Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F35D6_2
(315 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17540146|ref|NP_500825.1| feminization 1 homolog a like, FEMi... 221 3e-57
gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinizat... 182 1e-49
gi|39588349|emb|CAE72700.1| Hypothetical protein CBG19924 [Caeno... 114 9e-29
gi|24308163|ref|NP_061178.1| fem-1 homolog a (C.elegans) [Homo s... 52 3e-10
gi|40643259|emb|CAC85342.1| putative sex determining protein [Ho... 52 3e-10
gi|47212723|emb|CAF90461.1| unnamed protein product [Tetraodon n... 50 6e-10
gi|34882324|ref|XP_236784.2| similar to sex-determination protei... 48 3e-09
gi|50806390|ref|XP_428816.1| PREDICTED: similar to feminization ... 48 3e-09
gi|34850070|ref|NP_789799.1| RIKEN cDNA 4931440F15; Fem1a-like [... 48 3e-09
gi|50761188|ref|XP_418271.1| PREDICTED: similar to fem-1 homolog... 47 4e-09
gi|31542806|ref|NP_034322.2| feminization 1 homolog a [Mus muscu... 47 4e-09
gi|3930525|gb|AAC82372.1| sex-determination protein homolog Fem1... 47 4e-09
gi|12836689|dbj|BAB23768.1| unnamed protein product [Mus musculus] 47 4e-09
gi|17864094|ref|NP_064562.1| feminization 1 homolog a [Homo sapi... 45 2e-08
gi|9187618|emb|CAB96957.1| similar to (NP_034322.1|) sex-determi... 45 2e-08
gi|41054155|ref|NP_956131.1| Unknown (protein for MGC:63483); wu... 45 2e-08
gi|27674123|ref|XP_228396.1| similar to fem-1 homolog c (C.elega... 45 3e-08
gi|27734132|ref|NP_775599.1| fem-1 homolog c (C.elegans) [Mus mu... 45 3e-08
gi|41282175|ref|NP_937788.2| fem-1 homolog c (C.elegans) [Danio ... 44 4e-08
gi|31322632|gb|AAO64431.1| Fem1c [Danio rerio] 44 4e-08
gi|26340056|dbj|BAC33691.1| unnamed protein product [Mus musculus] 44 4e-08
gi|25013125|gb|AAN71661.1| SD14914p [Drosophila melanogaster] 46 4e-07
gi|26329921|dbj|BAC28699.1| unnamed protein product [Mus musculus] 41 4e-07
gi|31202897|ref|XP_310397.1| ENSANGP00000005617 [Anopheles gambi... 38 1e-05
gi|48102812|ref|XP_392810.1| similar to ENSANGP00000005617 [Apis... 44 2e-05
gi|24646968|ref|NP_650415.1| CG6966-PA [Drosophila melanogaster]... 38 1e-04
gi|29837359|gb|AAP05764.1| notch-like transmembrane receptor LIN... 45 3e-04
gi|39585032|emb|CAE62683.1| Hypothetical protein CBG06829 [Caeno... 45 3e-04
gi|6322079|ref|NP_012154.1| Subunit of the Set3 complex, which i... 45 4e-04
gi|28373837|pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat ... 44 6e-04
gi|28373835|pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat ... 44 6e-04
gi|27720561|ref|XP_236321.1| similar to sex-determination protei... 42 7e-04
gi|6753840|ref|NP_034323.1| feminization 1 homolog b [Mus muscul... 42 7e-04
gi|13359098|dbj|BAB33298.1| mt-Fem [Mus musculus] 42 7e-04
gi|7657265|ref|NP_056137.1| fem-1 homolog b; FEM-1-like death re... 42 7e-04
gi|6175871|gb|AAF05315.1| FEM-1-like death receptor binding prot... 42 7e-04
gi|24745936|dbj|BAC23047.1| ankyrin-like protein [Solanum tubero... 43 0.002
gi|7110220|gb|AAF36832.1| AKT1-like potassium channel [Triticum ... 40 0.002
gi|29837357|gb|AAP05763.1| notch-like transmembrane receptor LIN... 42 0.002
gi|39585030|emb|CAE62681.1| Hypothetical protein CBG06826 [Caeno... 42 0.002
gi|13385328|ref|NP_080126.1| fibronectin type 3 and ankyrin repe... 42 0.004
gi|42523275|ref|NP_968655.1| conserved hypothetical protein [Bde... 42 0.004
gi|12856143|dbj|BAB30580.1| unnamed protein product [Mus musculus] 42 0.004
gi|12231947|gb|AAG49318.1| notch-like transmembrane receptor [Ca... 42 0.004
gi|12231949|gb|AAG49319.1| notch-like transmembrane receptor [Ca... 42 0.004
gi|50554851|ref|XP_504834.1| hypothetical protein [Yarrowia lipo... 42 0.004
gi|28196052|gb|AAN78090.2| putative AKT1-like potassium channel ... 39 0.005
gi|34854366|ref|XP_215505.2| similar to ankycorbin [Rattus norve... 41 0.005
gi|34329680|gb|AAQ63971.1| unknown [Nicotiana benthamiana] 41 0.007
gi|48102151|ref|XP_392747.1| similar to CG3104-PA [Apis mellifera] 41 0.007
gi|50310449|ref|XP_455244.1| unnamed protein product [Kluyveromy... 40 0.009
gi|7243049|dbj|BAA92572.1| KIAA1334 protein [Homo sapiens] 40 0.009
gi|37039909|gb|AAQ63889.2| retinoic acid induced 14 isoform [Hom... 40 0.009
gi|38104460|gb|EAA51022.1| hypothetical protein MG04781.4 [Magna... 40 0.009
gi|32481927|gb|AAP84319.1| RAI14 isoform [Homo sapiens] 40 0.009
gi|49135976|ref|XP_413324.1| hypothetical protein AN9187.2 [Aspe... 40 0.009
gi|31418642|gb|AAH52988.1| Retinoic acid induced 14 [Homo sapiens] 40 0.009
gi|13470086|ref|NP_056392.1| retinoic acid induced 14; novel ret... 40 0.009
gi|29248600|gb|EAA40130.1| GLP_80_44934_42319 [Giardia lamblia A... 40 0.012
gi|28373666|pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin... 40 0.012
gi|15225768|ref|NP_180233.1| potassium channel protein 1 (AKT1) ... 36 0.014
gi|99746|pir||S23606 potassium channel protein AKT1 - Arabidopsi... 36 0.014
gi|30102664|gb|AAP21250.1| At2g26650 [Arabidopsis thaliana] 36 0.014
gi|13435256|gb|AAK26131.1| putative ankyrin [Oryza sativa] 40 0.015
gi|38109002|gb|EAA54936.1| hypothetical protein MG05727.4 [Magna... 40 0.015
gi|48716527|dbj|BAD23131.1| putative ankyrin-like protein [Oryza... 40 0.015
gi|34896840|ref|NP_909764.1| putative stress-inducible protein [... 40 0.015
gi|50762280|ref|XP_425003.1| PREDICTED: similar to Retinoic acid... 40 0.015
gi|17554212|ref|NP_499007.1| abnormal cell LINeage LIN-12, notch... 40 0.015
gi|24581258|ref|NP_608724.1| CG3104-PA [Drosophila melanogaster]... 39 0.020
gi|46118980|ref|ZP_00175910.2| COG0666: FOG: Ankyrin repeat [Cro... 39 0.020
gi|50744999|ref|XP_419939.1| PREDICTED: similar to KIAA1250 prot... 39 0.020
gi|42520607|ref|NP_966522.1| ankyrin repeat domain protein [Wolb... 39 0.020
gi|50285605|ref|XP_445231.1| unnamed protein product [Candida gl... 39 0.020
gi|48138442|ref|XP_393405.1| similar to CG10011-PA [Apis mellifera] 35 0.022
gi|38073758|ref|XP_203596.3| RIKEN cDNA A530050D06 [Mus musculus] 39 0.026
gi|37360330|dbj|BAC98143.1| mKIAA1334 protein [Mus musculus] 39 0.026
gi|13507620|ref|NP_109615.1| ankycorbin; NORPEG-like protein [Mu... 39 0.026
gi|34861136|ref|XP_219418.2| similar to RIKEN cDNA 1700007B22 [R... 39 0.026
gi|46359897|gb|AAS88829.1| putative ankyrin protein [Oryza sativ... 39 0.026
gi|24650843|ref|NP_651624.2| CG10011-PA [Drosophila melanogaster... 37 0.029
gi|17862878|gb|AAL39916.1| SD01389p [Drosophila melanogaster] 37 0.029
gi|19527661|gb|AAL89945.1| SD03956p [Drosophila melanogaster] 37 0.029
gi|49115128|gb|AAH73194.1| Unknown (protein for MGC:80444) [Xeno... 36 0.031
gi|32410461|ref|XP_325711.1| hypothetical protein [Neurospora cr... 39 0.034
gi|15229331|ref|NP_187122.1| ankyrin repeat family protein [Arab... 39 0.034
gi|50738628|ref|XP_426100.1| PREDICTED: similar to Ankyrin repea... 39 0.034
gi|28274850|gb|AAO25690.1| ankyrin repeat protein E3_19 [synthet... 39 0.034
gi|31208307|ref|XP_313120.1| ENSANGP00000012854 [Anopheles gambi... 34 0.037
gi|3986768|gb|AAC84164.1| G9A [Mus musculus] 38 0.045
gi|38075900|ref|XP_127673.3| RIKEN cDNA E430019N21 [Mus musculus] 38 0.045
gi|22219432|ref|NP_671493.1| HLA-B associated transcript 8 isofo... 38 0.045
gi|14424019|sp|O15084|AN28_HUMAN Ankyrin repeat domain protein 2... 38 0.045
gi|26346681|dbj|BAC36989.1| unnamed protein product [Mus musculus] 38 0.045
gi|18543183|ref|NP_569834.1| CG2995-PA [Drosophila melanogaster]... 38 0.045
gi|37231570|gb|AAH58357.1| Bat8 protein [Mus musculus] 38 0.045
gi|34877009|ref|XP_224620.2| similar to Hypothetical protein KIA... 38 0.045
gi|22164772|ref|NP_665829.1| HLA-B associated transcript 8 isofo... 38 0.045
gi|47059112|ref|NP_997628.1| HLA-B associated transcript 8, rat ... 38 0.045
gi|46195713|ref|NP_056014.1| ankyrin repeat domain 28 [Homo sapi... 38 0.045
gi|18375637|ref|NP_006700.2| HLA-B associated transcript 8 BAT8 ... 38 0.059
gi|15917538|emb|CAC86666.1| NG36/G9a [Homo sapiens] 38 0.059
gi|18426879|ref|NP_079532.4| HLA-B associated transcript 8 BAT8 ... 38 0.059
gi|34222186|ref|NP_660278.2| fibronectin type 3 and ankyrin repe... 38 0.059
gi|50746705|ref|XP_420618.1| PREDICTED: similar to Hypothetical ... 38 0.059
gi|34534435|dbj|BAC87007.1| unnamed protein product [Homo sapiens] 38 0.059
gi|28274846|gb|AAO25688.1| ankyrin repeat protein E2_17 [synthet... 38 0.059
gi|34856863|ref|XP_215553.2| similar to Hypothetical protein KIA... 38 0.059
gi|47124718|gb|AAH70641.1| MGC81501 protein [Xenopus laevis] 38 0.059
gi|49522384|gb|AAH75392.1| Unknown (protein for MGC:89123) [Xeno... 38 0.059
gi|47223960|emb|CAG06137.1| unnamed protein product [Tetraodon n... 38 0.059
gi|48257161|gb|AAH02686.2| BAT8 protein [Homo sapiens] 38 0.059
gi|38076235|ref|XP_130845.2| RIKEN cDNA E430012K20 [Mus musculus] 38 0.059
gi|46436822|gb|EAK96178.1| hypothetical protein CaO19.7160 [Cand... 38 0.059
gi|14424228|sp|Q9ULJ7|YB23_HUMAN Hypothetical protein KIAA1223 >... 38 0.059
gi|17555340|ref|NP_499461.1| ankyrin (108.6 kD) (3M451) [Caenorh... 38 0.059
gi|25989449|gb|AAL82720.1| ankyrin B [Edwardsiella tarda] >gnl|B... 38 0.059
gi|34364722|emb|CAE45806.1| hypothetical protein [Homo sapiens] 38 0.059
gi|19353254|gb|AAH24725.1| KIAA1223 protein [Homo sapiens] 38 0.059
gi|41195096|ref|XP_048747.4| KIAA1223 protein [Homo sapiens] 38 0.059
gi|46255679|gb|AAH09351.1| BAT8 protein [Homo sapiens] 38 0.059
gi|4529889|gb|AAD21812.1| G9A [Homo sapiens] >gnl|BL_ORD_ID|6865... 38 0.059
gi|48257231|gb|AAH20970.2| BAT8 protein [Homo sapiens] 38 0.059
gi|478844|pir||S30385 G9a protein - human >gnl|BL_ORD_ID|622893 ... 38 0.059
gi|37181416|gb|AAQ88521.1| CG3104 hlg [Homo sapiens] 38 0.059
gi|46120376|ref|XP_385011.1| hypothetical protein FG04835.1 [Gib... 35 0.063
gi|1168457|sp|Q02357|ANK1_MOUSE Ankyrin 1 (Erythrocyte ankyrin) ... 37 0.077
gi|10947038|ref|NP_065209.1| ankyrin 1 isoform 1; ankyrin-1, ery... 37 0.077
gi|226788|prf||1605244A erythrocyte ankyrin 37 0.077
gi|7385113|gb|AAF61702.1| ankyrin 1 [Bos taurus] 37 0.077
gi|1881698|gb|AAB49464.1| ankyrin [Pseudomonas aeruginosa] 37 0.077
gi|48783925|ref|ZP_00280306.1| COG0666: FOG: Ankyrin repeat [Bur... 37 0.077
gi|47226243|emb|CAG08390.1| unnamed protein product [Tetraodon n... 37 0.077
gi|50806270|ref|XP_424401.1| PREDICTED: similar to ankyrin [Gall... 37 0.077
gi|10947036|ref|NP_065208.1| ankyrin 1 isoform 4; ankyrin-1, ery... 37 0.077
gi|1360744|pir||B35049 ankyrin 1, erythrocyte splice form 3 - human 37 0.077
gi|1845265|gb|AAB47805.1| ankyrin [Homo sapiens] 37 0.077
gi|105337|pir||A35049 ankyrin 1, erythrocyte splice form 2 - human 37 0.077
gi|178646|gb|AAA51732.1| ankyrin 37 0.077
gi|10947040|ref|NP_000028.2| ankyrin 1 isoform 3; ankyrin-1, ery... 37 0.077
gi|46133955|ref|XP_389293.1| hypothetical protein FG09117.1 [Gib... 37 0.077
gi|46165056|ref|ZP_00138168.2| COG0666: FOG: Ankyrin repeat [Pse... 37 0.077
gi|25553600|dbj|BAC24865.1| putative AKT1-like potassium channel... 37 0.077
gi|15599808|ref|NP_253302.1| conserved hypothetical protein [Pse... 37 0.077
gi|50795961|ref|XP_423822.1| PREDICTED: similar to ankyrin repea... 37 0.077
gi|13624297|ref|NP_112435.1| ankyrin 1, erythroid; normoblastic ... 37 0.077
gi|22208951|ref|NP_665862.1| ankyrin repeat and SOCS box-contain... 37 0.077
gi|7022441|dbj|BAA91599.1| unnamed protein product [Homo sapiens] 37 0.077
gi|7705831|ref|NP_057199.1| ankyrin repeat and SOCS box-containi... 37 0.077
gi|28274852|gb|AAO25691.1| ankyrin repeat protein E4_2 [syntheti... 37 0.077
gi|10947042|ref|NP_065210.1| ankyrin 1 isoform 2; ankyrin-1, ery... 37 0.077
gi|34879099|ref|XP_240464.2| similar to ankyrin [Rattus norvegicus] 37 0.077
gi|49081768|gb|AAT50284.1| PA4612 [synthetic construct] 37 0.077
gi|34879673|ref|XP_344278.1| similar to ankyrin repeat and SOCS ... 37 0.10
gi|48833919|ref|ZP_00290935.1| COG0666: FOG: Ankyrin repeat [Mag... 37 0.10
gi|12963689|ref|NP_075961.1| ankyrin repeat, family A (RFXANK-li... 37 0.10
gi|47223711|emb|CAF99320.1| unnamed protein product [Tetraodon n... 37 0.10
gi|50745401|ref|XP_420094.1| PREDICTED: similar to dysferlin-int... 37 0.10
gi|34853462|ref|XP_215457.2| similar to ankyrin repeat, family A... 37 0.10
gi|26349313|dbj|BAC38296.1| unnamed protein product [Mus musculus] 37 0.10
gi|12746412|ref|NP_075526.1| ankyrin repeat, family A (RFXANK-li... 37 0.10
gi|42406377|gb|AAH66113.1| Ankra2 protein [Mus musculus] 37 0.10
gi|20532001|sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box con... 37 0.10
gi|45187629|ref|NP_983852.1| ADL244Wp [Eremothecium gossypii] >g... 37 0.13
gi|34877792|ref|XP_237393.2| similar to espin [Rattus norvegicus] 37 0.13
gi|391941|dbj|BAA02508.1| PHO81 [Saccharomyces cerevisiae] 37 0.13
gi|38637543|dbj|BAD03795.1| ankyrin-like protein [Oryza sativa (... 37 0.13
gi|50750854|ref|XP_422174.1| PREDICTED: similar to KIAA1728 prot... 37 0.13
gi|46104668|ref|XP_380316.1| hypothetical protein FG00140.1 [Gib... 37 0.13
gi|50761861|ref|XP_429167.1| PREDICTED: similar to 2610034M16Rik... 37 0.13
gi|45387675|ref|NP_991189.1| BCL6 co-repressor; BCL-6 corepresso... 37 0.13
gi|6321672|ref|NP_011749.1| Cyclin-dependent kinase (CDK) inhibi... 37 0.13
gi|4140|emb|CAA36726.1| unnamed protein product [Saccharomyces c... 37 0.13
gi|47213218|emb|CAF89739.1| unnamed protein product [Tetraodon n... 37 0.13
gi|48137938|ref|XP_396833.1| similar to RIKEN cDNA 9230102N17 [A... 37 0.13
gi|21426773|ref|NP_653351.1| lysophospholipase [Rattus norvegicu... 37 0.13
gi|29251459|gb|EAA42940.1| GLP_170_35655_38039 [Giardia lamblia ... 37 0.13
gi|48095483|ref|XP_392305.1| similar to ENSANGP00000010233 [Apis... 37 0.13
gi|28274854|gb|AAO25692.1| ankyrin repeat protein E4_8 [syntheti... 37 0.13
gi|15528712|dbj|BAB64778.1| putative ankyrin-like protein [Oryza... 37 0.13
gi|38344540|emb|CAD40970.2| OSJNBa0027P08.8 [Oryza sativa (japon... 36 0.17
gi|47124782|gb|AAH70767.1| LOC431863 protein [Xenopus laevis] 36 0.17
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib... 36 0.17
gi|27451615|gb|AAO15006.1| hypothetical protein [Takifugu rubripes] 36 0.17
gi|13242480|ref|NP_077493.1| EsV-1-8 [Ectocarpus siliculosus vir... 36 0.17
gi|47085879|ref|NP_998294.1| zgc:64138 [Danio rerio] >gnl|BL_ORD... 36 0.17
gi|45199209|ref|NP_986238.1| AFR690Cp [Eremothecium gossypii] >g... 36 0.17
gi|50800235|ref|XP_424114.1| PREDICTED: similar to RIKEN cDNA G4... 36 0.17
gi|34862202|ref|XP_343140.1| similar to RIKEN cDNA G431002C21 [R... 36 0.17
gi|37955184|gb|AAP20060.1| HSD13 [Homo sapiens] 36 0.17
gi|26328249|dbj|BAC27865.1| unnamed protein product [Mus musculus] 36 0.17
gi|41201712|ref|XP_370696.1| hypothetical protein FLJ34236 [Homo... 36 0.17
gi|27370168|ref|NP_766378.1| RIKEN cDNA G431002C21 [Mus musculus... 36 0.17
gi|49089797|ref|XP_406501.1| hypothetical protein AN2364.2 [Aspe... 36 0.17
gi|32403722|ref|XP_322474.1| hypothetical protein [Neurospora cr... 36 0.17
gi|34875711|ref|XP_346039.1| hypothetical protein XP_346038 [Rat... 36 0.17
gi|15241347|ref|NP_196927.1| ankyrin repeat family protein [Arab... 36 0.17
gi|7510991|pir||T27753 hypothetical protein ZK1320.7 - Caenorhab... 36 0.17
gi|46323508|ref|ZP_00223872.1| COG0666: FOG: Ankyrin repeat [Bur... 36 0.17
gi|46937308|emb|CAG27094.1| inwardly rectifying potassium channe... 33 0.18
gi|50258361|gb|EAL21050.1| hypothetical protein CNBD4260 [Crypto... 36 0.22
gi|45550629|ref|NP_648826.2| CG5841-PA [Drosophila melanogaster]... 36 0.22
gi|34911758|ref|NP_917226.1| putative AKT1-like potassium channe... 36 0.22
gi|26336659|dbj|BAC32012.1| unnamed protein product [Mus musculus] 36 0.22
gi|47206139|emb|CAG14609.1| unnamed protein product [Tetraodon n... 36 0.22
gi|11321435|gb|AAG34167.1| ankyrin repeat-rich membrane-spanning... 36 0.22
gi|1703310|sp|Q01484|ANK2_HUMAN Ankyrin 2 (Brain ankyrin) (Ankyr... 36 0.22
gi|38050339|ref|XP_149072.2| hypothetical protein XP_149072 [Mus... 36 0.22
gi|41134000|ref|XP_043492.3| KIAA1728 protein [Homo sapiens] 36 0.22
gi|41326528|emb|CAF21010.1| Ankyrin repeat protein [Corynebacter... 36 0.22
gi|28385979|gb|AAH46467.1| C330002I19Rik protein [Mus musculus] ... 36 0.22
gi|46201746|ref|ZP_00054445.2| COG0568: DNA-directed RNA polymer... 36 0.22
gi|10947054|ref|NP_066187.1| ankyrin 2 isoform 2; ankyrin, noner... 36 0.22
gi|14133247|dbj|BAA86564.2| KIAA1250 protein [Homo sapiens] 36 0.22
gi|50746761|ref|XP_420642.1| PREDICTED: similar to ankyrin 2 iso... 36 0.22
gi|34785877|gb|AAH57657.1| Unknown (protein for MGC:68086) [Mus ... 36 0.22
gi|26350249|dbj|BAC38764.1| unnamed protein product [Mus musculus] 36 0.22
gi|12698001|dbj|BAB21819.1| KIAA1728 protein [Homo sapiens] 36 0.22
gi|19526775|ref|NP_446247.1| kinase D-interacting substance of 2... 36 0.22
gi|42656507|ref|XP_291015.3| likely homolog of rat kinase D-inte... 36 0.22
gi|21312664|ref|NP_080773.1| nudix (nucleoside diphosphate linke... 36 0.22
gi|1841966|gb|AAB47551.1| ankyrin [Rattus norvegicus] 36 0.22
gi|34859981|ref|XP_342338.1| similar to hypothetical protein [Ra... 36 0.22
gi|47198573|emb|CAF88419.1| unnamed protein product [Tetraodon n... 36 0.22
gi|47222867|emb|CAF96534.1| unnamed protein product [Tetraodon n... 36 0.22
gi|17887457|gb|AAL40894.1| AKT1-like potassium channel [Oryza sa... 36 0.22
gi|31873714|emb|CAD97827.1| hypothetical protein [Homo sapiens] 36 0.22
gi|38049418|ref|XP_126866.5| kinase D-interacting substance of 2... 36 0.22
gi|19387842|ref|NP_076395.1| ankyrin repeat and SOCS box-contain... 36 0.22
gi|4803663|emb|CAB42644.1| ankyrin B (440 kDa) [Homo sapiens] 36 0.22
gi|18606485|gb|AAH23086.1| Ankyrin repeat and SOCS box-containin... 36 0.22
gi|11359987|pir||T43458 hypothetical protein DKFZp434F0621.1 - h... 36 0.22
gi|26350949|dbj|BAC39111.1| unnamed protein product [Mus musculus] 36 0.22
gi|10947052|ref|NP_001139.2| ankyrin 2 isoform 1; ankyrin, noner... 36 0.22
gi|23308929|ref|NP_601546.2| ankyrin repeat containing protein [... 36 0.22
gi|28972688|dbj|BAC65760.1| mKIAA1250 protein [Mus musculus] 36 0.22
gi|31197783|ref|XP_307839.1| ENSANGP00000004013 [Anopheles gambi... 35 0.25
gi|730856|sp|P40418|SWI6_KLULA Regulatory protein SWI6 (Cell-cyc... 35 0.29
gi|29245032|gb|EAA36697.1| GLP_78_838_1464 [Giardia lamblia ATCC... 35 0.29
gi|50304643|ref|XP_452277.1| SWI6_KLULA [Kluyveromyces lactis] >... 35 0.29
gi|34189775|gb|AAH16985.2| Unknown (protein for MGC:21968) [Homo... 35 0.29
gi|30249048|ref|NP_841118.1| Ankyrin-repeat [Nitrosomonas europa... 35 0.29
gi|11359960|pir||T42691 hypothetical protein DKFZp434D2328.1 - h... 35 0.29
gi|31234451|ref|XP_319063.1| ENSANGP00000013300 [Anopheles gambi... 35 0.29
gi|47125198|gb|AAH70744.1| MGC83745 protein [Xenopus laevis] 35 0.29
gi|32189743|ref|NP_859473.1| ankyrin repeat protein 1 [Leishmani... 35 0.29
gi|24233530|ref|NP_710181.1| hypothetical protein DKFZp434D2328 ... 35 0.29
gi|28564938|gb|AAO32553.1| AKR1 [Saccharomyces kluyveri] 35 0.29
gi|49116595|ref|XP_412156.1| hypothetical protein AN8019.2 [Aspe... 35 0.29
gi|50748758|ref|XP_421393.1| PREDICTED: similar to hypothetical ... 35 0.38
gi|50259759|gb|EAL22427.1| hypothetical protein CNBB3060 [Crypto... 35 0.38
gi|26333929|dbj|BAC30682.1| unnamed protein product [Mus musculus] 35 0.38
gi|47229290|emb|CAG04042.1| unnamed protein product [Tetraodon n... 35 0.38
gi|34877922|ref|XP_344649.1| hypothetical protein XP_344648 [Rat... 35 0.38
gi|47216108|emb|CAG11176.1| unnamed protein product [Tetraodon n... 35 0.38
gi|16550932|gb|AAL25648.1| inward-rectifying K+ channel [Eucalyp... 35 0.38
gi|33284837|emb|CAE17588.1| SI:dZ119J18.2 (novel protein similar... 35 0.38
gi|16550935|gb|AAL25649.1| inward-rectifying K+ channel [Eucalyp... 35 0.38
gi|28274844|gb|AAO25687.1| ankyrin repeat protein E2_5 [syntheti... 35 0.38
gi|6753934|ref|NP_034379.1| GA repeat binding protein, beta 1 is... 35 0.38
gi|786502|gb|AAB32375.1| GABP beta 1-1=heterotetrameric transcri... 35 0.38
gi|46575942|ref|NP_997552.1| GA repeat binding protein, beta 1 i... 35 0.38
gi|46445251|gb|EAL04520.1| hypothetical protein CaO19.12191 [Can... 35 0.38
gi|50750204|ref|XP_421911.1| PREDICTED: similar to Ankyrin repea... 35 0.38
gi|32475771|ref|NP_868765.1| ank-repeat containing protein [Pire... 35 0.38
gi|109848|pir||C40858 GA-binding protein beta chain form 2 - mouse 35 0.38
gi|33466102|gb|AAQ19490.1| GA binding protein subunit beta1 [Mus... 35 0.38
gi|10954886|ref|NP_053306.1| Hypothetical gene [Agrobacterium tu... 35 0.38
gi|46139821|ref|XP_391601.1| hypothetical protein FG11425.1 [Gib... 35 0.38
gi|13899267|ref|NP_113626.1| nudix -type motif 12; nucleoside di... 35 0.38
gi|42520409|ref|NP_966324.1| ankyrin repeat domain protein [Wolb... 35 0.38
gi|41053899|ref|NP_956276.1| Unknown (protein for MGC:63531); wu... 35 0.38
gi|28478836|ref|XP_129827.2| RIKEN cDNA C030004B10 [Mus musculus... 35 0.38
gi|49089652|ref|XP_406485.1| hypothetical protein AN2348.2 [Aspe... 35 0.38
gi|47222252|emb|CAG11131.1| unnamed protein product [Tetraodon n... 35 0.38
gi|16125885|ref|NP_420449.1| ankyrin-related protein [Caulobacte... 35 0.38
gi|46445449|gb|EAL04717.1| hypothetical protein CaO19.4729 [Cand... 35 0.38
gi|23503067|sp|Q00420|GABB_MOUSE GA binding protein beta chain (... 35 0.38
gi|46226781|gb|EAK87747.1| Ank repeat protein with possible sign... 35 0.38
gi|46120398|ref|XP_385022.1| hypothetical protein FG04846.1 [Gib... 35 0.38
gi|49121845|ref|XP_412441.1| hypothetical protein AN8304.2 [Aspe... 35 0.38
gi|33466096|gb|AAQ19487.1| GA binding protein subunit beta1 [Mus... 35 0.38
gi|49259167|pdb|1SVX|A Chain A, Crystal Structure Of A Designed ... 35 0.38
gi|2981726|pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND... 35 0.38
gi|7445893|pir||T05360 probable potassium channel protein F8B4.2... 33 0.49
gi|15236820|ref|NP_194976.1| potassium channel protein, putative... 33 0.49
gi|6686817|emb|CAB64728.1| putative potassium channel [Arabidops... 33 0.49
gi|34852246|ref|XP_228027.2| hypothetical protein XP_228027 [Rat... 35 0.50
gi|7020277|dbj|BAA91061.1| unnamed protein product [Homo sapiens] 35 0.50
gi|47213224|emb|CAF89745.1| unnamed protein product [Tetraodon n... 35 0.50
gi|26006277|dbj|BAC41481.1| mKIAA1728 protein [Mus musculus] 35 0.50
gi|19921030|ref|NP_609333.1| CG5846-PA [Drosophila melanogaster]... 35 0.50
gi|47230685|emb|CAF99878.1| unnamed protein product [Tetraodon n... 35 0.50
gi|48716529|dbj|BAD23133.1| putative ankyrin-like protein [Oryza... 35 0.50
gi|26328183|dbj|BAC27832.1| unnamed protein product [Mus musculus] 35 0.50
gi|47226452|emb|CAG08468.1| unnamed protein product [Tetraodon n... 35 0.50
gi|46445038|gb|EAL04309.1| hypothetical protein CaO19.13382 [Can... 35 0.50
gi|31241371|ref|XP_321116.1| ENSANGP00000018360 [Anopheles gambi... 35 0.50
gi|20913927|ref|XP_126635.1| RIKEN cDNA 1110033I14 [Mus musculus... 35 0.50
gi|50251586|dbj|BAD29152.1| ankyrin-like protein [Oryza sativa (... 35 0.50
gi|27690902|ref|XP_213541.1| similar to protein phosphatase 1, r... 35 0.50
gi|8980432|emb|CAA65254.1| potassium channel [Lycopersicon escul... 35 0.50
gi|50811821|ref|NP_001002854.1| TPR domain, ankyrin-repeat and c... 35 0.50
gi|50760441|ref|XP_418023.1| PREDICTED: similar to Ankyrin repea... 35 0.50
gi|38683797|ref|NP_056060.1| ankyrin repeat and sterile alpha mo... 35 0.50
gi|29250225|gb|EAA41722.1| GLP_554_17664_16207 [Giardia lamblia ... 35 0.50
gi|47230088|emb|CAG10502.1| unnamed protein product [Tetraodon n... 35 0.50
gi|39596149|emb|CAE69786.1| Hypothetical protein CBG16074 [Caeno... 35 0.50
gi|1504038|dbj|BAA13218.1| similar to human ankyrin 1(S08275) [H... 35 0.50
gi|38083691|ref|XP_289703.2| similar to cortactin binding protei... 35 0.50
gi|34854699|ref|XP_229944.2| similar to KIAA1728 protein [Rattus... 35 0.50
gi|38074775|ref|XP_130249.3| RIKEN cDNA 1200003E16 [Mus musculus] 35 0.50
gi|50511093|dbj|BAD32532.1| mKIAA1758 protein [Mus musculus] 35 0.50
gi|50808535|ref|XP_424609.1| PREDICTED: similar to hypothetical ... 35 0.50
gi|13542230|ref|NP_111918.1| Ankyrin repeat protein [Thermoplasm... 35 0.50
gi|47219311|emb|CAG10940.1| unnamed protein product [Tetraodon n... 30 0.53
gi|47225526|emb|CAG12009.1| unnamed protein product [Tetraodon n... 34 0.65
gi|38683816|ref|NP_942592.1| ankyrin repeat domain protein 17 is... 34 0.65
gi|40549395|ref|NP_932127.2| ankyrin repeat domain protein 17 is... 34 0.65
gi|15208191|dbj|BAB63120.1| hypothetical protein [Macaca fascicu... 34 0.65
gi|50728162|ref|XP_416012.1| PREDICTED: similar to Gasz [Gallus ... 34 0.65
gi|49091538|ref|XP_407230.1| hypothetical protein AN3093.2 [Aspe... 34 0.65
gi|33869762|gb|AAH04173.1| ANKRD17 protein [Homo sapiens] 34 0.65
gi|40549397|ref|NP_112148.2| ankyrin repeat domain protein 17 is... 34 0.65
gi|38683807|ref|NP_115593.3| ankyrin repeat domain protein 17 is... 34 0.65
gi|34876677|ref|XP_214012.2| similar to gene trap ankyrin repeat... 34 0.65
gi|50746677|ref|XP_420605.1| PREDICTED: similar to ankyrin repea... 34 0.65
gi|20522002|dbj|BAB47505.2| KIAA1876 protein [Homo sapiens] 34 0.65
gi|14211561|dbj|BAB56104.1| GLP1 [Homo sapiens] 34 0.65
gi|39584744|emb|CAE67639.1| Hypothetical protein CBG13198 [Caeno... 34 0.65
gi|12963869|gb|AAK07672.1| gene trap ankyrin repeat containing p... 34 0.65
gi|47218572|emb|CAG10271.1| unnamed protein product [Tetraodon n... 34 0.65
gi|47211783|emb|CAF93751.1| unnamed protein product [Tetraodon n... 34 0.65
gi|7505273|pir||T16553 hypothetical protein K04C2.4 - Caenorhabd... 34 0.65
gi|20521133|dbj|BAA31672.2| KIAA0697 protein [Homo sapiens] 34 0.65
gi|41150580|ref|XP_371086.1| similar to dysferlin-interacting pr... 34 0.65
gi|46138163|ref|XP_390772.1| hypothetical protein FG10596.1 [Gib... 34 0.65
gi|34864697|ref|XP_236353.2| similar to hypothetical protein [Ra... 34 0.65
gi|48099070|ref|XP_392574.1| similar to hypothetical protein D1E... 34 0.65
gi|38014011|gb|AAH11608.2| Eu-HMTase1 protein [Homo sapiens] 34 0.65
gi|24987851|pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) >gn... 34 0.65
gi|24987853|pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) >gn... 34 0.65
gi|21732410|emb|CAD38571.1| hypothetical protein [Homo sapiens] 34 0.65
gi|47229206|emb|CAG03958.1| unnamed protein product [Tetraodon n... 34 0.65
gi|50415115|gb|AAH77360.1| Unknown (protein for MGC:81366) [Xeno... 34 0.65
gi|21740668|emb|CAD41131.1| OSJNBa0084K20.9 [Oryza sativa (japon... 34 0.65
gi|32565798|ref|NP_498498.2| BRCA1-associated Ring Domain protei... 34 0.65
gi|48838377|ref|ZP_00295321.1| COG0666: FOG: Ankyrin repeat [Met... 34 0.65
gi|32408383|ref|XP_324673.1| hypothetical protein [Neurospora cr... 34 0.65
gi|40217808|ref|NP_079033.3| euchromatic histone methyltransfera... 34 0.65
gi|25090571|sp|Q9H9B1|HMT1_HUMAN Histone-lysine N-methyltransfer... 34 0.65
gi|23115916|ref|ZP_00100747.1| COG0666: FOG: Ankyrin repeat [Des... 34 0.65
gi|28870743|ref|NP_793362.1| ankyrin domain protein [Pseudomonas... 34 0.65
gi|30682817|ref|NP_180131.2| potassium channel protein, putative... 34 0.85
gi|44887678|sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 (Shaker ... 34 0.85
gi|46127555|ref|XP_388331.1| hypothetical protein FG08155.1 [Gib... 34 0.85
gi|31088892|ref|NP_852078.1| ankyrin repeat and sterile alpha mo... 34 0.85
gi|48139684|ref|XP_393472.1| similar to Probable phenylalanyl-tR... 34 0.85
gi|46112797|ref|XP_383076.1| hypothetical protein FG02900.1 [Gib... 34 0.85
gi|24216755|ref|NP_714236.1| Ankyrin repeat proteins [Leptospira... 34 0.85
gi|17550756|ref|NP_510540.1| ankyrin (66.5 kD) (XP981) [Caenorha... 34 0.85
gi|47215351|emb|CAG12585.1| unnamed protein product [Tetraodon n... 34 0.85
gi|992626|emb|CAA62625.1| XrpFIbeta1 [Xenopus laevis] 34 0.85
gi|28302287|gb|AAH46663.1| Gabpb1-prov protein [Xenopus laevis] 34 0.85
gi|32415629|ref|XP_328293.1| hypothetical protein [Neurospora cr... 34 0.85
gi|48847003|ref|ZP_00301261.1| COG0666: FOG: Ankyrin repeat [Geo... 34 0.85
gi|41017423|sp|Q9XZC0|LCTA_LATMA Alpha-latrocrustotoxin (Alpha-L... 34 0.85
gi|26343065|dbj|BAC35189.1| unnamed protein product [Mus musculus] 34 0.85
gi|46139737|ref|XP_391559.1| hypothetical protein FG11383.1 [Gib... 34 0.85
gi|24214963|ref|NP_712444.1| Ankyrin repeat proteins [Leptospira... 34 0.85
gi|46401923|ref|YP_006666.1| RPXV022 [Rabbitpox virus] >gnl|BL_O... 34 0.85
gi|14586362|emb|CAC42893.1| putative protein [Arabidopsis thaliana] 34 0.85
gi|31210717|ref|XP_314325.1| ENSANGP00000001193 [Anopheles gambi... 34 0.85
gi|45659057|ref|YP_003143.1| ankyrin-like protein [Leptospira in... 34 0.85
gi|47218162|emb|CAG10082.1| unnamed protein product [Tetraodon n... 34 0.85
gi|49080628|ref|XP_403811.1| hypothetical protein UM06196.1 [Ust... 34 0.85
gi|47211441|emb|CAF93693.1| unnamed protein product [Tetraodon n... 34 0.85
gi|28850414|gb|AAO53180.1| hypothetical protein [Dictyostelium d... 34 0.85
gi|46118594|ref|XP_384894.1| hypothetical protein FG04718.1 [Gib... 34 0.85
gi|46447248|ref|YP_008613.1| conserved hypothetical protein [Par... 34 0.85
gi|34875868|ref|XP_237153.2| similar to hypothetical protein DKF... 34 0.85
gi|45506040|ref|ZP_00158402.1| COG0666: FOG: Ankyrin repeat [Ana... 34 0.85
gi|18254470|ref|NP_543147.1| ankyrin repeat and SOCS box-contain... 34 0.85
gi|45657541|ref|YP_001627.1| ankyrin repeat protein [Leptospira ... 34 0.85
gi|27948808|gb|AAO25596.1| SWI6 [Kluyveromyces delphensis] 34 0.85
gi|47220184|emb|CAG07325.1| unnamed protein product [Tetraodon n... 34 0.85
gi|47228380|emb|CAG05200.1| unnamed protein product [Tetraodon n... 34 0.85
gi|26451600|dbj|BAC42897.1| putative potassium transporter/chann... 34 0.85
gi|50405105|ref|YP_054197.1| hypothetical protein, ankyrin repea... 34 0.85
gi|46117326|ref|XP_384681.1| hypothetical protein FG04505.1 [Gib... 34 0.85
gi|29250430|gb|EAA41924.1| GLP_39_57701_61939 [Giardia lamblia A... 34 0.85
gi|31240375|ref|XP_320601.1| ENSANGP00000008728 [Anopheles gambi... 34 0.85
gi|6691805|emb|CAB65850.1| EG:BACR37P7.2 [Drosophila melanogaster] 34 0.85
gi|38109131|gb|EAA55045.1| hypothetical protein MG06702.4 [Magna... 34 0.85
gi|39579503|emb|CAE56868.1| Hypothetical protein CBG24701 [Caeno... 34 0.85
gi|50760590|ref|XP_418072.1| PREDICTED: similar to KIAA1636 prot... 34 0.85
gi|30684047|ref|NP_568265.2| ankyrin repeat family protein [Arab... 34 0.85
gi|34531701|dbj|BAC86204.1| unnamed protein product [Homo sapiens] 34 0.85
gi|7496874|pir||T19653 hypothetical protein C33A11.1 - Caenorhab... 34 0.85
gi|46315433|ref|ZP_00216015.1| COG0666: FOG: Ankyrin repeat [Bur... 34 0.85
gi|47214458|emb|CAF95793.1| unnamed protein product [Tetraodon n... 34 0.85
gi|37359852|dbj|BAC97904.1| mKIAA0229 protein [Mus musculus] 34 0.85
gi|19112571|ref|NP_595779.1| ankyrin repeat-containing yeast yar... 34 0.85
gi|37576203|gb|AAQ93811.1| ankyrin repeat protein mbp3_5 [synthe... 34 0.85
gi|46126459|ref|XP_387783.1| hypothetical protein FG07607.1 [Gib... 34 0.85
gi|41724422|ref|ZP_00151259.1| COG0666: FOG: Ankyrin repeat [Dec... 34 0.85
gi|48140579|ref|XP_397133.1| similar to fem-1 homolog b; FEM-1-l... 32 1.1
gi|47223787|emb|CAF98557.1| unnamed protein product [Tetraodon n... 33 1.1
gi|7496368|pir||T32258 hypothetical protein C24A1.3 - Caenorhabd... 33 1.1
gi|7511311|pir||T27995 hypothetical protein ZK792.4 - Caenorhabd... 33 1.1
gi|17552278|ref|NP_497240.1| protein-tyrosine kinase, possibly N... 33 1.1
gi|28144863|ref|NP_083786.1| BCL-6 interacting corepressor isofo... 33 1.1
gi|28492296|ref|XP_143418.2| similar to hypothetical protein FLJ... 33 1.1
gi|37231432|gb|AAH09675.2| BCOR protein [Homo sapiens] 33 1.1
gi|15236325|ref|NP_192259.1| ankyrin repeat family protein [Arab... 33 1.1
gi|15207851|dbj|BAB62950.1| hypothetical protein [Macaca fascicu... 33 1.1
gi|38083695|ref|XP_133002.3| RIKEN cDNA 4930532L20 [Mus musculus] 33 1.1
gi|29655045|ref|NP_820737.1| ankyrin repeat domain protein [Coxi... 33 1.1
gi|49093496|ref|XP_408209.1| hypothetical protein AN4072.2 [Aspe... 33 1.1
gi|41281859|ref|NP_778210.1| BCL-6 interacting corepressor isofo... 33 1.1
gi|35193142|gb|AAH58656.1| Bcor protein [Mus musculus] 33 1.1
gi|12852185|dbj|BAB29308.1| unnamed protein product [Mus musculus] 33 1.1
gi|38511409|gb|AAH60720.1| Caskin1 protein [Mus musculus] 33 1.1
gi|34783587|gb|AAH50586.2| Unknown (protein for IMAGE:6159555) [... 33 1.1
gi|34858270|ref|XP_345259.1| similar to hypothetical protein FLJ... 33 1.1
gi|34852976|ref|XP_342380.1| similar to RIKEN cDNA 9230102N17 [R... 33 1.1
gi|25147076|ref|NP_509620.2| ankyrin (XK235) [Caenorhabditis ele... 33 1.1
gi|41281843|ref|NP_778209.1| BCL-6 interacting corepressor isofo... 33 1.1
gi|50260633|gb|EAL23286.1| hypothetical protein CNBA4020 [Crypto... 33 1.1
gi|50755693|ref|XP_414857.1| PREDICTED: similar to CASK interact... 33 1.1
gi|6323211|ref|NP_013283.1| Transcription cofactor, forms comple... 33 1.1
gi|39593779|emb|CAE62072.1| Hypothetical protein CBG06095 [Caeno... 33 1.1
gi|7495860|pir||T19193 hypothetical protein C11E4.6 - Caenorhabd... 33 1.1
gi|39645579|gb|AAH63622.1| Unknown (protein for MGC:70444) [Homo... 33 1.1
gi|46123231|ref|XP_386169.1| hypothetical protein FG05993.1 [Gib... 33 1.1
gi|41281849|ref|NP_778211.1| BCL-6 interacting corepressor isofo... 33 1.1
gi|28494624|ref|XP_289760.1| similar to hypothetical protein FLJ... 33 1.1
gi|15341604|gb|AAK16185.2| putative ankyrin [Oryza sativa (japon... 33 1.1
gi|37360318|dbj|BAC98137.1| mKIAA1306 protein [Mus musculus] 33 1.1
gi|7445895|pir||T07651 potassium channel protein SKT1 - potato >... 33 1.1
gi|15207933|dbj|BAB62991.1| hypothetical protein [Macaca fascicu... 33 1.1
gi|21071037|ref|NP_060215.4| BCL-6 interacting corepressor isofo... 33 1.1
gi|48121540|ref|XP_396483.1| similar to ENSANGP00000018360 [Apis... 33 1.1
gi|2120720|pir||JC4356 ankyrin precursor - Pseudomonas syringae ... 33 1.1
gi|26333463|dbj|BAC30449.1| unnamed protein product [Mus musculus] 33 1.1
gi|1754534|gb|AAC61658.1| ankyrin AnkF [Pseudomonas syringae pv.... 33 1.1
gi|29248244|gb|EAA39783.1| GLP_36_34726_38091 [Giardia lamblia A... 33 1.1
gi|38082073|ref|XP_196170.3| similar to cask-interacting protein... 33 1.1
gi|34933221|ref|XP_228716.2| similar to BCL-6 corepressor isofor... 33 1.1
gi|41054071|ref|NP_956168.1| ankyrin repeat and SOCS box-contain... 33 1.1
gi|18093104|ref|NP_542421.1| cask-interacting protein 1 [Rattus ... 33 1.1
gi|18079216|ref|NP_065815.1| CASK interacting protein 1 [Homo sa... 33 1.1
gi|26345898|dbj|BAC36600.1| unnamed protein product [Mus musculus] 33 1.1
gi|39586131|emb|CAE69207.1| Hypothetical protein CBG15247 [Caeno... 33 1.1
gi|47523973|ref|NP_998243.1| protein kinase PKK [Danio rerio] >g... 33 1.1
gi|17544630|ref|NP_502211.1| ankyrin (56.0 kD) (4M444) [Caenorha... 33 1.1
gi|46592863|ref|NP_082213.1| CASK interacting protein 1 [Mus mus... 33 1.1
gi|24432065|ref|NP_653299.2| hypothetical protein FLJ25124 [Homo... 33 1.1
gi|38018406|gb|AAR08265.1| BCL-6 corepressor long isoform [Homo ... 33 1.1
gi|37360460|dbj|BAC98208.1| mKIAA1575 protein [Mus musculus] 33 1.1
gi|24583364|ref|NP_723568.1| CG31715-PA [Drosophila melanogaster... 33 1.1
gi|6137552|pdb|1SW6|A Chain A, S. Cerevisiae Swi6 Ankyrin-Repeat... 33 1.1
gi|49129321|ref|XP_412904.1| hypothetical protein AN8767.2 [Aspe... 33 1.1
gi|18073524|emb|CAC83292.1| poly-ankyrin [Geodia cydonium] 33 1.1
gi|23472184|ref|ZP_00127511.1| COG0666: FOG: Ankyrin repeat [Pse... 33 1.1
gi|5052341|gb|AAD38511.1| ankyrin AnkB [Pseudomonas syringae pv.... 33 1.1
gi|34784556|gb|AAH56938.1| Ehmt1 protein [Mus musculus] 33 1.4
gi|465425|sp|P33825|VM01_VARV Protein M1 33 1.4
gi|34785717|gb|AAH57317.1| Dapk1 protein [Mus musculus] >gnl|BL_... 33 1.4
gi|38090672|ref|XP_354558.1| similar to E2a-Pbx1-associated prot... 33 1.4
gi|30584995|gb|AAP36770.1| Homo sapiens GA binding protein trans... 33 1.4
gi|34873590|ref|XP_225138.2| similar to Dapk1 protein [Rattus no... 33 1.4
gi|21356447|ref|NP_648148.1| CG7462-PC [Drosophila melanogaster]... 33 1.4
gi|47225182|emb|CAF98809.1| unnamed protein product [Tetraodon n... 33 1.4
gi|46138133|ref|XP_390757.1| hypothetical protein FG10581.1 [Gib... 33 1.4
gi|31208581|ref|XP_313257.1| ENSANGP00000010409 [Anopheles gambi... 33 1.4
gi|17553810|ref|NP_499014.1| notch-like transmembrane receptor, ... 33 1.4
gi|38085055|ref|XP_129246.4| RIKEN cDNA 5430432P15 [Mus musculus] 33 1.4
gi|32471000|ref|NP_863993.1| ankyrin-related protein [Pirellula ... 33 1.4
gi|7445894|pir||T03939 potassium channel protein - maize >gnl|BL... 33 1.4
gi|46117464|ref|XP_384750.1| hypothetical protein FG04574.1 [Gib... 33 1.4
gi|50511945|ref|NP_690001.3| cajalin 2 isoform a; amyloid-beta p... 33 1.4
gi|9627539|ref|NP_042062.1| O1L [Variola virus] >gnl|BL_ORD_ID|1... 33 1.4
gi|29692136|gb|AAO89309.1| ankyrin-like protein [Vaccinia virus] 33 1.4
gi|9790939|ref|NP_063666.1| putative ankyrin isoform [Vaccinia v... 33 1.4
gi|6969670|gb|AAF33882.1| TM1L [Vaccinia virus (strain Tian Tan)] 33 1.4
gi|49098288|ref|XP_410604.1| hypothetical protein AN6467.2 [Aspe... 33 1.4
gi|34877954|ref|XP_346081.1| similar to RIKEN cDNA 0610016O18 [R... 33 1.4
gi|45551532|ref|NP_729285.2| CG7462-PB [Drosophila melanogaster]... 33 1.4
gi|893320|gb|AAA69611.1| protein M1 33 1.4
gi|50728542|ref|XP_416169.1| PREDICTED: similar to E2a-Pbx1-asso... 33 1.4
gi|8051599|ref|NP_057739.1| GA binding protein transcription fac... 33 1.4
gi|13470466|ref|NP_102035.1| unknown protein [Mesorhizobium loti... 33 1.4
gi|29246497|gb|EAA38091.1| GLP_127_8582_9757 [Giardia lamblia AT... 33 1.4
gi|34858655|ref|XP_342514.1| similar to GA binding protein trans... 33 1.4
gi|477983|pir||C48146 nuclear respiratory factor-2 beta-2 chain ... 33 1.4
gi|34883007|ref|XP_346239.1| similar to ankyrin 3, epithelial is... 33 1.4
gi|286023|dbj|BAA02573.1| transcription factor E4TF1-47 [Homo sa... 33 1.4
gi|47226717|emb|CAG07876.1| unnamed protein product [Tetraodon n... 33 1.4
gi|27369762|ref|NP_766133.1| euchromatic histone methyltransfera... 33 1.4
>gi|17540146|ref|NP_500825.1| feminization 1 homolog a like,
FEMinization of XX and XO animals FEM-1 (fem-1)
[Caenorhabditis elegans]
gi|14574183|gb|AAK68379.1| Feminization of xx and xo animals
protein 1, isoform b [Caenorhabditis elegans]
Length = 104
Score = 221 bits (563), Expect = 3e-57
Identities = 104/104 (100%), Positives = 104/104 (100%)
Frame = -1
Query: 315 MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWIIDCFNSDQDGRYPLVIAARNGH 136
MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWIIDCFNSDQDGRYPLVIAARNGH
Sbjct: 1 MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWIIDCFNSDQDGRYPLVIAARNGH 60
Query: 135 ANVVEYLLEIGADPSVRGVVEFDNENILFRRNTSFVGCLRCWTH 4
ANVVEYLLEIGADPSVRGVVEFDNENILFRRNTSFVGCLRCWTH
Sbjct: 61 ANVVEYLLEIGADPSVRGVVEFDNENILFRRNTSFVGCLRCWTH 104