Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F36A4_6
(954 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33) [... 192 7e-48
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e... 164 4e-39
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno... 110 6e-23
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl... 110 6e-23
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >... 110 6e-23
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 102 1e-20
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 102 1e-20
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 102 1e-20
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 102 2e-20
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 100 6e-20
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 100 6e-20
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 100 6e-20
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 99 1e-19
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 99 2e-19
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 99 2e-19
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 98 2e-19
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno... 87 6e-16
gi|17561476|ref|NP_505888.1| COLlagen structural gene (col-155) ... 82 2e-14
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ... 81 4e-14
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 79 2e-13
gi|39580360|emb|CAE61465.1| Hypothetical protein CBG05357 [Caeno... 77 6e-13
gi|39592242|emb|CAE75463.1| Hypothetical protein CBG23461 [Caeno... 76 1e-12
gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT... 75 2e-12
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-... 75 2e-12
gi|687634|gb|AAA62504.1| collagen 75 3e-12
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 74 4e-12
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno... 74 6e-12
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno... 73 1e-11
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ... 71 3e-11
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno... 71 3e-11
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 69 2e-10
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 69 2e-10
gi|17539418|ref|NP_501561.1| COLlagen structural gene (col-119) ... 68 3e-10
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 68 3e-10
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 68 3e-10
gi|17551424|ref|NP_510247.1| COLlagen structural gene (col-183) ... 67 8e-10
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 67 8e-10
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 67 8e-10
gi|1184072|gb|AAC47437.1| COL-1 66 1e-09
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno... 65 3e-09
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ... 65 3e-09
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 64 4e-09
gi|1589837|gb|AAC48358.1| cuticle preprocollagen [Meloidogyne in... 64 5e-09
gi|115397|sp|P08124|CC01_CAEEL Cuticle collagen 1 precursor (Squ... 62 1e-08
gi|39596527|emb|CAE63146.1| Hypothetical protein CBG07448 [Caeno... 62 2e-08
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 42 3e-08
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 60 7e-08
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 60 9e-08
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 60 9e-08
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ... 59 1e-07
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 59 1e-07
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 59 2e-07
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 58 4e-07
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 57 5e-07
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [... 57 5e-07
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 57 8e-07
gi|17542184|ref|NP_501700.1| COLlagen structural gene (29.4 kD) ... 57 8e-07
gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114) ... 56 1e-06
gi|39588428|emb|CAE72779.1| Hypothetical protein CBG20034 [Caeno... 56 1e-06
gi|39596498|emb|CAE63117.1| Hypothetical protein CBG07414 [Caeno... 56 1e-06
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 55 2e-06
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 55 2e-06
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno... 55 2e-06
gi|39593552|emb|CAE61844.1| Hypothetical protein CBG05818 [Caeno... 55 2e-06
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 54 7e-06
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 54 7e-06
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 54 7e-06
gi|39596499|emb|CAE63118.1| Hypothetical protein CBG07415 [Caeno... 54 7e-06
gi|39580392|emb|CAE70951.1| Hypothetical protein CBG17762 [Caeno... 54 7e-06
gi|17535685|ref|NP_496589.1| ROLler: helically twisted, animals ... 54 7e-06
gi|32698037|emb|CAE11316.1| Hypothetical protein H06A10.2 [Caeno... 53 1e-05
gi|17568109|ref|NP_510274.1| COLlagen structural gene (col-44) [... 53 1e-05
gi|39582210|emb|CAE64161.1| Hypothetical protein CBG08781 [Caeno... 52 2e-05
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 51 4e-05
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 50 6e-05
gi|17537301|ref|NP_494562.1| COLlagen structural gene (37.0 kD) ... 50 6e-05
gi|39596517|emb|CAE63136.1| Hypothetical protein CBG07436 [Caeno... 50 6e-05
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 50 1e-04
gi|7498195|pir||T34203 hypothetical protein D2024.8 - Caenorhabd... 50 1e-04
gi|39588940|emb|CAE69570.1| Hypothetical protein CBG15782 [Caeno... 49 1e-04
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 49 2e-04
gi|39591412|emb|CAE73466.1| Hypothetical protein CBG20917 [Caeno... 49 2e-04
gi|159171|gb|AAA29174.1| collagen 8E 49 2e-04
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 48 3e-04
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 48 3e-04
gi|17543166|ref|NP_500138.1| COLlagen structural gene (29.0 kD) ... 48 3e-04
gi|39583745|emb|CAE63849.1| Hypothetical protein CBG08408 [Caeno... 48 3e-04
gi|17557099|ref|NP_499700.1| COLlagen structural gene (30.3 kD) ... 48 3e-04
gi|39588941|emb|CAE69571.1| Hypothetical protein CBG15783 [Caeno... 48 3e-04
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 48 4e-04
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 48 4e-04
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [... 48 4e-04
gi|321007|pir||B44984 collagen - nematode (Haemonchus contortus)... 47 5e-04
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 47 5e-04
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 47 6e-04
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 47 6e-04
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 47 6e-04
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 47 6e-04
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 47 6e-04
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 47 6e-04
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 47 6e-04
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 47 6e-04
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 47 8e-04
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 47 8e-04
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 46 0.001
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 46 0.001
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 46 0.001
gi|115399|sp|P16252|CAC2_HAECO Cuticle collagen 2C >gnl|BL_ORD_I... 46 0.001
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno... 46 0.001
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 46 0.001
gi|4809258|gb|AAD30169.1| collagen [Haemonchus contortus] 45 0.002
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 45 0.002
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 45 0.003
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 45 0.003
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 44 0.004
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 44 0.004
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 44 0.004
gi|17568107|ref|NP_510273.1| COLlagen structural gene (col-9) [C... 44 0.004
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 44 0.005
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd... 44 0.005
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 44 0.005
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 44 0.005
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 44 0.005
gi|17539916|ref|NP_500598.1| COLlagen structural gene (col-110) ... 44 0.005
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno... 44 0.007
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 44 0.007
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 44 0.007
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 44 0.007
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 44 0.007
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 44 0.007
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 44 0.007
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 43 0.009
gi|4504487|ref|NP_002143.1| histidine-rich calcium-binding prote... 43 0.012
gi|39590294|emb|CAE66032.1| Hypothetical protein CBG11227 [Caeno... 43 0.012
gi|34526573|dbj|BAC85246.1| unnamed protein product [Homo sapiens] 43 0.012
gi|47564823|ref|ZP_00235867.1| collagen adhesin protein, putativ... 42 0.016
gi|17532741|ref|NP_495367.1| DumPY : shorter than wild-type DPY-... 42 0.020
gi|543967|sp|P35799|CCD2_CAEEL Cuticle collagen dpy-2 precursor 42 0.020
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 42 0.020
gi|7494559|pir||T28887 collagen dpy-10 - Caenorhabditis elegans 42 0.027
gi|32565701|ref|NP_495366.2| collagen triple helix repeat family... 42 0.027
gi|543968|sp|P35800|CCDA_CAEEL Cuticle collagen dpy-10 precursor... 42 0.027
gi|23613722|ref|NP_704743.1| hypothetical protein [Plasmodium fa... 41 0.035
gi|50289215|ref|XP_447038.1| unnamed protein product [Candida gl... 41 0.035
gi|39587615|emb|CAE58553.1| Hypothetical protein CBG01712 [Caeno... 41 0.035
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno... 41 0.045
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 41 0.045
gi|6467825|gb|AAF13218.1| Spen RNP motif protein long isoform [D... 40 0.059
gi|24580581|ref|NP_524718.2| CG18497-PB [Drosophila melanogaster... 40 0.059
gi|6979936|gb|AAF34661.1| split ends long isoform [Drosophila me... 40 0.059
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 40 0.059
gi|24580583|ref|NP_722616.1| CG18497-PC [Drosophila melanogaster... 40 0.059
gi|24580579|ref|NP_722615.1| CG18497-PA [Drosophila melanogaster... 40 0.059
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 40 0.059
gi|32404250|ref|XP_322738.1| predicted protein [Neurospora crass... 40 0.059
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 40 0.059
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 40 0.059
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 40 0.059
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 40 0.077
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 40 0.077
gi|15010476|gb|AAK77286.1| GH06265p [Drosophila melanogaster] 40 0.077
gi|24653538|ref|NP_610925.2| CG30483-PA [Drosophila melanogaster... 40 0.077
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ... 40 0.077
gi|50419303|ref|XP_458176.1| unnamed protein product [Debaryomyc... 40 0.10
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 39 0.13
gi|39590295|emb|CAE66033.1| Hypothetical protein CBG11229 [Caeno... 39 0.13
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 39 0.17
gi|39591507|emb|CAE73561.1| Hypothetical protein CBG21031 [Caeno... 39 0.17
gi|17569623|ref|NP_509801.1| esophageal gland cell secretory pro... 39 0.23
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 39 0.23
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 38 0.29
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 38 0.29
gi|7332272|gb|AAA17398.2| collagen [Caenorhabditis elegans] 38 0.29
gi|7494560|pir||T37285 collagen dpy-2 - Caenorhabditis elegans 38 0.29
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 38 0.29
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 38 0.29
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 38 0.29
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 38 0.29
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo... 38 0.29
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano... 38 0.29
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 38 0.38
gi|126169|sp|P14594|LEGB_PEA Legumin B [Contains: Legumin B alph... 38 0.38
gi|34860597|ref|XP_342346.1| similar to CENTROMERIC PROTEIN E (C... 37 0.50
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 37 0.50
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 37 0.50
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD... 37 0.65
gi|7442029|pir||T06453 probable legumin B - garden pea >gnl|BL_O... 37 0.65
gi|10047361|dbj|BAB13468.1| KIAA1642 protein [Homo sapiens] 37 0.65
gi|12053007|emb|CAB66679.1| hypothetical protein [Homo sapiens] 37 0.65
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens] 37 0.65
gi|11992162|gb|AAG42473.1| spectrin beta IV [Homo sapiens] 37 0.65
gi|40353204|ref|NP_066022.1| spectrin, beta, non-erythrocytic 4 ... 37 0.65
gi|17368942|sp|Q9H254|SPCQ_HUMAN Spectrin beta chain, brain 3 (S... 37 0.65
gi|13435161|ref|NP_079489.1| spectrin, beta, non-erythrocytic 4 ... 37 0.65
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri... 37 0.65
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 37 0.65
gi|11602888|gb|AAF93172.1| betaIV spectrin isoform sigma3 [Homo ... 37 0.65
gi|47213357|emb|CAF92980.1| unnamed protein product [Tetraodon n... 37 0.65
gi|45360551|ref|NP_988948.1| hypothetical protein MGC75816 [Xeno... 37 0.65
gi|41203898|ref|XP_372522.1| similar to Plasmodium falciparum tr... 37 0.86
gi|39581447|emb|CAE74729.1| Hypothetical protein CBG22547 [Caeno... 37 0.86
gi|24663755|ref|NP_648638.1| CG14110-PA [Drosophila melanogaster... 37 0.86
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 37 0.86
gi|38110797|gb|EAA56463.1| hypothetical protein MG06434.4 [Magna... 37 0.86
gi|34874497|ref|XP_224295.2| similar to KIAA0853 protein [Rattus... 37 0.86
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ... 36 1.1
gi|25518265|pir||JC7732 trypsin-plasmin inhibitor, bdellin-KL - ... 36 1.1
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno... 36 1.1
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 36 1.1
gi|23508404|ref|NP_701073.1| hypothetical protein [Plasmodium fa... 36 1.1
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 36 1.1
gi|32565084|ref|NP_497348.2| putative nuclear protein family mem... 36 1.1
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [... 36 1.5
gi|32141042|gb|AAP70486.1| histidine-rich calcium binding protei... 36 1.5
gi|50307169|ref|XP_453563.1| unnamed protein product [Kluyveromy... 36 1.5
gi|25148570|ref|NP_740973.1| M protein repeat containing protein... 36 1.5
gi|50543092|ref|XP_499712.1| hypothetical protein [Yarrowia lipo... 36 1.5
gi|1705738|sp|P51861|CDR1_HUMAN Cerebellar-degeneration-related ... 36 1.5
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 36 1.5
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd... 36 1.5
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno... 36 1.5
gi|11346371|pir||T47235 sex determining protein [imported] - wes... 36 1.5
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ... 36 1.5
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [... 36 1.5
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40 36 1.5
gi|42733860|gb|AAS38778.1| similar to exonuclease ii [Schizosacc... 36 1.5
gi|45199081|ref|NP_986110.1| AFR563Cp [Eremothecium gossypii] >g... 35 1.9
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl... 35 1.9
gi|34858169|ref|XP_227368.2| similar to dJ14N1.2 (novel S-100/IC... 35 1.9
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 35 1.9
gi|29833121|ref|NP_827755.1| hypothetical protein SAV6579 [Strep... 35 1.9
gi|21667649|gb|AAM74143.1| myosin binding subunit of myosin phos... 35 2.5
gi|24664979|ref|NP_730099.1| CG32156-PC [Drosophila melanogaster... 35 2.5
gi|24664983|ref|NP_730100.1| CG32156-PA [Drosophila melanogaster... 35 2.5
gi|21392168|gb|AAM48438.1| RE63915p [Drosophila melanogaster] 35 2.5
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 35 2.5
gi|50259385|gb|EAL22058.1| hypothetical protein CNBC1960 [Crypto... 35 2.5
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus] 35 2.5
gi|17509691|ref|NP_493400.1| putative protein, with 2 coiled coi... 35 2.5
gi|47227720|emb|CAG09717.1| unnamed protein product [Tetraodon n... 35 2.5
gi|21357891|ref|NP_648830.1| CG32156-PE [Drosophila melanogaster... 35 2.5
gi|7505675|pir||T32092 hypothetical protein K09F6.6 - Caenorhabd... 35 2.5
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 35 2.5
gi|1711421|sp|P54705|SNWA_DICDI Protein snwA >gnl|BL_ORD_ID|9602... 35 2.5
gi|50344874|ref|NP_001002109.1| zgc:85944 [Danio rerio] >gnl|BL_... 35 3.2
gi|7505772|pir||T32659 hypothetical protein K11D12.9 - Caenorhab... 35 3.2
gi|27817223|gb|AAO23334.1| NcpB [Nostoc sp. ATCC 53789] 35 3.2
gi|24642303|ref|NP_573077.1| CG15602-PA [Drosophila melanogaster... 35 3.2
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid... 35 3.2
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 35 3.2
gi|48862540|ref|ZP_00316436.1| COG0845: Membrane-fusion protein ... 35 3.2
gi|37589396|gb|AAH59341.1| MGC69139 protein [Xenopus laevis] 35 3.2
gi|46227396|gb|EAK88331.1| large hypothetical protein, possible ... 35 3.2
gi|23483514|gb|EAA19159.1| hypothetical protein [Plasmodium yoel... 34 4.2
gi|42783971|ref|NP_981218.1| hypothetical protein BCE4925 [Bacil... 34 4.2
gi|49070630|ref|XP_399604.1| hypothetical protein UM01989.1 [Ust... 34 4.2
gi|23468050|ref|ZP_00123621.1| COG5295: Autotransporter adhesin ... 34 4.2
gi|50732245|ref|XP_418546.1| PREDICTED: similar to PAX transcrip... 34 4.2
gi|41117725|ref|XP_372917.1| similar to Cerebellar-degeneration-... 34 4.2
gi|50552886|ref|XP_503853.1| hypothetical protein [Yarrowia lipo... 34 4.2
gi|9715734|emb|CAC01604.1| peptide synthetase [Anabaena sp. 90] 34 4.2
gi|28828532|gb|AAO51140.1| similar to Homo sapiens (Human). FLJ0... 34 4.2
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 34 5.5
gi|16305113|gb|AAL16979.1| 50kD gamma zein [Zea mays] 34 5.5
gi|45200797|ref|NP_986367.1| AGL300Cp [Eremothecium gossypii] >g... 34 5.5
gi|2708813|gb|AAC50042.1| ATA20 [Arabidopsis thaliana] 34 5.5
gi|50255267|gb|EAL18002.1| hypothetical protein CNBK0230 [Crypto... 34 5.5
gi|50405707|ref|XP_456492.1| unnamed protein product [Debaryomyc... 34 5.5
gi|46123703|ref|XP_386405.1| hypothetical protein FG06229.1 [Gib... 34 5.5
gi|23510183|ref|NP_702849.1| hypothetical protein [Plasmodium fa... 34 5.5
gi|6324238|ref|NP_014308.1| Protein of unknown function, mediate... 34 5.5
gi|42374898|gb|AAS13449.1| merozoite surface protein 6 [Plasmodi... 34 5.5
gi|17551634|ref|NP_508124.1| kinase (40.9 kD) (XB213) [Caenorhab... 34 5.5
gi|18652045|gb|AAL76931.1| chromogranin B [Rana ridibunda] 34 5.5
gi|50546030|ref|XP_500548.1| hypothetical protein [Yarrowia lipo... 34 5.5
gi|24666698|ref|NP_649104.1| CG9619-PA [Drosophila melanogaster]... 34 5.5
gi|15232576|ref|NP_188159.1| anther development protein, putativ... 34 5.5
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 34 5.5
gi|1076839|pir||S49313 protein kinase - slime mold (Dictyosteliu... 34 5.5
gi|46435594|gb|EAK94973.1| hypothetical protein CaO19.7783 [Cand... 34 5.5
gi|28839767|gb|AAH47827.1| Smarcc1 protein [Danio rerio] 33 7.2
gi|39979199|emb|CAE85570.1| related to histone acetyltransferase... 33 7.2
gi|46125615|ref|XP_387361.1| hypothetical protein FG07185.1 [Gib... 33 7.2
gi|28827789|ref|NP_789780.1| NACHT, leucine rich repeat and PYD ... 33 7.2
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor... 33 7.2
gi|46226280|gb|EAK87298.1| hypothetical protein with signal pept... 33 7.2
gi|25152784|ref|NP_500947.2| Neuropeptide-Like Protein (nlp-16) ... 33 7.2
gi|37531244|ref|NP_919924.1| unknown protein [Oryza sativa (japo... 33 7.2
gi|50417567|gb|AAH77588.1| K14 protein [Xenopus laevis] 33 7.2
gi|32407080|ref|XP_324139.1| hypothetical protein [Neurospora cr... 33 7.2
gi|39595809|emb|CAE67312.1| Hypothetical protein CBG12769 [Caeno... 33 7.2
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand... 33 7.2
gi|24641792|ref|NP_572893.1| CG15753-PA [Drosophila melanogaster... 33 7.2
gi|30348940|tpg|DAA01241.1| TPA: NOD14 [Homo sapiens] 33 7.2
gi|39598361|emb|CAE69054.1| Hypothetical protein CBG15063 [Caeno... 33 9.5
gi|42476118|ref|NP_001456.3| FYN binding protein (FYB-120/130); ... 33 9.5
gi|7416993|gb|AAF62400.1| EVH1 domain binding protein [Homo sapi... 33 9.5
gi|1174739|sp|P41512|TOP1_XENLA DNA topoisomerase I >gnl|BL_ORD_... 33 9.5
gi|50730849|ref|XP_417045.1| PREDICTED: similar to KIAA0853 prot... 33 9.5
gi|16508129|gb|AAL17914.1| homeobox protein hox4x [Petromyzon ma... 33 9.5
gi|7274456|gb|AAF44783.1| M protein [Streptococcus pyogenes] 33 9.5
gi|5823345|gb|AAD53111.1| M protein precursor [Streptococcus pyo... 33 9.5
gi|32328882|dbj|BAC78524.1| prepro beta-conglycinin alpha prime ... 33 9.5
gi|46249604|gb|AAH68841.1| LOC414611 protein [Xenopus laevis] 33 9.5
gi|42518986|ref|NP_964916.1| hypothetical protein LJ1061 [Lactob... 33 9.5
gi|8038077|gb|AAF71609.1| M protein [Streptococcus pyogenes] 33 9.5
gi|902016|gb|AAB17102.1| EmmL2(A207) [Streptococcus pyogenes] 33 9.5
gi|6166197|sp|O15117|FYB_HUMAN FYN-binding protein (FYN-T-bindin... 33 9.5
gi|49217627|gb|AAL83627.2| putative manganese transport protein ... 33 9.5
gi|2078273|gb|AAC51300.1| SLP-76 associated protein [Homo sapiens] 33 9.5
gi|8038085|gb|AAF71612.1| M protein [Streptococcus pyogenes] 33 9.5
gi|40788007|ref|NP_955367.1| FYN binding protein (FYB-120/130); ... 33 9.5
gi|50257630|gb|EAL20335.1| hypothetical protein CNBF1460 [Crypto... 33 9.5
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 33 9.5
gi|23479921|gb|EAA16622.1| Arabidopsis thaliana At3g58560/F14P22... 33 9.5
gi|6323883|ref|NP_013954.1| TFIID subunit (67 kDa), involved in ... 33 9.5
gi|29654071|ref|NP_819763.1| trigger factor [Coxiella burnetii R... 33 9.5
gi|50744518|ref|XP_419760.1| PREDICTED: similar to Heat shock fa... 33 9.5
gi|585277|sp|P38530|HSF2_CHICK Heat shock factor protein 2 (HSF ... 33 9.5
gi|39596340|emb|CAE69978.1| Hypothetical protein CBG16376 [Caeno... 33 9.5
gi|24954532|gb|AAN64672.1| M protein [Streptococcus pyogenes] 33 9.5
gi|32410635|ref|XP_325798.1| hypothetical protein [Neurospora cr... 33 9.5
gi|121286|sp|P11827|GLCX_SOYBN Beta-conglycinin, alpha' chain pr... 33 9.5
gi|254751|gb|AAB23118.1| precursor [Chironomus tentans] 33 9.5
gi|8038087|gb|AAF71613.1| M protein [Streptococcus pyogenes] 33 9.5
gi|9967361|dbj|BAA74452.2| alpha' subunit of beta-conglycinin [G... 33 9.5
gi|8038080|gb|AAF71610.1| M protein [Streptococcus pyogenes] 33 9.5
gi|8038082|gb|AAF71611.1| M protein [Streptococcus pyogenes] 33 9.5
gi|50554953|ref|XP_504885.1| hypothetical protein [Yarrowia lipo... 33 9.5
gi|8038075|gb|AAF71608.1| M protein [Streptococcus pyogenes] 33 9.5
gi|24648119|ref|NP_650778.1| CG6026-PA [Drosophila melanogaster]... 33 9.5
gi|8038090|gb|AAF71614.1| M protein [Streptococcus pyogenes] 33 9.5
gi|7406742|gb|AAF61748.1| fruitless type C [Drosophila silvestris] 33 9.5
>gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33)
[Caenorhabditis elegans]
gi|7500598|pir||T29960 hypothetical protein F36A4.6 -
Caenorhabditis elegans
Length = 317
Score = 192 bits (489), Expect = 7e-48
Identities = 102/159 (64%), Positives = 102/159 (64%)
Frame = +1
Query: 1 MEVQEIKNRMKAYRFXXXXXXXXXXXXXXXXXQIDSILIFCSKVCVTLPMVYNYVHHVKR 180
MEVQEIKNRMKAYRF QIDSILIFCSKVCVTLPMVYNYVHHVKR
Sbjct: 1 MEVQEIKNRMKAYRFVAYSAVAFSVVAVISVSQIDSILIFCSKVCVTLPMVYNYVHHVKR 60
Query: 181 SMQNEIVYCRGSAKDIWSEVRTLKTALEPIQNRTARQAYADAAVHXXXXXXXNCEACCXX 360
SMQNEIVYCRGSAKDIWSEVRTLKTALEPIQNRTARQAYADAAVH NCEACC
Sbjct: 61 SMQNEIVYCRGSAKDIWSEVRTLKTALEPIQNRTARQAYADAAVHGGGGGGGNCEACCLP 120
Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQPCEPIT 477
VQPCEPIT
Sbjct: 121 GPAGPAGAPGNPGRPGKPGAPGLPGNPGKPPVQPCEPIT 159
Score = 48.9 bits (115), Expect = 2e-04
Identities = 20/20 (100%), Positives = 20/20 (100%)
Frame = +1
Query: 892 ICPKYCAIDGGVFFEDGTRR 951
ICPKYCAIDGGVFFEDGTRR
Sbjct: 298 ICPKYCAIDGGVFFEDGTRR 317