.2b stomatin >gnl|BL_ORD_ID|5328... 264 2e-69
gi|38016911|ref|NP_004090.4| stomatin isoform a; erythrocyte mem... 264 2e-69
gi|181184|gb|AAA58432.1| stomatin peptide 264 2e-69
gi|50757151|ref|XP_415401.1| PREDICTED: similar to Erythrocyte b... 264 3e-69
gi|34853860|ref|XP_216045.2| similar to erthyrocyte band 7 integ... 264 3e-69
gi|2137794|pir||JC5221 stomatin - mouse >gnl|BL_ORD_ID|15973 gi|... 264 3e-69
gi|7710018|ref|NP_038543.1| erythrocyte protein band 7.2; protei... 263 4e-69
gi|3747064|gb|AAC64173.1| stomatin [Mus musculus] 263 4e-69
gi|14715077|gb|AAH10703.1| Stomatin, isoform a [Homo sapiens] 263 5e-69
gi|2507563|sp|P54116|STOM_MOUSE Erythrocyte band 7 integral memb... 263 7e-69
gi|47221084|emb|CAG12778.1| unnamed protein product [Tetraodon n... 261 3e-68
gi|31210569|ref|XP_314251.1| ENSANGP00000023515 [Anopheles gambi... 260 3e-68
gi|31210565|ref|XP_314249.1| ENSANGP00000022711 [Anopheles gambi... 260 3e-68
gi|31205365|ref|XP_311631.1| ENSANGP00000024399 [Anopheles gambi... 260 3e-68
gi|31205363|ref|XP_311630.1| ENSANGP00000014875 [Anopheles gambi... 260 3e-68
gi|32566490|ref|NP_508902.3| stomatin (sto-2) [Caenorhabditis el... 258 2e-67
gi|7500297|pir||T16240 hypothetical protein F32A6.5 - Caenorhabd... 258 2e-67
gi|39598038|emb|CAE68730.1| Hypothetical protein CBG14656 [Caeno... 256 7e-67
gi|18860517|ref|NP_573357.1| CG7635-PA [Drosophila melanogaster]... 255 1e-66
gi|45556022|ref|NP_996512.1| CG33253-PA [Drosophila melanogaster... 253 7e-66
gi|17569497|ref|NP_509941.1| stomatin (sto-3) [Caenorhabditis el... 249 1e-64
gi|17569493|ref|NP_509281.1| stomatin (sto-1) [Caenorhabditis el... 248 1e-64
gi|45361535|ref|NP_989344.1| hypothetical protein MGC75647 [Xeno... 244 3e-63
gi|7447613|pir||T15971 hypothetical protein F08C6.4 - Caenorhabd... 240 5e-62
gi|23346603|ref|NP_694796.1| stomatin (Epb7.2)-like 3; stomatin ... 237 4e-61
gi|37194829|gb|AAH58224.1| Stoml3 protein [Mus musculus] 237 4e-61
gi|39594739|emb|CAE70607.1| Hypothetical protein CBG17284 [Caeno... 236 5e-61
gi|21686995|ref|NP_660329.1| stomatin-like 3; erythrocyte band 7... 234 2e-60
gi|39594130|emb|CAE70240.1| Hypothetical protein CBG16729 [Caeno... 233 6e-60
gi|34857327|ref|XP_227141.2| similar to stomatin related olfacto... 233 6e-60
gi|11499015|ref|NP_070249.1| membrane protein [Archaeoglobus ful... 229 7e-59
gi|50731223|ref|XP_425632.1| PREDICTED: similar to stomatin-like... 228 2e-58
gi|26346296|dbj|BAC36799.1| unnamed protein product [Mus musculus] 223 5e-57
gi|47196819|emb|CAF89245.1| unnamed protein product [Tetraodon n... 217 3e-55
gi|28573263|ref|NP_649445.3| CG14644-PA [Drosophila melanogaster... 216 1e-54
gi|45547666|ref|ZP_00187709.1| COG0330: Membrane protease subuni... 210 4e-53
gi|1469524|gb|AAB18857.1| stomatin 207 5e-52
gi|47210284|emb|CAF93637.1| unnamed protein product [Tetraodon n... 206 6e-52
gi|21673626|ref|NP_661691.1| band 7 family protein [Chlorobium t... 204 2e-51
gi|14520865|ref|NP_126340.1| stomatin-like protein [Pyrococcus a... 203 7e-51
gi|39997525|ref|NP_953476.1| SPFH/Band 7 domain protein [Geobact... 203 7e-51
gi|48846848|ref|ZP_00301107.1| COG0330: Membrane protease subuni... 202 1e-50
gi|14591293|ref|NP_143371.1| erythrocyte band7 integral membrane... 201 2e-50
gi|18977906|ref|NP_579263.1| hypothetical stomatin [Pyrococcus f... 201 2e-50
gi|20806896|ref|NP_622067.1| Membrane protease subunits, stomati... 201 3e-50
gi|7657615|ref|NP_055440.1| podocin; NPHS2 gene (podocin) [Homo ... 194 3e-48
gi|24646180|ref|NP_731666.1| CG14736-PB [Drosophila melanogaster... 194 4e-48
gi|24646182|ref|NP_731667.1| CG14736-PA [Drosophila melanogaster... 194 4e-48
gi|31543335|ref|NP_570841.2| podocin [Rattus norvegicus] >gnl|BL... 193 7e-48
gi|30172987|sp|Q8K4G9|PODO_RAT Podocin >gnl|BL_ORD_ID|866603 gi|... 193 7e-48
gi|15606241|ref|NP_213619.1| erythrocyte band 7 homolog [Aquifex... 192 1e-47
gi|18485514|ref|NP_569723.1| nephrosis 2 homolog, podocin [Mus m... 192 2e-47
gi|15020840|emb|CAC44636.1| podocin [Mus musculus] 192 2e-47
gi|26342943|dbj|BAC35128.1| unnamed protein product [Mus musculus] 192 2e-47
gi|30250388|ref|NP_842458.1| Band 7 protein [Nitrosomonas europa... 191 2e-47
gi|33597278|ref|NP_884921.1| Putative membrane protein [Bordetel... 189 1e-46
gi|45916800|ref|ZP_00197636.1| COG0330: Membrane protease subuni... 186 6e-46
gi|16264862|ref|NP_437654.1| putative stomatin-like protein [Sin... 185 1e-45
gi|42523755|ref|NP_969135.1| band 7 protein [Bdellovibrio bacter... 185 1e-45
gi|15595649|ref|NP_249143.1| probable stomatin-like protein [Pse... 184 3e-45
gi|14601876|ref|NP_148418.1| erythrocyte band 7 integral membran... 184 3e-45
gi|29654773|ref|NP_820465.1| SPFH domain/Band 7 family domain pr... 184 4e-45
gi|49082930|gb|AAT50865.1| PA0452 [synthetic construct] 184 4e-45
gi|13471831|ref|NP_103398.1| probable stomatin [Mesorhizobium lo... 183 5e-45
gi|45519588|ref|ZP_00171139.1| COG0330: Membrane protease subuni... 183 7e-45
gi|48785701|ref|ZP_00281910.1| COG0330: Membrane protease subuni... 182 9e-45
gi|17545521|ref|NP_518923.1| PUTATIVE STOMATIN-LIKE TRANSMEMBRAN... 182 2e-44
gi|18029255|gb|AAL56433.1| similar to stomatin [Oikopleura dioica] 182 2e-44
gi|46581756|ref|YP_012564.1| SPFH domain/Band 7 family protein [... 181 2e-44
gi|48771000|ref|ZP_00275343.1| COG0330: Membrane protease subuni... 181 3e-44
gi|27262372|gb|AAN87467.1| erythrocyte band 7 integral membrane ... 181 4e-44
gi|27380062|ref|NP_771591.1| bll4951 [Bradyrhizobium japonicum U... 181 4e-44
gi|46915992|emb|CAG22763.1| putative stomatin-like protein [Phot... 180 6e-44
gi|46323173|ref|ZP_00223538.1| COG0330: Membrane protease subuni... 179 8e-44
gi|21356845|ref|NP_650147.1| CG31358-PA [Drosophila melanogaster... 179 1e-43
gi|48850035|ref|ZP_00304277.1| COG0330: Membrane protease subuni... 179 1e-43
gi|50843420|ref|YP_056647.1| stomatin/prohibitin homolog [Propio... 178 2e-43
gi|26986943|ref|NP_742368.1| SPFH domain/Band 7 family protein [... 178 2e-43
gi|20089794|ref|NP_615869.1| erythrocyte band 7 integral membran... 178 2e-43
gi|41719690|ref|ZP_00148566.1| COG0330: Membrane protease subuni... 178 2e-43
gi|21228135|ref|NP_634057.1| stomatin-like protein [Methanosarci... 177 3e-43
gi|23102707|ref|ZP_00089208.1| COG0330: Membrane protease subuni... 177 5e-43
gi|46313350|ref|ZP_00213941.1| COG0330: Membrane protease subuni... 176 9e-43
gi|28900961|ref|NP_800616.1| putative stomatin-like protein [Vib... 176 1e-42
gi|20094283|ref|NP_614130.1| Membrane protease subunit, stomatin... 176 1e-42
gi|41409281|ref|NP_962117.1| hypothetical protein MAP3183 [Mycob... 175 1e-42
gi|48838988|ref|ZP_00295924.1| COG0330: Membrane protease subuni... 174 4e-42
gi|21224384|ref|NP_630163.1| putative membrane protein [Streptom... 171 4e-41
gi|15679768|ref|NP_276886.1| stomatin-like protein [Methanotherm... 170 6e-41
gi|29828754|ref|NP_823388.1| hypothetical protein SAV2212 [Strep... 169 8e-41
gi|15824697|gb|AAL09446.1| podocin [Rattus norvegicus] 166 7e-40
gi|2655363|gb|AAC64873.1| stomatin like protein [Rhizobium etli] 166 1e-39
gi|13277804|gb|AAH03789.1| Epb7.2 protein [Mus musculus] 164 3e-39
gi|15898972|ref|NP_343577.1| Erythrocyte band 7 membrane protein... 163 6e-39
gi|15922536|ref|NP_378205.1| 260aa long hypothetical erythrocyte... 163 8e-39
gi|18312154|ref|NP_558821.1| conserved protein (band 7 homolog) ... 154 3e-36
gi|23473174|ref|ZP_00128470.1| COG0330: Membrane protease subuni... 150 7e-35
gi|45551882|ref|NP_731668.2| CG14736-PC [Drosophila melanogaster... 144 3e-33
gi|19528189|gb|AAL90209.1| AT28327p [Drosophila melanogaster] 144 3e-33
gi|22086350|gb|AAM90639.1| podocin; NPHS2 [Rattus norvegicus] 142 1e-32
gi|16082292|ref|NP_394756.1| membrane protein 7, erythrocyte (hu... 141 2e-32
gi|13541147|ref|NP_110835.1| Membrane protease subunit (stomatin... 140 4e-32
gi|50751118|ref|XP_422265.1| PREDICTED: similar to podocin [Gall... 139 2e-31
gi|48477457|ref|YP_023163.1| band 7 integral membrane protein-li... 135 2e-30
gi|48853128|ref|ZP_00307309.1| COG0330: Membrane protease subuni... 135 2e-30
gi|47223910|emb|CAG06087.1| unnamed protein product [Tetraodon n... 133 8e-30
gi|14590383|ref|NP_142449.1| membrane protein [Pyrococcus horiko... 132 2e-29
gi|14521762|ref|NP_127238.1| stomatin-like protein [Pyrococcus a... 131 3e-29
gi|48729059|ref|ZP_00262811.1| COG0330: Membrane protease subuni... 130 4e-29
gi|15669014|ref|NP_247818.1| membrane protein, putative regulato... 127 6e-28
gi|15643629|ref|NP_228675.1| conserved hypothetical protein [The... 124 4e-27
gi|45358599|ref|NP_988156.1| Band 7 protein:Stomatin [Methanococ... 120 7e-26
gi|46201423|ref|ZP_00055092.2| COG0330: Membrane protease subuni... 117 6e-25
gi|49076854|ref|XP_402357.1| hypothetical protein UM04742.1 [Ust... 117 6e-25
gi|13236193|gb|AAK16087.1| YcaD [Photorhabdus luminescens] 116 8e-25
gi|37527681|ref|NP_931025.1| hypothetical protein [Photorhabdus ... 116 1e-24
gi|22973475|ref|ZP_00020124.1| hypothetical protein [Chloroflexu... 116 1e-24
gi|15678719|ref|NP_275835.1| stomatin-like protein [Methanotherm... 115 2e-24
gi|47225862|emb|CAF98342.1| unnamed protein product [Tetraodon n... 114 5e-24
gi|16127605|ref|NP_422169.1| band 7/Mec-2 family protein [Caulob... 112 2e-23
gi|6456514|gb|AAF09169.1| HflC homolog [Clostridium difficile] 111 3e-23
gi|23467886|ref|ZP_00123463.1| COG0330: Membrane protease subuni... 108 2e-22
gi|32029571|ref|ZP_00132574.1| COG0330: Membrane protease subuni... 108 2e-22
gi|15602754|ref|NP_245826.1| unknown [Pasteurella multocida Pm70... 108 2e-22
gi|16123260|ref|NP_406573.1| conserved hypothetical protein [Yer... 108 3e-22
gi|50470480|ref|YP_054433.1| hypothetical protein WGpWb0004 [Wig... 107 4e-22
gi|15800226|ref|NP_286238.1| putative protease [Escherichia coli... 107 4e-22
gi|50555892|ref|XP_505354.1| hypothetical protein [Yarrowia lipo... 107 5e-22
gi|48893869|ref|ZP_00327067.1| COG0330: Membrane protease subuni... 106 8e-22
gi|50120135|ref|YP_049302.1| putative membrane protein [Erwinia ... 106 8e-22
gi|49481659|ref|YP_036221.1| stomatin-like protein [Bacillus thu... 106 1e-21
gi|42781212|ref|NP_978459.1| SPFH domain/Band 7 family protein [... 106 1e-21
gi|47566841|ref|ZP_00237559.1| stomatin-like protein [Bacillus c... 106 1e-21
gi|21399946|ref|NP_655931.1| Band_7, SPFH domain / Band 7 family... 106 1e-21
gi|30020194|ref|NP_831825.1| Stomatin like protein [Bacillus cer... 105 2e-21
gi|45916145|ref|ZP_00195000.2| COG0330: Membrane protease subuni... 105 2e-21
gi|16763881|ref|NP_459496.1| putative inner membrane protein [Sa... 105 2e-21
gi|16759479|ref|NP_455096.1| putative membrane protein [Salmonel... 105 2e-21
gi|24375614|ref|NP_719657.1| SPFH domain/Band 7 family protein [... 104 3e-21
gi|48094863|ref|XP_394289.1| similar to ENSANGP00000000956 [Apis... 104 4e-21
gi|4160546|emb|CAA76271.1| SLP-1 protein [Homo sapiens] 103 5e-21
gi|5689799|emb|CAB52016.1| SLP-1 [Homo sapiens] 103 5e-21
gi|20149563|ref|NP_004800.2| stomatin (EPB72)-like 1; stomatin-l... 103 5e-21
gi|49457131|emb|CAG46886.1| STOML1 [Homo sapiens] 103 5e-21
gi|46916123|emb|CAG22892.1| putative protease [Photobacterium pr... 103 5e-21
gi|24214772|ref|NP_712253.1| membrane protein [Leptospira interr... 103 7e-21
gi|50255960|gb|EAL18689.1| hypothetical protein CNBI2770 [Crypto... 103 9e-21
gi|15891178|ref|NP_356850.1| AGR_L_2127p [Agrobacterium tumefaci... 103 9e-21
gi|32404066|ref|XP_322646.1| hypothetical protein [Neurospora cr... 102 1e-20
gi|48833818|ref|ZP_00290834.1| COG0330: Membrane protease subuni... 102 1e-20
gi|28881163|emb|CAD70333.1| related to stomatin [Neurospora crassa] 102 1e-20
gi|19704881|ref|NP_602376.1| Stomatin like protein [Fusobacteriu... 102 2e-20
gi|46438099|gb|EAK97435.1| hypothetical protein CaO19.7296 [Cand... 102 2e-20
gi|13472654|ref|NP_104221.1| hypothetical protein mlr3021 [Mesor... 102 2e-20
gi|17988363|ref|NP_540996.1| STOMATIN LIKE PROTEIN [Brucella mel... 102 2e-20
gi|23331113|gb|AAH37074.1| Stomatin-like 1 [Mus musculus] 102 2e-20
gi|42526218|ref|NP_971316.1| SPFH domain/Band 7 family protein [... 101 4e-20
gi|28897579|ref|NP_797184.1| conserved hypothetical protein [Vib... 101 4e-20
gi|10955528|ref|NP_065380.1| hypothetical protein R721_89 [Esche... 100 5e-20
gi|37679170|ref|NP_933779.1| putative membrane protease [Vibrio ... 100 6e-20
gi|18266423|gb|AAL67572.1| putative transmembrane protein [Sinor... 100 1e-19
gi|15966557|ref|NP_386910.1| HYPOTHETICAL TRANSMEMBRANE PROTEIN ... 100 1e-19
gi|15608626|ref|NP_216004.1| hypothetical protein Rv1488 [Mycoba... 100 1e-19
gi|15807137|ref|NP_295866.1| conserved hypothetical protein [Dei... 100 1e-19
gi|7228883|gb|AAF42675.1| membrane protein GNA1220 [Neisseria me... 99 1e-19
gi|7228885|gb|AAF42676.1| membrane protein GNA1220 [Neisseria me... 99 1e-19
gi|21232310|ref|NP_638227.1| conserved hypothetical protein [Xan... 99 1e-19
gi|46138789|ref|XP_391085.1| hypothetical protein FG10909.1 [Gib... 99 2e-19
gi|15640992|ref|NP_230623.1| conserved hypothetical protein [Vib... 99 2e-19
gi|47213317|emb|CAF89675.1| unnamed protein product [Tetraodon n... 99 2e-19
gi|27754035|ref|NP_081218.2| stomatin-like 1 [Mus musculus] >gnl... 99 2e-19
gi|15721878|dbj|BAB68403.1| stomatin-like protein [Gibberella fu... 99 2e-19
gi|42524093|ref|NP_969473.1| putative membrane protein with prot... 98 3e-19
gi|41054125|ref|NP_957325.1| similar to stomatin (Epb7.2)-like 2... 98 3e-19
gi|41407312|ref|NP_960148.1| hypothetical protein MAP1214 [Mycob... 98 3e-19
gi|5326747|gb|AAD42031.1| stomatin-like protein UNC24 [Homo sapi... 98 3e-19
gi|34541024|ref|NP_905503.1| band 7/Mec-2 family protein [Porphy... 98 4e-19
gi|27363684|ref|NP_759212.1| Membrane protease subunits [Vibrio ... 98 4e-19
gi|50413238|ref|XP_457231.1| unnamed protein product [Debaryomyc... 98 4e-19
gi|24214771|ref|NP_712252.1| membrane protein [Leptospira interr... 97 5e-19
gi|7228852|gb|AAF42660.1| membrane protein GNA1220 [Neisseria me... 97 5e-19
gi|15794303|ref|NP_284125.1| putative periplasmic protein [Neiss... 97 5e-19
gi|15789595|ref|NP_279419.1| bifunctional short chain isoprenyl ... 97 5e-19
gi|15677093|ref|NP_274245.1| stomatin/Mec-2 family protein [Neis... 97 7e-19
gi|7228868|gb|AAF42668.1| membrane protein GNA1220 [Neisseria me... 97 7e-19
gi|7228858|gb|AAF42663.1| membrane protein GNA1220 [Neisseria me... 97 7e-19
gi|20151909|gb|AAM11314.1| SD03319p [Drosophila melanogaster] 97 9e-19
gi|45550506|ref|NP_611853.2| CG2970-PA [Drosophila melanogaster]... 97 9e-19
gi|48787674|ref|ZP_00283653.1| COG0330: Membrane protease subuni... 97 9e-19
gi|49091678|ref|XP_407300.1| hypothetical protein AN3163.2 [Aspe... 97 9e-19
gi|48781860|ref|ZP_00278439.1| COG0330: Membrane protease subuni... 97 9e-19
gi|46311920|ref|ZP_00212521.1| COG0330: Membrane protease subuni... 96 1e-18
gi|46319060|ref|ZP_00219480.1| COG0330: Membrane protease subuni... 96 1e-18
gi|21225504|ref|NP_631283.1| putative secreted protein [Streptom... 96 1e-18
gi|50752642|ref|XP_413691.1| PREDICTED: similar to stomatin (EPB... 96 1e-18
gi|7274432|gb|AAF44771.1| GNA1220 [Neisseria gonorrhoeae] >gnl|B... 96 1e-18
gi|15827960|ref|NP_302223.1| conserved hypothetical protein [Myc... 96 1e-18
gi|31197807|ref|XP_307851.1| ENSANGP00000018661 [Anopheles gambi... 96 1e-18
gi|46106594|ref|ZP_00200069.1| COG0330: Membrane protease subuni... 96 1e-18
gi|38108404|gb|EAA54425.1| hypothetical protein MG02410.4 [Magna... 96 2e-18
gi|17542664|ref|NP_501335.1| UNCoordinated locomotion UNC-24, st... 96 2e-18
gi|46130495|ref|ZP_00165390.2| COG0330: Membrane protease subuni... 96 2e-18
gi|32266355|ref|NP_860387.1| membrane protease subunits [Helicob... 95 3e-18
gi|2183273|gb|AAC46209.1| MAV266 [Mycobacterium avium] 95 3e-18
gi|46365936|ref|ZP_00199200.2| COG0330: Membrane protease subuni... 95 3e-18
gi|48104453|ref|XP_395784.1| similar to SD03319p [Apis mellifera] 95 3e-18
gi|47575461|ref|ZP_00245496.1| COG0330: Membrane protease subuni... 94 4e-18
gi|39933953|ref|NP_946229.1| conserved unknown protein [Rhodopse... 94 4e-18
gi|22299727|ref|NP_682974.1| ORF_ID:tlr2184~hypothetical protein... 94 4e-18
gi|21220287|ref|NP_626066.1| putative secreted protein [Streptom... 94 6e-18
gi|17546142|ref|NP_519544.1| PUTATIVE TRANSMEMBRANE PROTEIN [Ral... 94 6e-18
gi|48768209|ref|ZP_00272560.1| COG0330: Membrane protease subuni... 94 7e-18
gi|7716464|gb|AAF68388.1| stomatin-like protein [Zea mays] 93 1e-17
gi|49250398|gb|AAH74573.1| Unknown (protein for MGC:69303) [Xeno... 93 1e-17
gi|29833024|ref|NP_827658.1| hypothetical protein SAV6482 [Strep... 93 1e-17
gi|46141142|ref|ZP_00153014.2| COG0330: Membrane protease subuni... 93 1e-17
gi|48861521|ref|ZP_00315422.1| COG0330: Membrane protease subuni... 93 1e-17
gi|41689141|ref|ZP_00145676.1| COG0330: Membrane protease subuni... 92 2e-17
gi|48893426|ref|ZP_00326662.1| COG0330: Membrane protease subuni... 92 2e-17
gi|28198082|ref|NP_778396.1| inner membrane protein [Xylella fas... 92 2e-17
gi|50876758|emb|CAG36598.1| conserved hypothetical protein [Desu... 92 2e-17
gi|15836790|ref|NP_297478.1| conserved hypothetical protein [Xyl... 92 2e-17
gi|22994319|ref|ZP_00038827.1| COG0330: Membrane protease subuni... 92 2e-17
gi|33592538|ref|NP_880182.1| putative membrane protein [Bordetel... 92 2e-17
gi|22997312|ref|ZP_00041545.1| COG0330: Membrane protease subuni... 92 2e-17
gi|50415100|ref|XP_457451.1| unnamed protein product [Debaryomyc... 91 4e-17
gi|48835422|ref|ZP_00292422.1| COG0330: Membrane protease subuni... 91 5e-17
gi|17229964|ref|NP_486512.1| hypothetical protein [Nostoc sp. PC... 91 5e-17
gi|15894339|ref|NP_347688.1| Membrane protease subunit, stomatin... 91 6e-17
gi|6841440|gb|AAF29073.1| HSPC108 [Homo sapiens] 91 6e-17
gi|34557241|ref|NP_907056.1| conserved hypothetical protein [Wol... 91 6e-17
gi|7305503|ref|NP_038470.1| stomatin (EPB72)-like 2; stomatin-li... 91 6e-17
gi|7513076|pir||T02246 hypothetical protein P1.11659_4 - human >... 91 6e-17
gi|34863672|ref|XP_236297.2| similar to Stomatin-like 1 [Rattus ... 90 8e-17
gi|23126826|ref|ZP_00108710.1| COG0330: Membrane protease subuni... 90 8e-17
gi|28210405|ref|NP_781349.1| conserved protein [Clostridium teta... 90 8e-17
gi|50085990|ref|YP_047500.1| conserved hypothetical protein; put... 90 1e-16
gi|16805265|ref|NP_473293.1| band 7-related protein; conserved p... 90 1e-16
gi|23491123|gb|EAA22734.1| SPFH domain / Band 7 family, putative... 90 1e-16
gi|17231879|ref|NP_488427.1| hypothetical protein [Nostoc sp. PC... 90 1e-16
gi|34867290|ref|XP_216439.2| similar to stomatin-like protein 2 ... 89 1e-16
gi|12963591|ref|NP_075720.1| stomatin-like protein 2 [Mus muscul... 89 1e-16
gi|45521573|ref|ZP_00173092.1| COG0330: Membrane protease subuni... 89 1e-16
gi|34905182|ref|NP_913938.1| P0498E12.9 [Oryza sativa (japonica ... 89 1e-16
gi|25028210|ref|NP_738264.1| conserved hypothetical protein [Cor... 89 1e-16
gi|16329249|ref|NP_439977.1| erthyrocyte band 7 integral membran... 89 1e-16
gi|27382861|ref|NP_774390.1| bll7750 [Bradyrhizobium japonicum U... 89 1e-16
gi|37806149|dbj|BAC99654.1| putative Band 7 protein [Oryza sativ... 89 1e-16
gi|23394406|gb|AAN31491.1| unknown [Phytophthora infestans] 89 1e-16
gi|19552746|ref|NP_600748.1| membrane protease subunit [Coryneba... 89 1e-16
gi|34498383|ref|NP_902598.1| probable stomatin/Mec-2 family prot... 89 2e-16
gi|39595060|emb|CAE70928.1| Hypothetical protein CBG17728 [Caeno... 89 2e-16
gi|33863567|ref|NP_895127.1| Band 7 protein [Prochlorococcus mar... 89 2e-16
gi|37521743|ref|NP_925120.1| hypothetical protein gll2174 [Gloeo... 89 2e-16
gi|12833038|dbj|BAB22363.1| unnamed protein product [Mus musculus] 88 3e-16
gi|15828539|ref|NP_325899.1| conserved hypothetical protein [Myc... 88 4e-16
gi|14603403|gb|AAH10152.1| Stomatin (EPB72)-like 2 [Homo sapiens] 88 4e-16
gi|38233861|ref|NP_939628.1| Putative secreted protein [Coryneba... 87 5e-16
gi|7500183|pir||T21562 hypothetical protein F30A10.5 - Caenorhab... 87 5e-16
gi|32564147|ref|NP_492517.2| STomatin-Like (stl-1) [Caenorhabdit... 87 5e-16
gi|19113548|ref|NP_596756.1| stomatin family; may regulate catio... 87 5e-16
gi|15604196|ref|NP_220711.1| unknown [Rickettsia prowazekii str.... 87 9e-16
gi|21233774|ref|NP_640072.1| hypothetical transmembrane protein ... 86 2e-15
gi|32410015|ref|XP_325488.1| hypothetical protein [Neurospora cr... 86 2e-15
gi|42526219|ref|NP_971317.1| SPFH domain/Band 7 family protein [... 86 2e-15
gi|38107469|gb|EAA53635.1| hypothetical protein MG07912.4 [Magna... 85 3e-15
gi|15892375|ref|NP_360089.1| unknown [Rickettsia conorii str. Ma... 85 3e-15
gi|42453588|ref|ZP_00153495.1| hypothetical protein Rick044401 [... 85 3e-15
gi|20809646|gb|AAH29141.1| NPHS2 protein [Homo sapiens] 84 4e-15
gi|50546423|ref|XP_500681.1| hypothetical protein [Yarrowia lipo... 84 4e-15
gi|23129520|ref|ZP_00111347.1| COG0330: Membrane protease subuni... 84 6e-15
gi|24375615|ref|NP_719658.1| SPFH domain/Band 7 family protein [... 84 8e-15
gi|26991514|ref|NP_746939.1| SPFH domain/Band 7 family protein [... 84 8e-15
gi|46134309|ref|XP_389470.1| hypothetical protein FG09294.1 [Gib... 83 1e-14
gi|49086816|ref|XP_405424.1| hypothetical protein AN1287.2 [Aspe... 82 2e-14
gi|7487517|pir||T05863 hypothetical protein T29A15.70 - Arabidop... 81 4e-14
gi|18310042|ref|NP_561976.1| conserved hypothetical protein [Clo... 81 4e-14
gi|18417021|ref|NP_567778.1| band 7 family protein [Arabidopsis ... 81 4e-14
gi|13471254|ref|NP_102823.1| hypothetical protein mlr1172 [Mesor... 80 8e-14
gi|21233691|ref|NP_639989.1| conserved hypothetical protein [Pro... 80 1e-13
gi|45524135|ref|ZP_00175440.1| COG0330: Membrane protease subuni... 79 2e-13
gi|28788107|gb|AAO46793.1| stomatin-like protein [Leishmania enr... 77 7e-13
gi|50843006|ref|YP_056233.1| conserved protein [Propionibacteriu... 77 9e-13
gi|22957948|ref|ZP_00005632.1| COG0330: Membrane protease subuni... 77 9e-13
gi|15239547|ref|NP_200221.1| band 7 family protein [Arabidopsis ... 77 9e-13
gi|6503224|gb|AAF14646.1| 7138.6 [Leishmania major] 77 9e-13
gi|15600134|ref|NP_253628.1| protease subunit HflC [Pseudomonas ... 75 4e-12
gi|34764231|ref|ZP_00145085.1| STOMATIN LIKE PROTEIN [Fusobacter... 74 8e-12
gi|49083060|gb|AAT50930.1| PA4941 [synthetic construct] 73 1e-11
gi|21554125|gb|AAM63205.1| stomatin-like protein [Arabidopsis th... 72 2e-11
gi|48864288|ref|ZP_00318181.1| COG0330: Membrane protease subuni... 72 2e-11
gi|39936552|ref|NP_948828.1| putative hflC protein [Rhodopseudom... 71 4e-11
gi|39579762|emb|CAE56713.1| Hypothetical protein CBG24499 [Caeno... 71 5e-11
gi|27380740|ref|NP_772269.1| bll5629 [Bradyrhizobium japonicum U... 71 5e-11
gi|48763111|ref|ZP_00267667.1| COG0330: Membrane protease subuni... 70 7e-11
gi|46435803|gb|EAK95177.1| hypothetical protein CaO19.4079 [Cand... 70 9e-11
gi|46435646|gb|EAK95023.1| hypothetical protein CaO19.11560 [Can... 70 9e-11
gi|48732168|ref|ZP_00265911.1| COG0330: Membrane protease subuni... 70 1e-10
gi|26991569|ref|NP_746994.1| HflC protein [Pseudomonas putida KT... 69 1e-10
gi|46120680|ref|ZP_00201785.1| COG0330: Membrane protease subuni... 69 2e-10
gi|21244682|ref|NP_644264.1| conserved hypothetical protein [Xan... 68 3e-10
gi|23104559|ref|ZP_00091023.1| COG0330: Membrane protease subuni... 68 3e-10
gi|23130510|ref|ZP_00112323.1| COG0330: Membrane protease subuni... 68 3e-10
gi|23118383|ref|ZP_00101947.1| COG0330: Membrane protease subuni... 68 4e-10
gi|21233305|ref|NP_639222.1| conserved hypothetical protein [Xan... 67 6e-10
gi|15644567|ref|NP_229620.1| ftsH protease activity modulator Hf... 67 6e-10
gi|42520670|ref|NP_966585.1| hflC protein [Wolbachia endosymbion... 67 6e-10
gi|34500111|gb|AAQ73640.1| stomatin-like protein [Epichloe festu... 67 6e-10
gi|23469907|ref|ZP_00125241.1| COG0330: Membrane protease subuni... 67 7e-10
gi|23473852|ref|ZP_00129147.1| COG0330: Membrane protease subuni... 67 1e-09
gi|15896623|ref|NP_349972.1| Membrane protease subunit, stomatin... 67 1e-09
gi|28872053|ref|NP_794672.1| hflC protein [Pseudomonas syringae ... 66 1e-09
gi|22996792|ref|ZP_00041036.1| COG0330: Membrane protease subuni... 65 2e-09
gi|46143461|ref|ZP_00135198.2| COG0330: Membrane protease subuni... 65 2e-09
gi|22995188|ref|ZP_00039668.1| COG0330: Membrane protease subuni... 65 3e-09
gi|28199506|ref|NP_779820.1| integral membrane proteinase [Xylel... 65 3e-09
gi|15599778|ref|NP_253272.1| conserved hypothetical protein [Pse... 64 6e-09
gi|49089368|gb|AAT51675.1| PA4582 [synthetic construct] 64 6e-09
gi|48850436|ref|ZP_00304678.1| COG0330: Membrane protease subuni... 64 8e-09
gi|46165030|ref|ZP_00138134.2| COG0330: Membrane protease subuni... 64 8e-09
gi|30249263|ref|NP_841333.1| Band 7 protein [Nitrosomonas europa... 63 1e-08
gi|34498768|ref|NP_902983.1| hflC protein [Chromobacterium viola... 63 1e-08
gi|2126562|pir||I39620 hypothetical protein X - Anabaena variabi... 62 2e-08
gi|17228235|ref|NP_484783.1| hypothetical protein [Nostoc sp. PC... 62 2e-08
gi|49475830|ref|YP_033871.1| Protease subunit hflK [Bartonella h... 61 4e-08
gi|48861769|ref|ZP_00315668.1| COG0330: Membrane protease subuni... 61 5e-08
gi|21230509|ref|NP_636426.1| integral membrane proteinase subuni... 60 9e-08
gi|28829318|gb|AAO51860.1| similar to Agrobacterium tumefaciens ... 60 9e-08
gi|21241910|ref|NP_641492.1| integral membrane proteinase subuni... 60 1e-07
gi|49474434|ref|YP_032476.1| Protease subunit hflK [Bartonella q... 60 1e-07
gi|48831374|ref|ZP_00288441.1| COG0330: Membrane protease subuni... 59 2e-07
gi|46316941|ref|ZP_00217519.1| COG0330: Membrane protease subuni... 59 2e-07
gi|48861768|ref|ZP_00315667.1| COG0330: Membrane protease subuni... 59 2e-07
gi|32490934|ref|NP_871188.1| hflK [Wigglesworthia glossinidia en... 59 2e-07
gi|50122852|ref|YP_052019.1| putative phage-related protein [Erw... 57 6e-07
gi|48787768|ref|ZP_00283747.1| COG0330: Membrane protease subuni... 56 2e-06
gi|34527374|dbj|BAC85377.1| unnamed protein product [Homo sapiens] 55 2e-06
gi|38016907|ref|NP_937837.1| stomatin isoform b; erythrocyte mem... 55 3e-06
gi|5689797|emb|CAB52015.1| SLP-1 [Homo sapiens] 55 3e-06
gi|17432225|gb|AAL39002.1| MSTP019 [Homo sapiens] 55 3e-06
gi|15644566|ref|NP_229619.1| ftsH protease activity modulator Hf... 55 4e-06
gi|16120710|ref|NP_404023.1| putative membrane protein [Yersinia... 54 5e-06
gi|21241909|ref|NP_641491.1| integral membrane protease subunit ... 54 6e-06
gi|17986894|ref|NP_539528.1| HFLC PROTEIN [Brucella melitensis 1... 54 8e-06
gi|23502267|ref|NP_698394.1| hflC protein [Brucella suis 1330] >... 54 8e-06
gi|13471473|ref|NP_103039.1| ftsH protease activity modulator hf... 54 8e-06
gi|49474433|ref|YP_032475.1| ftsH protease activity modulator hf... 53 1e-05
gi|24115529|ref|NP_710039.1| protease specific for phage lambda ... 53 1e-05
gi|15804763|ref|NP_290804.1| protease specific for phage lambda ... 53 1e-05
gi|24372196|ref|NP_716238.1| hflK protein [Shewanella oneidensis... 53 1e-05
gi|21230508|ref|NP_636425.1| integral membrane protease subunit ... 52 2e-05
gi|49475829|ref|YP_033870.1| ftsH protease activity modulator hf... 51 4e-05
gi|26251066|ref|NP_757106.1| HflK protein [Escherichia coli CFT0... 51 4e-05
gi|46323591|ref|ZP_00223955.1| COG0330: Membrane protease subuni... 51 5e-05
gi|33519560|ref|NP_878392.1| HflC protein [Candidatus Blochmanni... 51 5e-05
gi|42526840|ref|NP_971938.1| hflK protein, putative [Treponema d... 50 7e-05
gi|33519559|ref|NP_878391.1| HflK protein [Candidatus Blochmanni... 50 9e-05
gi|15615716|ref|NP_244020.1| protease specific for phage lambda ... 50 1e-04
gi|16763182|ref|NP_458799.1| HflK protein [Salmonella enterica s... 50 1e-04
gi|16767609|ref|NP_463224.1| FtsH modulator [Salmonella typhimur... 49 2e-04
gi|45914660|ref|ZP_00196753.1| COG0330: Membrane protease subuni... 49 2e-04
gi|15672721|ref|NP_266895.1| flotillin-like protein [Lactococcus... 49 3e-04
gi|48855051|ref|ZP_00309211.1| COG0330: Membrane protease subuni... 48 4e-04
gi|47933920|gb|AAT39526.1| HflK [Vibrio harveyi] 47 0.001
gi|15601982|ref|NP_245054.1| HflK [Pasteurella multocida Pm70] >... 47 0.001
gi|46143462|ref|ZP_00204479.1| COG0330: Membrane protease subuni... 46 0.002
gi|27364696|ref|NP_760224.1| Membrane protease subunits [Vibrio ... 46 0.002
gi|22957684|ref|ZP_00005377.1| COG0330: Membrane protease subuni... 45 0.002
gi|28899589|ref|NP_799194.1| HflK protein [Vibrio parahaemolytic... 45 0.002
gi|23467994|ref|ZP_00123568.1| COG0330: Membrane protease subuni... 45 0.002
gi|23112975|ref|ZP_00098394.1| COG0330: Membrane protease subuni... 45 0.003
gi|48729060|ref|ZP_00262812.1| COG0330: Membrane protease subuni... 45 0.003
gi|21325840|dbj|BAC00461.1| Membrane protease subunits, stomatin... 45 0.004
gi|19554257|ref|NP_602259.1| hypothetical protein NCgl2962 [Cory... 45 0.004
gi|16272119|ref|NP_438321.1| HflK [Haemophilus influenzae Rd KW2... 44 0.005
gi|45914727|ref|ZP_00196789.1| COG0330: Membrane protease subuni... 44 0.005
gi|29376335|ref|NP_815489.1| SPFH domain/Band 7 family protein [... 44 0.007
gi|6563242|gb|AAF17215.1| flotillin [Homo sapiens] 44 0.007
gi|16120147|ref|NP_395735.1| Vng6208c [Halobacterium sp. NRC-1] ... 44 0.007
gi|5114049|gb|AAD40192.1| flotillin [Homo sapiens] 44 0.007
gi|30584549|gb|AAP36527.1| Homo sapiens flotillin 1 [synthetic c... 43 0.011
gi|26985229|gb|AAN86279.1| flotillin 1c [Xenopus laevis] 43 0.011
gi|5031699|ref|NP_005794.1| flotillin 1 [Homo sapiens] >gnl|BL_O... 43 0.011
gi|38502931|sp|Q7YR41|FLT1_PANTR Flotillin-1 >gnl|BL_ORD_ID|1842... 43 0.011
gi|41529176|dbj|BAD08436.1| flotillin 1 [Sus scrofa] 43 0.011
gi|48146009|emb|CAG33227.1| FLOT1 [Homo sapiens] 43 0.011
gi|37528398|ref|NP_931743.1| protease specific for phage lambda ... 43 0.015
gi|33152817|ref|NP_874170.1| HflK protein [Haemophilus ducreyi 3... 42 0.019
gi|46914869|emb|CAG21646.1| putative Membrane protease subunits ... 42 0.019
gi|15603999|ref|NP_220514.1| HFLK PROTEIN (hflK) [Rickettsia pro... 42 0.025
gi|15617159|ref|NP_240372.1| HflK protein [Buchnera aphidicola s... 42 0.033
gi|23098338|ref|NP_691804.1| hypothetical protein OB0883 [Oceano... 41 0.043
gi|24372040|ref|NP_716082.1| hflC protein, putative [Shewanella ... 41 0.043
gi|17986893|ref|NP_539527.1| HFLK PROTEIN [Brucella melitensis 1... 41 0.043
gi|24114188|ref|NP_708698.1| putative SPFH domain protein [Shige... 41 0.057
gi|26985225|gb|AAN86277.1| flotillin 1a [Xenopus laevis] 41 0.057
gi|26985227|gb|AAN86278.1| flotillin 1b [Xenopus laevis] >gnl|BL... 41 0.057
gi|24899156|dbj|BAC23092.1| podocin [Rattus norvegicus] 41 0.057
gi|27904984|ref|NP_778110.1| HflC [Buchnera aphidicola (Baizongi... 40 0.074
gi|37726926|gb|AAO39406.1| flotillin-1 [Mus musculus] 40 0.097
gi|12083663|ref|NP_073192.1| flotillin 1 [Rattus norvegicus] >gn... 40 0.097
gi|27694658|gb|AAH43770.1| Flot2-prov protein [Xenopus laevis] 40 0.097
gi|6679809|ref|NP_032053.1| flotillin 1 [Mus musculus] >gnl|BL_O... 40 0.097
gi|13124118|sp|Q9Z1E1|FLT1_RAT Flotillin-1 (Reggie-2) (REG-2) >g... 40 0.097
gi|48855519|ref|ZP_00309678.1| COG2268: Uncharacterized protein ... 39 0.16
gi|50758238|ref|XP_415825.1| PREDICTED: similar to Flotillin-2 (... 39 0.16
gi|33866441|ref|NP_898000.1| Band 7 family protein [Synechococcu... 39 0.16
gi|23502268|ref|NP_698395.1| hflK protein [Brucella suis 1330] >... 39 0.16
gi|12835861|dbj|BAB23392.1| unnamed protein product [Mus musculus] 39 0.22
gi|26326187|dbj|BAC26837.1| unnamed protein product [Mus musculus] 39 0.22
gi|13124119|sp|Q9Z2S9|FLT2_RAT Flotillin-2 (Reggie-1) (REG-1) >g... 39 0.22
gi|13277550|gb|AAH03683.1| Similar to flotillin 2 [Homo sapiens] 39 0.22
gi|13124169|sp|O13127|FLT1_CARAU Flotillin-1 (Reggie-2) (REG-2) ... 39 0.22
gi|26249352|ref|NP_755392.1| Hypothetical protein [Escherichia c... 39 0.28
gi|32265949|ref|NP_859981.1| conserved hypothetical protein [Hel... 39 0.28
gi|47223729|emb|CAF98499.1| unnamed protein product [Tetraodon n... 38 0.37
gi|15597634|ref|NP_251128.1| hypothetical protein [Pseudomonas a... 38 0.37
gi|47213568|emb|CAF95550.1| unnamed protein product [Tetraodon n... 38 0.48
gi|33416684|gb|AAH56051.1| Elk3-prov protein [Xenopus laevis] 38 0.48
gi|34556544|ref|NP_906359.1| conserved hypothetical protein [Wol... 38 0.48
gi|33239932|ref|NP_874874.1| Membrane protease subunits [Prochlo... 37 0.63
gi|33863180|ref|NP_894740.1| Band 7 protein [Prochlorococcus mar... 37 0.63
gi|10880776|gb|AAG24386.1| epidermal growth factor receptor [Mus... 37 0.82
gi|1071851|pir||A53183 epidermal growth factor receptor precurso... 37 0.82
gi|46560582|ref|NP_997538.1| epidermal growth factor receptor is... 37 0.82
gi|458124|gb|AAA17899.1| EGF receptor 37 0.82
gi|11055360|gb|AAG28046.1| epidermal growth factor receptor isof... 37 0.82
gi|46193117|ref|ZP_00005376.2| COG0330: Membrane protease subuni... 37 0.82
gi|46313764|ref|ZP_00214352.1| COG0330: Membrane protease subuni... 37 0.82
gi|50804|emb|CAA42219.1| EGF-receptor [Mus musculus] 37 0.82
gi|23473853|ref|ZP_00129148.1| COG0330: Membrane protease subuni... 37 0.82
gi|48097857|ref|XP_391959.1| similar to prohibitin protein Wph [... 37 0.82
gi|14043050|gb|AAG17037.2| epidermal growth factor receptor rela... 37 0.82
gi|6681283|ref|NP_031938.1| epidermal growth factor receptor iso... 37 0.82
gi|15241424|ref|NP_199227.1| prohibitin, putative [Arabidopsis t... 37 1.1
gi|6635079|emb|CAB64584.1| hypothetical protein L391.07 [Leishma... 37 1.1
gi|13124175|sp|O42305|FLT2_CARAU Flotillin-2 (Reggie-1) (REG-1) ... 37 1.1
gi|27801599|emb|CAD60636.1| SI:dZ44O19.1 (novel flotillin) [Dani... 37 1.1
gi|42780655|ref|NP_977902.1| hypothetical protein BCE1580 [Bacil... 37 1.1
gi|47216879|emb|CAG11686.1| unnamed protein product [Tetraodon n... 37 1.1
gi|15791639|ref|NP_281462.1| putative transmembrane protein [Cam... 37 1.1
gi|41055331|ref|NP_956933.1| hypothetical protein MGC64103 [Dani... 36 1.4
gi|29409366|gb|AAM29179.1| prohibitin protein Wph [Triticum aest... 36 1.4
gi|29436776|gb|AAH49425.1| Flot1b protein [Danio rerio] 36 1.8
gi|41393077|ref|NP_958864.1| flotillin 1b [Danio rerio] >gnl|BL_... 36 1.8
gi|29349628|ref|NP_813131.1| flotillin-like protein [Bacteroides... 36 1.8
gi|12751187|gb|AAK07567.1| reggie 2b [Danio rerio] 36 1.8
gi|22971839|ref|ZP_00018759.1| hypothetical protein [Chloroflexu... 36 1.8
gi|12751189|gb|AAK07568.1| reggie 2b [Carassius auratus] 35 2.4
gi|48428145|sp|Q98TZ8|FLT2_BRARE Flotillin-2a (Reggie-1a) (REG-1) 35 2.4
gi|13929186|ref|NP_114018.1| flotillin 2; reggie1-1 [Rattus norv... 35 2.4
gi|12751181|gb|AAK07564.1| reggie 1a [Danio rerio] 35 2.4
gi|50428673|gb|AAT77024.1| putative prohibitin [Oryza sativa (ja... 35 3.1
gi|31202785|ref|XP_310341.1| ENSANGP00000015278 [Anopheles gambi... 35 3.1
gi|31202089|ref|XP_309992.1| ENSANGP00000022464 [Anopheles gambi... 35 4.1
gi|22970131|ref|ZP_00017276.1| hypothetical protein [Chloroflexu... 34 5.3
gi|4097589|gb|AAD00120.1| R-Reggie-1.1 34 5.3
gi|6679811|ref|NP_032054.1| flotillin 2 [Mus musculus] >gnl|BL_O... 34 5.3
gi|4079713|gb|AAC98729.1| reggie1-4 [Rattus norvegicus] 34 5.3
gi|47125519|gb|AAH70423.1| Flot2 protein [Mus musculus] 34 5.3
gi|4758394|ref|NP_004466.1| flotillin 2; Flotillin 2 (epidermal ... 34 5.3
gi|28378379|ref|NP_785271.1| integral membrane protein [Lactobac... 34 5.3
gi|12751183|gb|AAK07565.1| reggie 1b [Carassius auratus] 34 5.3
gi|24642061|ref|NP_727812.1| CG32593-PC [Drosophila melanogaster... 34 6.9
gi|24642031|ref|NP_511157.2| CG32593-PB [Drosophila melanogaster... 34 6.9
gi|2055454|gb|AAB53231.1| prohibitin-like molecule TC-PRO-1 [Tox... 34 6.9
gi|25395621|pir||E88320 protein F07A11.6 [imported] - Caenorhabd... 34 6.9
gi|7498509|pir||T20532 hypothetical protein F07A11.6b - Caenorha... 34 6.9
gi|7498508|pir||T20531 hypothetical protein F07A11.6a - Caenorha... 34 6.9
gi|32563716|ref|NP_496484.2| RNA-binding region RNP-1 family mem... 34 6.9
gi|24642027|ref|NP_727797.1| CG32593-PA [Drosophila melanogaster... 34 6.9
gi|7499671|pir||T21276 hypothetical protein F22E12.4 - Caenorhab... 34 6.9
gi|25152823|ref|NP_741621.1| EGg Laying defective EGL-9, protein... 34 6.9
gi|46434118|gb|EAK93537.1| hypothetical protein CaO19.14206 [Can... 33 9.1
gi|47228368|emb|CAG07763.1| unnamed protein product [Tetraodon n... 33 9.1
gi|47085803|ref|NP_998240.1| zgc:55821 [Danio rerio] >gnl|BL_ORD... 33 9.1
>gi|17569501|ref|NP_510715.1| stomatin (sto-5) [Caenorhabditis
elegans]
gi|15150676|gb|AAK85483.1| Stomatin protein 5, isoform a
[Caenorhabditis elegans]
Length = 367
Score = 657 bits (1696), Expect = 0.0
Identities = 340/367 (92%), Positives = 340/367 (92%)
Frame = -1
Query: 1104 MSATERRQRIMRRIHTLQSEDTGYSNEGSLSRRSSTASVKDETASAPPSASINPNLLFVP 925
MSATERRQRIMRRIHTLQSEDTGYSNEGSLSRRSSTASVKDETASAPPSASINPNLLFVP
Sbjct: 1 MSATERRQRIMRRIHTLQSEDTGYSNEGSLSRRSSTASVKDETASAPPSASINPNLLFVP 60
Query: 924 DIRSLGLDRGEVPPHKRDAIEKIPMRARSQSWLIRTRHLLHEEREPPPLISHMMXXXXXX 745
DIRSLGLDRGEVPPHKRDAIEKIPMRARSQSWLIRTRHLLHEEREPPPLISHMM
Sbjct: 61 DIRSLGLDRGEVPPHKRDAIEKIPMRARSQSWLIRTRHLLHEEREPPPLISHMMLIFSFL 120
Query: 744 XXXXXFPWCLFFCVKVVKEYQRAVIFRLGRLIKGGTKGPGLFFVLPCIDTMKIVDLRVLS 565
FPWCLFFCVKVVKEYQRAVIFRLGRLIKGGTKGPGLFFVLPCIDTMKIVDLRVLS
Sbjct: 121 LILLSFPWCLFFCVKVVKEYQRAVIFRLGRLIKGGTKGPGLFFVLPCIDTMKIVDLRVLS 180
Query: 564 FDVPPQEILSRDSVTVSVEAVIYFRVSNPVISVTNVNDAQFSTRLLAQTTLRNVLGTKTL 385
FDVPPQEILSRDSVTVSVEAVIYFRVSNPVISVTNVNDAQFSTRLLAQTTLRNVLGTKTL
Sbjct: 181 FDVPPQEILSRDSVTVSVEAVIYFRVSNPVISVTNVNDAQFSTRLLAQTTLRNVLGTKTL 240
Query: 384 SEMLSERDAIASISEKVLDEGTDPWGVKVERVEIKDIRLPHQLMRSMXXXXXXXXXXXXX 205
SEMLSERDAIASISEKVLDEGTDPWGVKVERVEIKDIRLPHQLMRSM
Sbjct: 241 SEMLSERDAIASISEKVLDEGTDPWGVKVERVEIKDIRLPHQLMRSMAAKAEAVRRARAA 300
Query: 204 XXXAQGEKDASESLQTAADTIAQNKMTIQLRYLQTLTKISAQRNNTIVMPYPIEVAKHYM 25
AQGEKDASESLQTAADTIAQNKMTIQLRYLQTLTKISAQRNNTIVMPYPIEVAKHYM
Sbjct: 301 IIAAQGEKDASESLQTAADTIAQNKMTIQLRYLQTLTKISAQRNNTIVMPYPIEVAKHYM 360
Query: 24 KKFHQKS 4
KKFHQKS
Sbjct: 361 KKFHQKS 367