Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F36F12_5
         (672 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb...   392   e-108
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb...   357   9e-98
gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 k...   158   1e-37
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur...   157   1e-37
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno...   156   3e-37
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb...   155   7e-37
gi|17511037|ref|NP_492866.1| c-type lectin precursor family memb...   155   9e-37
gi|39580389|emb|CAE70948.1| Hypothetical protein CBG17758 [Caeno...   150   2e-35
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb...   150   2e-35
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family...   149   5e-35
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb...   141   1e-32
gi|17536863|ref|NP_494583.1| c-type lectin family member (2D865)...   140   2e-32
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family...   140   2e-32
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab...   139   4e-32
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor...   139   4e-32
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ...   139   4e-32
gi|17509255|ref|NP_493210.1| c-type lectin family member (1N275)...   135   7e-31
gi|17536865|ref|NP_494582.1| c-type lectin family member (2D863)...   133   3e-30
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family...   133   4e-30
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)...   132   8e-30
gi|17536861|ref|NP_494585.1| c-type lectin family member (2D867)...   130   2e-29
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi...   129   5e-29
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family...   127   2e-28
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur...   127   3e-28
gi|39592415|emb|CAE63492.1| Hypothetical protein CBG07961 [Caeno...   126   3e-28
gi|17511043|ref|NP_492871.1| chondroitin sulfate proteoglycan 3 ...   125   6e-28
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb...   125   8e-28
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur...   125   1e-27
gi|17561202|ref|NP_507305.1| predicted CDS, low affinity IgE Fc ...   123   3e-27
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k...   123   3e-27
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae...   122   5e-27
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno...   122   8e-27
gi|17561204|ref|NP_507306.1| predicted CDS, low affinity IgE Fc ...   120   3e-26
gi|17558364|ref|NP_507555.1| predicted CDS, c-type lectin family...   117   2e-25
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno...   117   2e-25
gi|17560214|ref|NP_507154.1| predicted CDS, c-type lectin precur...   114   1e-24
gi|17536551|ref|NP_496528.1| c-type lectin precursor family memb...   113   4e-24
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb...   113   4e-24
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno...   110   2e-23
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno...   110   3e-23
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam...   107   2e-22
gi|17560612|ref|NP_507185.1| predicted CDS, putative secreted or...   107   3e-22
gi|39580387|emb|CAE70946.1| Hypothetical protein CBG17755 [Caeno...   106   5e-22
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6...   104   1e-21
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno...   101   2e-20
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family...   100   3e-20
gi|39580388|emb|CAE70947.1| Hypothetical protein CBG17757 [Caeno...   100   4e-20
gi|39592429|emb|CAE63506.1| Hypothetical protein CBG07983 [Caeno...    99   6e-20
gi|17510251|ref|NP_492880.1| predicted CDS, c-type lectin precur...    98   2e-19
gi|39592448|emb|CAE63525.1| Hypothetical protein CBG08004 [Caeno...    98   2e-19
gi|17536719|ref|NP_493771.1| c-type lectin family member (2A900)...    97   2e-19
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family...    96   6e-19
gi|17510207|ref|NP_492857.1| c-type lectin family member (1L607)...    94   2e-18
gi|39592447|emb|CAE63524.1| Hypothetical protein CBG08003 [Caeno...    94   3e-18
gi|17509827|ref|NP_493289.1| c-type lectin precursor family memb...    92   7e-18
gi|25395485|pir||C88102 protein W09G10.6 [imported] - Caenorhabd...    91   2e-17
gi|39590393|emb|CAE66132.1| Hypothetical protein CBG11356 [Caeno...    90   4e-17
gi|17539324|ref|NP_503089.1| putative protein family member, wit...    87   2e-16
gi|39590141|emb|CAE61139.1| Hypothetical protein CBG04901 [Caeno...    87   3e-16
gi|39580384|emb|CAE70943.1| Hypothetical protein CBG17751 [Caeno...    87   3e-16
gi|39592405|emb|CAE63482.1| Hypothetical protein CBG07950 [Caeno...    87   4e-16
gi|39592428|emb|CAE63505.1| Hypothetical protein CBG07982 [Caeno...    86   5e-16
gi|17544386|ref|NP_502991.1| c-type lectin precursor family memb...    85   1e-15
gi|17509731|ref|NP_493248.1| c-type lectin precursor family memb...    85   1e-15
gi|39590136|emb|CAE61134.1| Hypothetical protein CBG04895 [Caeno...    84   2e-15
gi|17565896|ref|NP_503376.1| predicted CDS, c-type lectin family...    84   3e-15
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb...    83   4e-15
gi|39590134|emb|CAE61132.1| Hypothetical protein CBG04893 [Caeno...    83   6e-15
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno...    82   7e-15
gi|33300606|emb|CAE17978.1| Hypothetical protein Y18D10A.24 [Cae...    81   2e-14
gi|17560038|ref|NP_507097.1| c-type lectin family member (5Q715)...    80   4e-14
gi|17506689|ref|NP_493310.1| putative protein family member (1N7...    78   2e-13
gi|39590137|emb|CAE61135.1| Hypothetical protein CBG04896 [Caeno...    77   4e-13
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa...    77   4e-13
gi|17566540|ref|NP_507917.1| predicted CDS, putative protein fam...    76   5e-13
gi|39580257|emb|CAE69649.1| Hypothetical protein CBG15894 [Caeno...    76   5e-13
gi|39585190|emb|CAE57433.1| Hypothetical protein CBG00394 [Caeno...    75   9e-13
gi|39590135|emb|CAE61133.1| Hypothetical protein CBG04894 [Caeno...    75   9e-13
gi|39585189|emb|CAE57432.1| Hypothetical protein CBG00393 [Caeno...    75   9e-13
gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)...    74   2e-12
gi|39590099|emb|CAE61097.1| Hypothetical protein CBG04852 [Caeno...    74   3e-12
gi|17559102|ref|NP_505754.1| predicted CDS, c-type lectin family...    74   3e-12
gi|39591539|emb|CAE71115.1| Hypothetical protein CBG17968 [Caeno...    73   6e-12
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno...    73   6e-12
gi|39592446|emb|CAE63523.1| Hypothetical protein CBG08002 [Caeno...    72   8e-12
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno...    72   1e-11
gi|17510429|ref|NP_493430.1| predicted CDS, c-type lectin family...    72   1e-11
gi|17566546|ref|NP_507913.1| c-type lectin precursor family memb...    72   1e-11
gi|17539326|ref|NP_503090.1| versican family member, possibly N-...    71   2e-11
gi|17560662|ref|NP_507006.1| c-type lectin family member (5Q453)...    71   2e-11
gi|39579666|emb|CAE56464.1| Hypothetical protein CBG24174 [Caeno...    68   1e-10
gi|39591537|emb|CAE71113.1| Hypothetical protein CBG17966 [Caeno...    66   5e-10
gi|17566100|ref|NP_507868.1| c-type lectin family member (5U452)...    65   1e-09
gi|39590447|emb|CAE66187.1| Hypothetical protein CBG11425 [Caeno...    63   5e-09
gi|17544382|ref|NP_502990.1| predicted CDS, c-type lectin family...    62   8e-09
gi|7497627|pir||T20046 hypothetical protein C49A1.9 - Caenorhabd...    62   1e-08
gi|17506151|ref|NP_493484.1| predicted CDS, putative protein fam...    62   1e-08
gi|17562684|ref|NP_507837.1| putative protein family member (5U2...    62   1e-08
gi|39590140|emb|CAE61138.1| Hypothetical protein CBG04899 [Caeno...    61   2e-08
gi|17565952|ref|NP_507583.1| c-type lectin precursor family memb...    60   3e-08
gi|17531917|ref|NP_494490.1| putative protein family member (2D5...    59   9e-08
gi|17553180|ref|NP_498001.1| predicted CDS, c-type lectin family...    59   1e-07
gi|39590143|emb|CAE61141.1| Hypothetical protein CBG04903 [Caeno...    58   1e-07
gi|39589078|emb|CAE57810.1| Hypothetical protein CBG00834 [Caeno...    58   1e-07
gi|17511041|ref|NP_492870.1| putative secreted or extracellular ...    58   1e-07
gi|17542442|ref|NP_501639.1| putative protein (4K93) [Caenorhabd...    58   2e-07
gi|17559100|ref|NP_505753.1| putative protein family member (5L2...    58   2e-07
gi|17510431|ref|NP_493431.1| putative endoplasmic reticulum prot...    57   3e-07
gi|39591912|emb|CAE75132.1| Hypothetical protein CBG23060 [Caeno...    56   6e-07
gi|17508069|ref|NP_493489.1| c-type lectin family member (1O843)...    56   6e-07
gi|17544394|ref|NP_502996.1| c-type lectin family member (4R777)...    56   6e-07
gi|17540278|ref|NP_502932.1| predicted CDS, c-type lectin family...    54   2e-06
gi|17539148|ref|NP_501134.1| c-type lectin family member (4H948)...    54   3e-06
gi|39583006|emb|CAE71785.1| Hypothetical protein CBG18789 [Caeno...    54   4e-06
gi|17553034|ref|NP_497946.1| c-type lectin precursor family memb...    53   5e-06
gi|17553030|ref|NP_497945.1| c-type lectin family member (3F723)...    53   6e-06
gi|39579641|emb|CAE56640.1| Hypothetical protein CBG24401 [Caeno...    53   6e-06
gi|33300499|emb|CAE18002.1| Hypothetical protein Y51A2A.11 [Caen...    50   4e-05
gi|39579554|emb|CAE56072.1| Hypothetical protein CBG23650 [Caeno...    50   4e-05
gi|17507421|ref|NP_493450.1| putative protein family member (1O6...    50   5e-05
gi|39583395|emb|CAE66370.1| Hypothetical protein CBG11629 [Caeno...    49   1e-04
gi|17544442|ref|NP_503021.1| predicted CDS, putative protein fam...    48   2e-04
gi|17559816|ref|NP_505795.1| c-type lectin precursor family memb...    48   2e-04
gi|39583394|emb|CAE66369.1| Hypothetical protein CBG11628 [Caeno...    48   2e-04
gi|17554888|ref|NP_497956.1| predicted CDS, c-type lectin family...    47   3e-04
gi|17506693|ref|NP_493312.1| putative protein family member (1N7...    47   3e-04
gi|39587016|emb|CAE62951.1| Hypothetical protein CBG07164 [Caeno...    45   0.001
gi|17557544|ref|NP_505863.1| putative protein family member (5L7...    45   0.002
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb...    44   0.002
gi|32697984|emb|CAB02800.2| Hypothetical protein C29F3.4 [Caenor...    44   0.002
gi|17563062|ref|NP_506460.1| predicted CDS, putative protein fam...    44   0.003
gi|17543488|ref|NP_500445.1| c-type lectin family member (65.9 k...    44   0.003
gi|17541614|ref|NP_502826.1| putative secreted or extracellular ...    44   0.004
gi|17540466|ref|NP_500450.1| c-type lectin family member (65.9 k...    43   0.005
gi|17562694|ref|NP_507835.1| putative protein (5U249) [Caenorhab...    43   0.005
gi|17561852|ref|NP_506804.1| predicted CDS, c-type lectin family...    42   0.008
gi|17558760|ref|NP_504967.1| predicted CDS, putative cytoplasmic...    42   0.011
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno...    42   0.011
gi|17565266|ref|NP_507666.1| predicted CDS, c-type lectin family...    42   0.014
gi|17553032|ref|NP_497944.1| predicted CDS, c-type lectin family...    42   0.014
gi|33300312|emb|CAE17891.1| Hypothetical protein M199.6 [Caenorh...    42   0.014
gi|39582517|emb|CAE65604.1| Hypothetical protein CBG10625 [Caeno...    41   0.019
gi|39580256|emb|CAE69648.1| Hypothetical protein CBG15893 [Caeno...    41   0.019
gi|47225069|emb|CAF97484.1| unnamed protein product [Tetraodon n...    40   0.032
gi|39580171|emb|CAE56379.1| Hypothetical protein CBG24059 [Caeno...    40   0.042
gi|39587015|emb|CAE62950.1| Hypothetical protein CBG07163 [Caeno...    40   0.042
gi|17506147|ref|NP_493487.1| predicted CDS, putative protein fam...    40   0.054
gi|17565950|ref|NP_507582.1| predicted CDS, putative protein fam...    39   0.071
gi|17558310|ref|NP_506808.1| c-type lectin precursor family memb...    39   0.093
gi|39580589|emb|CAE70485.1| Hypothetical protein CBG17082 [Caeno...    39   0.093
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n...    39   0.12
gi|39584131|emb|CAE61506.1| Hypothetical protein CBG05405 [Caeno...    39   0.12
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno...    39   0.12
gi|17539582|ref|NP_500691.1| predicted CDS, putative protein fam...    38   0.16
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans]        38   0.16
gi|39581281|emb|CAE60027.1| Hypothetical protein CBG03533 [Caeno...    38   0.21
gi|47214539|emb|CAG04559.1| unnamed protein product [Tetraodon n...    38   0.21
gi|34864835|ref|XP_217657.2| similar to bA338L11.1 (novel CUB do...    37   0.27
gi|47219432|emb|CAG10796.1| unnamed protein product [Tetraodon n...    37   0.27
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno...    37   0.27
gi|39582793|emb|CAE74256.1| Hypothetical protein CBG21945 [Caeno...    37   0.46
gi|17531337|ref|NP_493698.1| c-type lectin precursor family memb...    36   0.60
gi|39588191|emb|CAE68116.1| Hypothetical protein CBG13759 [Caeno...    36   0.79
gi|17539578|ref|NP_500693.1| predicted CDS, putative nuclear pro...    35   1.0
gi|17565058|ref|NP_507829.1| versican precursor family member (3...    35   1.3
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb...    35   1.3
gi|17543706|ref|NP_499975.1| c-type lectin family member (4B469)...    35   1.3
gi|20977545|ref|NP_624360.1| chondrolectin [Mus musculus] >gnl|B...    35   1.3
gi|42526246|ref|NP_971344.1| hypothetical protein TDE0732 [Trepo...    35   1.8
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;...    35   1.8
gi|17559330|ref|NP_504977.1| c-type lectin precursor family memb...    35   1.8
gi|17544698|ref|NP_502451.1| phospholipase A2 receptor precursor...    35   1.8
gi|17558312|ref|NP_506807.1| c-type lectin family member (5P828)...    34   2.3
gi|17540122|ref|NP_501229.1| c-type lectin superfamily like (4I3...    34   2.3
gi|48844058|ref|ZP_00298400.1| COG1804: Predicted acyl-CoA trans...    34   2.3
gi|33243092|gb|AAQ01216.1| C-type lectin CTL-27 [Echis ocellatus]      34   2.3
gi|25396647|pir||H88733 protein F32E10.3 [imported] - Caenorhabd...    34   2.3
gi|26326981|dbj|BAC27234.1| unnamed protein product [Mus musculus]     34   3.0
gi|26345454|dbj|BAC36378.1| unnamed protein product [Mus musculus]     34   3.0
gi|1083928|pir||JP0075 lectin CEL-IV, C-type - Cucumaria echinat...    34   3.0
gi|27670608|ref|XP_221686.1| similar to c-type lectin protein MT...    34   3.0
gi|12851982|dbj|BAB29226.1| unnamed protein product [Mus musculus]     34   3.0
gi|17557916|ref|NP_507547.1| versican precursor family member (5...    33   3.9
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n...    33   3.9
gi|17539972|ref|NP_502157.1| predicted CDS, putative protein fam...    33   3.9
gi|37182231|gb|AAQ88918.1| RPGT208 [Homo sapiens]                      33   3.9
gi|39581146|emb|CAE71003.1| Hypothetical protein CBG17839 [Caeno...    33   3.9
gi|17559882|ref|NP_504948.1| predicted CDS, putative protein (5I...    33   3.9
gi|19263589|gb|AAH25407.1| Layilin [Homo sapiens]                      33   3.9
gi|16550435|dbj|BAB70978.1| unnamed protein product [Homo sapiens]     33   3.9
gi|30520331|ref|NP_849156.1| layilin [Homo sapiens] >gnl|BL_ORD_...    33   3.9
gi|39579486|emb|CAE56876.1| Hypothetical protein CBG24712 [Caeno...    33   3.9
gi|37993395|gb|AAR06853.1| C-type lectin-3 [Bitis gabonica]            33   3.9
gi|47216228|emb|CAG01262.1| unnamed protein product [Tetraodon n...    33   3.9
gi|50729858|ref|XP_416682.1| PREDICTED: similar to Chondrolectin...    33   5.1
gi|45382743|ref|NP_990815.1| hepatic lectin [Gallus gallus] >gnl...    33   5.1
gi|24583858|ref|NP_723732.1| CG31860-PA [Drosophila melanogaster...    33   5.1
gi|39588702|emb|CAE58226.1| Hypothetical protein CBG01323 [Caeno...    33   5.1
gi|39587019|emb|CAE62954.1| Hypothetical protein CBG07168 [Caeno...    33   5.1
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le...    33   5.1
gi|1839442|gb|AAB47093.1| platelet glycoprotein Ib-binding prote...    33   5.1
gi|50750535|ref|XP_422038.1| PREDICTED: similar to Lymphocyte an...    33   5.1
gi|17539580|ref|NP_500692.1| predicted CDS, putative protein fam...    33   5.1
gi|17532969|ref|NP_494362.1| putative mitochondrial protein (2D6...    33   5.1
gi|17531799|ref|NP_494750.1| putative protein family member (2E5...    33   5.1
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe...    33   6.7
gi|39587765|emb|CAE67783.1| Hypothetical protein CBG13359 [Caeno...    33   6.7
gi|27734229|sp|P81509|CHBB_CROHO CHH-B beta subunit                    33   6.7
gi|10434231|dbj|BAB14181.1| unnamed protein product [Homo sapien...    32   8.7
gi|17557350|ref|NP_506271.1| c-type lectin and CUB domain contai...    32   8.7
gi|32450776|gb|AAP41219.2| echicetin B-chain [Echis carinatus]         32   8.7
gi|40889261|pdb|1OZ7|B Chain B, Crystal Structure Of Echicetin F...    32   8.7
gi|34498980|ref|NP_903195.1| acid phosphatase [Chromobacterium v...    32   8.7
gi|20127636|ref|NP_079220.2| chondrolectin precursor; transmembr...    32   8.7
gi|31075306|gb|AAP43902.1| chondrolectin variant CHODLdeltaE [Ho...    32   8.7
gi|17535979|ref|NP_494826.1| phospholipase a2 receptor precursor...    32   8.7
gi|31075310|gb|AAP43904.1| chondrolectin variant CHODLFdeltaE [H...    32   8.7
gi|46136765|ref|XP_390074.1| hypothetical protein FG09898.1 [Gib...    32   8.7


>gi|17560636|ref|NP_503568.1| c-type lectin precursor family member
           (5C575) [Caenorhabditis elegans]
 gi|7500629|pir||T33193 hypothetical protein F36F12.5 -
           Caenorhabditis elegans
 gi|3193173|gb|AAC19204.1| Hypothetical protein F36F12.5
           [Caenorhabditis elegans]
          Length = 223

 Score =  392 bits (1008), Expect = e-108
 Identities = 191/213 (89%), Positives = 191/213 (89%)
 Frame = +1

Query: 31  STTYGIDFSDSSESCEDXXXXXXXXXXXXXXXXXXXXXXVCDAGWKFFSRPSGGWCIRVF 210
           STTYGIDFSDSSESCED                      VCDAGWKFFSRPSGGWCIRVF
Sbjct: 11  STTYGIDFSDSSESCEDGGRGGHNHGRPPRPPGNGGGGRVCDAGWKFFSRPSGGWCIRVF 70

Query: 211 AGRLGRDSANQACATQGGVLSGMQNVEEINYIVSQSLSVISPARSGGVWVGARRRPACIS 390
           AGRLGRDSANQACATQGGVLSGMQNVEEINYIVSQSLSVISPARSGGVWVGARRRPACIS
Sbjct: 71  AGRLGRDSANQACATQGGVLSGMQNVEEINYIVSQSLSVISPARSGGVWVGARRRPACIS 130

Query: 391 SGITATCTKTNSFYWTDNSATGINGMLFTNGEPNNGGVKLDQDCALLTVASTPVVFNKFR 570
           SGITATCTKTNSFYWTDNSATGINGMLFTNGEPNNGGVKLDQDCALLTVASTPVVFNKFR
Sbjct: 131 SGITATCTKTNSFYWTDNSATGINGMLFTNGEPNNGGVKLDQDCALLTVASTPVVFNKFR 190

Query: 571 TGQMDDVPCTWQDPTPTADKANKGYVCGKKARR 669
           TGQMDDVPCTWQDPTPTADKANKGYVCGKKARR
Sbjct: 191 TGQMDDVPCTWQDPTPTADKANKGYVCGKKARR 223




[DB home][top]