Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F35C5_3
(1185 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17533675|ref|NP_496739.1| mature parasite-infected erythrocyt... 602 e-171
gi|34871234|ref|XP_220323.2| similar to activated in Blocked Unf... 109 1e-22
gi|45553073|ref|NP_996064.1| CG33265-PA [Drosophila melanogaster... 103 6e-21
gi|24641644|ref|NP_727652.1| CG32644-PB [Drosophila melanogaster... 99 1e-19
gi|48870343|ref|ZP_00323067.1| COG4932: Predicted outer membrane... 99 1e-19
gi|48891876|ref|ZP_00325325.1| COG3210: Large exoproteins involv... 99 2e-19
gi|16122929|ref|NP_406242.1| conserved hypothetical protein [Yer... 97 7e-19
gi|33310026|gb|AAQ03243.1| putative cell wall protein FLO11p [Ca... 97 7e-19
gi|17221114|gb|AAK61484.1| glycoprotein gp2 [Equine herpesvirus 1] 96 2e-18
gi|50313312|ref|YP_053115.1| membrane glycoprotein [Equine herpe... 96 2e-18
gi|13277318|emb|CAC34385.1| putative cellulosomal anchoring prot... 95 3e-18
gi|17566006|ref|NP_505150.1| putative protein (5I806) [Caenorhab... 94 5e-18
gi|50305509|ref|XP_452714.1| unnamed protein product [Kluyveromy... 94 6e-18
gi|42795202|gb|AAS45959.1| envelope glycoprotein [Equine herpesv... 94 8e-18
gi|48824054|ref|ZP_00285484.1| hypothetical protein Efae03002600... 93 1e-17
gi|17221126|gb|AAK61490.1| glycoprotein gp2 [Equine herpesvirus 4] 92 2e-17
gi|39590335|emb|CAE66074.1| Hypothetical protein CBG11288 [Caeno... 92 3e-17
gi|17221106|gb|AAK61480.1| glycoprotein gp2 [Equine herpesvirus 1] 92 3e-17
gi|48120927|ref|XP_396472.1| similar to CG33103-PA [Apis mellifera] 92 3e-17
gi|17221112|gb|AAK61483.1| glycoprotein gp2 [Equine herpesvirus 1] 91 7e-17
gi|17221102|gb|AAK61478.1| glycoprotein gp2 [Equine herpesvirus 1] 91 7e-17
gi|17221124|gb|AAK61489.1| glycoprotein gp2 [Equine herpesvirus 4] 90 9e-17
gi|50306747|ref|XP_453348.1| unnamed protein product [Kluyveromy... 90 9e-17
gi|38492189|gb|AAR22399.1| antigenic cell wall protein MP2 [Aspe... 90 1e-16
gi|111979|pir||A39321 mucin - rat (fragment) >gnl|BL_ORD_ID|6277... 90 1e-16
gi|17221100|gb|AAK61477.1| glycoprotein gp2 [Equine herpesvirus 1] 90 1e-16
gi|17221116|gb|AAK61485.1| glycoprotein gp2 [Equine herpesvirus 1] 90 1e-16
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati... 89 2e-16
gi|17221098|gb|AAK61476.1| glycoprotein gp2 [Equine herpesvirus 1] 89 2e-16
gi|11278206|pir||T45463 membrane glycoprotein [imported] - equin... 89 2e-16
gi|17221104|gb|AAK61479.1| glycoprotein gp2 [Equine herpesvirus 1] 89 2e-16
gi|27469167|ref|NP_765804.1| streptococcal hemagglutinin protein... 89 2e-16
gi|17221110|gb|AAK61482.1| glycoprotein gp2 [Equine herpesvirus 1] 89 2e-16
gi|17221108|gb|AAK61481.1| glycoprotein gp2 [Equine herpesvirus 1] 88 3e-16
gi|17221120|gb|AAK61487.1| glycoprotein gp2 [Equine herpesvirus 4] 88 4e-16
gi|17221122|gb|AAK61488.1| glycoprotein gp2 [Equine herpesvirus 4] 88 4e-16
gi|11278205|pir||T45462 membrane glycoprotein [imported] - equin... 87 6e-16
gi|6322611|ref|NP_012685.1| Delayed Anaerobic Gene; Dan4p [Sacch... 87 8e-16
gi|32565595|ref|NP_872044.1| n/apple PAN (2L509) [Caenorhabditis... 87 8e-16
gi|17568435|ref|NP_508295.1| putative protein family member (XC1... 87 8e-16
gi|17536061|ref|NP_496398.1| n/apple PAN (2L509) [Caenorhabditis... 87 8e-16
gi|17221118|gb|AAK61486.1| glycoprotein gp2 [Equine herpesvirus 4] 87 8e-16
gi|31232507|ref|XP_318717.1| ENSANGP00000004655 [Anopheles gambi... 86 2e-15
gi|50307991|ref|XP_453995.1| unnamed protein product [Kluyveromy... 85 3e-15
gi|9629801|ref|NP_045288.1| 71 [Equine herpesvirus 4] >gnl|BL_OR... 85 3e-15
gi|24658342|ref|NP_647965.1| CG4835-PA [Drosophila melanogaster]... 85 4e-15
gi|31197257|ref|XP_307576.1| ENSANGP00000023198 [Anopheles gambi... 84 6e-15
gi|39583830|emb|CAE74903.1| Hypothetical protein CBG22772 [Caeno... 84 6e-15
gi|17561512|ref|NP_506158.1| predicted CDS, putative protein fam... 84 8e-15
gi|39583089|emb|CAE60629.1| Hypothetical protein CBG04272 [Caeno... 84 8e-15
gi|17221144|gb|AAK58439.1| glycoprotein gp2 [Equine herpesvirus 4] 83 1e-14
gi|18072158|gb|AAL58470.1| serine-threonine rich antigen [Staphy... 83 1e-14
gi|38108069|gb|EAA54157.1| hypothetical protein MG02142.4 [Magna... 82 2e-14
gi|11359724|pir||T46726 secreted acid phosphatase 2 precursor [i... 81 4e-14
gi|22125449|ref|NP_668872.1| hypothetical [Yersinia pestis KIM] ... 81 4e-14
gi|15925644|ref|NP_373178.1| hypothetical protein SAV2654 [Staph... 81 5e-14
gi|6164595|gb|AAF04457.1| lacunin [Manduca sexta] 81 5e-14
gi|31206185|ref|XP_312044.1| ENSANGP00000016899 [Anopheles gambi... 81 5e-14
gi|46114692|ref|XP_383364.1| hypothetical protein FG03188.1 [Gib... 80 9e-14
gi|49487433|ref|YP_044654.1| putative cell wall-anchored protein... 80 9e-14
gi|21284304|ref|NP_647392.1| ORFID:MW2575~hypothetical protein, ... 80 9e-14
gi|39580036|emb|CAE71562.1| Hypothetical protein CBG18512 [Caeno... 80 9e-14
gi|50545139|ref|XP_500107.1| hypothetical protein [Yarrowia lipo... 80 1e-13
gi|23025176|ref|ZP_00064342.1| COG5263: FOG: Glucan-binding doma... 80 1e-13
gi|39581384|emb|CAE69281.1| Hypothetical protein CBG15335 [Caeno... 80 1e-13
gi|39590900|emb|CAE58680.1| Hypothetical protein CBG01854 [Caeno... 80 1e-13
gi|39581385|emb|CAE69282.1| Hypothetical protein CBG15336 [Caeno... 79 2e-13
gi|34869658|ref|XP_223942.2| similar to loricrin - mouse [Rattus... 79 3e-13
gi|21229126|ref|NP_635048.1| conserved protein [Methanosarcina m... 77 6e-13
gi|20128875|ref|NP_569927.1| CG14796-PA [Drosophila melanogaster... 77 6e-13
gi|9367038|gb|AAF87093.1| secreted antigen SagBb [Enterococcus h... 77 6e-13
gi|33300082|emb|CAE17706.1| Hypothetical protein C30H6.11 [Caeno... 77 8e-13
gi|6319355|ref|NP_009437.1| Hypothetical ORF; Ybl113cp [Saccharo... 77 8e-13
gi|39590902|emb|CAE58682.1| Hypothetical protein CBG01856 [Caeno... 77 1e-12
gi|28572038|ref|NP_788751.1| CG33103-PB [Drosophila melanogaster... 76 1e-12
gi|17221146|gb|AAK58440.1| glycoprotein gp2 [Equine herpesvirus 4] 76 1e-12
gi|25152063|ref|NP_509435.2| putative protein, with 2 coiled coi... 76 1e-12
gi|28572036|ref|NP_788752.1| CG33103-PA [Drosophila melanogaster... 76 1e-12
gi|24582793|ref|NP_723377.1| CG31901-PA [Drosophila melanogaster... 76 1e-12
gi|45188073|ref|NP_984296.1| ADR200Cp [Eremothecium gossypii] >g... 76 2e-12
gi|49481455|ref|YP_038736.1| cell division protein [Bacillus thu... 75 2e-12
gi|24662885|ref|NP_648504.1| CG6004-PB [Drosophila melanogaster]... 75 2e-12
gi|17221130|gb|AAK58432.1| glycoprotein gp2 [Equine herpesvirus 4] 75 2e-12
gi|7504248|pir||T22696 hypothetical protein F55B11.3 - Caenorhab... 75 2e-12
gi|18447198|gb|AAL68190.1| GH09355p [Drosophila melanogaster] 75 2e-12
gi|50548313|ref|XP_501626.1| hypothetical protein [Yarrowia lipo... 75 2e-12
gi|39596372|emb|CAE70010.1| Hypothetical protein CBG16424 [Caeno... 75 3e-12
gi|46120338|ref|XP_384992.1| hypothetical protein FG04816.1 [Gib... 75 3e-12
gi|31222787|ref|XP_317225.1| ENSANGP00000012001 [Anopheles gambi... 75 3e-12
gi|39581621|emb|CAE58406.1| Hypothetical protein CBG01536 [Caeno... 75 4e-12
gi|21309886|gb|AAM46085.1| putative regulatory protein [Candida ... 75 4e-12
gi|39590899|emb|CAE58679.1| Hypothetical protein CBG01853 [Caeno... 75 4e-12
gi|17535137|ref|NP_496184.1| location Of Vulva defective LOV-1, ... 74 5e-12
gi|39580035|emb|CAE71561.1| Hypothetical protein CBG18510 [Caeno... 74 5e-12
gi|7511432|pir||T21460 hypothetical protein ZK945.10 - Caenorhab... 74 5e-12
gi|29423264|gb|AAO84908.1| extracellular matrix protein papilin ... 74 7e-12
gi|11559520|gb|AAG37995.1| extracellular matrix protein papilin ... 74 7e-12
gi|29423262|gb|AAO84907.1| extracellular matrix protein papilin ... 74 7e-12
gi|38110510|gb|EAA56217.1| hypothetical protein MG01868.4 [Magna... 74 7e-12
gi|46128419|ref|XP_388763.1| hypothetical protein FG08587.1 [Gib... 74 9e-12
gi|50286497|ref|XP_445677.1| unnamed protein product [Candida gl... 74 9e-12
gi|31231947|ref|XP_318620.1| ENSANGP00000020885 [Anopheles gambi... 74 9e-12
gi|48098141|ref|XP_393988.1| similar to ENSANGP00000003674 [Apis... 73 1e-11
gi|24639647|ref|NP_726915.1| CG32774-PA [Drosophila melanogaster... 72 2e-11
gi|31222811|ref|XP_317227.1| ENSANGP00000025200 [Anopheles gambi... 72 2e-11
gi|50556110|ref|XP_505463.1| hypothetical protein [Yarrowia lipo... 72 2e-11
gi|15901602|ref|NP_346206.1| cell wall surface anchor family pro... 72 2e-11
gi|17534551|ref|NP_494923.1| putative protein (2F299) [Caenorhab... 72 2e-11
gi|45552307|ref|NP_995676.1| CG33300-PA [Drosophila melanogaster... 72 3e-11
gi|45553053|ref|NP_996054.1| CG18331-PA [Drosophila melanogaster... 72 3e-11
gi|627056|pir||A54641 interspersed repeat antigen precursor - ma... 72 3e-11
gi|50543316|ref|XP_499824.1| hypothetical protein [Yarrowia lipo... 72 3e-11
gi|17566582|ref|NP_505243.1| putative protein (5J182) [Caenorhab... 72 3e-11
gi|46444373|gb|EAL03648.1| hypothetical protein CaO19.9067 [Cand... 71 4e-11
gi|7499248|pir||T25697 hypothetical protein F16F9.2 - Caenorhabd... 71 4e-11
gi|28379317|ref|NP_786209.1| extracellular protein [Lactobacillu... 71 4e-11
gi|39590338|emb|CAE66077.1| Hypothetical protein CBG11292 [Caeno... 71 6e-11
gi|28574039|ref|NP_523475.2| CG3047-PA [Drosophila melanogaster]... 71 6e-11
gi|29374744|ref|NP_813896.1| cell wall surface anchor family pro... 71 6e-11
gi|46134297|ref|XP_389464.1| hypothetical protein FG09288.1 [Gib... 70 7e-11
gi|34876132|ref|XP_344463.1| similar to seven transmembrane heli... 70 7e-11
gi|20514774|ref|NP_620610.1| putative cell surface antigen [Ratt... 70 7e-11
gi|2136504|pir||I47141 gastric mucin (clone PGM-2A) - pig (fragm... 70 7e-11
gi|38094079|ref|XP_142623.2| similar to mucin MUC5B [Mus musculus] 70 1e-10
gi|38083062|ref|XP_289814.2| similar to Zonadhesin [Mus musculus] 70 1e-10
gi|48891397|ref|ZP_00324921.1| COG0631: Serine/threonine protein... 70 1e-10
gi|34871532|ref|XP_222025.2| similar to Zonadhesin [Rattus norve... 70 1e-10
gi|46127759|ref|XP_388433.1| hypothetical protein FG08257.1 [Gib... 70 1e-10
gi|37538639|ref|XP_168585.3| similar to mucin 11 [Homo sapiens] ... 69 2e-10
gi|24649873|ref|NP_651318.1| CG13648-PA [Drosophila melanogaster... 69 2e-10
gi|39589211|emb|CAE57944.1| Hypothetical protein CBG00999 [Caeno... 69 2e-10
gi|20385612|gb|AAM21357.1| mucin-like protein 1 [Ctenocephalides... 69 2e-10
gi|47565114|ref|ZP_00236157.1| reticulocyte binding protein [Bac... 69 2e-10
gi|19112069|ref|NP_595277.1| hypothetical protein; sequence orph... 69 2e-10
gi|50306211|ref|XP_453068.1| unnamed protein product [Kluyveromy... 69 2e-10
gi|49124753|ref|XP_412621.1| hypothetical protein AN8484.2 [Aspe... 69 2e-10
gi|13492037|gb|AAK28052.1| Zonadhesin >gnl|BL_ORD_ID|1548452 gi|... 69 2e-10
gi|46435639|gb|EAK95016.1| hypothetical protein CaO19.11553 [Can... 69 2e-10
gi|39592372|emb|CAE63449.1| Hypothetical protein CBG07908 [Caeno... 69 2e-10
gi|46439404|gb|EAK98722.1| hypothetical protein CaO19.12856 [Can... 69 3e-10
gi|23510008|ref|NP_702674.1| hypothetical protein [Plasmodium fa... 69 3e-10
gi|24646232|ref|NP_650174.1| CG4066-PA [Drosophila melanogaster]... 68 4e-10
gi|50285523|ref|XP_445190.1| unnamed protein product [Candida gl... 68 4e-10
gi|46117462|ref|XP_384749.1| hypothetical protein FG04573.1 [Gib... 68 4e-10
gi|39597324|emb|CAE59552.1| Hypothetical protein CBG02948 [Caeno... 68 4e-10
gi|48870355|ref|ZP_00323079.1| hypothetical protein PpenA0100100... 68 4e-10
gi|38101612|gb|EAA48551.1| hypothetical protein MG00209.4 [Magna... 68 4e-10
gi|6321451|ref|NP_011528.1| Protein that functions as an osmosen... 68 4e-10
gi|46445626|gb|EAL04894.1| hypothetical protein CaO19.4906 [Cand... 68 5e-10
gi|50548855|ref|XP_501897.1| hypothetical protein [Yarrowia lipo... 68 5e-10
gi|31222803|ref|XP_317226.1| ENSANGP00000022604 [Anopheles gambi... 68 5e-10
gi|17221136|gb|AAK58435.1| glycoprotein gp2 [Equine herpesvirus 4] 67 6e-10
gi|17221134|gb|AAK58434.1| glycoprotein gp2 [Equine herpesvirus 4] 67 6e-10
gi|45552373|ref|NP_995709.1| CG32972-PA [Drosophila melanogaster... 67 6e-10
gi|46139237|ref|XP_391309.1| hypothetical protein FG11133.1 [Gib... 67 6e-10
gi|6320166|ref|NP_010246.1| Hypothetical ORF; Ydl038cp [Saccharo... 67 6e-10
gi|7287821|gb|AAF44859.1| hypothetical protein [Drosophila melan... 67 6e-10
gi|50308763|ref|XP_454386.1| unnamed protein product [Kluyveromy... 67 8e-10
gi|3335680|gb|AAC27329.1| hyosophorin [Cyprinus carpio] 67 8e-10
gi|6322237|ref|NP_012311.1| Hypothetical ORF; Yjl225cp [Saccharo... 67 8e-10
gi|6322017|ref|NP_012092.1| Hypothetical ORF; Yil177cp [Saccharo... 67 8e-10
gi|50553414|ref|XP_504118.1| hypothetical protein [Yarrowia lipo... 67 8e-10
gi|46435796|gb|EAK95170.1| hypothetical protein CaO19.4072 [Cand... 67 8e-10
gi|663232|emb|CAA88141.1| orf [Saccharomyces cerevisiae] 67 8e-10
gi|45198426|ref|NP_985455.1| AFL095Wp [Eremothecium gossypii] >g... 67 1e-09
gi|39596126|emb|CAE69762.1| Hypothetical protein CBG16043 [Caeno... 67 1e-09
gi|46111133|ref|XP_382624.1| hypothetical protein FG02448.1 [Gib... 67 1e-09
gi|34879318|ref|XP_225993.2| similar to hypothetical protein [Ra... 67 1e-09
gi|6322209|ref|NP_012284.1| GPI-anchored cell surface glycoprote... 67 1e-09
gi|10048477|ref|NP_035871.1| zonadhesin [Mus musculus] >gnl|BL_O... 67 1e-09
gi|32411243|ref|XP_326102.1| hypothetical protein [Neurospora cr... 67 1e-09
gi|39584067|emb|CAE66473.1| Hypothetical protein CBG11752 [Caeno... 66 1e-09
gi|34861062|ref|XP_227826.2| similar to hypothetical protein [Ra... 66 1e-09
gi|46110341|ref|XP_382228.1| hypothetical protein FG02052.1 [Gib... 66 1e-09
gi|34868844|ref|XP_227162.2| similar to chimeric AFGP/trypsinoge... 66 1e-09
gi|1082604|pir||S53363 mucin 5AC (clone JER58) - human (fragment... 66 1e-09
gi|39583863|emb|CAE63953.1| Hypothetical protein CBG08535 [Caeno... 66 1e-09
gi|23478367|gb|EAA15475.1| immediate early protein homolog [Plas... 66 1e-09
gi|31540577|gb|AAP48996.1| cellulosomal scaffoldin anchoring pro... 66 2e-09
gi|17221128|gb|AAK58431.1| glycoprotein gp2 [Equine herpesvirus 4] 66 2e-09
gi|31241999|ref|XP_321430.1| ENSANGP00000022061 [Anopheles gambi... 66 2e-09
gi|32440607|emb|CAA21616.2| Hypothetical protein Y43F8C.16 [Caen... 66 2e-09
gi|40645464|dbj|BAD06577.1| cell wall protein Awa1p [Saccharomyc... 65 2e-09
gi|17221132|gb|AAK58433.1| glycoprotein gp2 [Equine herpesvirus 4] 65 2e-09
gi|32452989|gb|AAP82647.1| Hypothetical protein K06A9.1c [Caenor... 65 2e-09
gi|17568719|ref|NP_508292.1| putative protein family member (XC1... 65 2e-09
gi|6323978|ref|NP_014050.1| Hypothetical ORF; Ymr317wp [Saccharo... 65 2e-09
gi|19168493|dbj|BAB85832.1| cell wall protein Awa1p [Saccharomyc... 65 2e-09
gi|17568717|ref|NP_508293.1| putative protein family member (XC1... 65 2e-09
gi|17221142|gb|AAK58438.1| glycoprotein gp2 [Equine herpesvirus 4] 65 3e-09
gi|7108937|gb|AAF36548.1| 82-kDa surface lipoprotein precursor [... 65 3e-09
gi|48890538|ref|ZP_00324203.1| COG0155: Sulfite reductase, beta ... 65 3e-09
gi|1582765|prf||2119294A YFW1 gene 65 3e-09
gi|6321759|ref|NP_011835.1| cell wall integrity and stress respo... 65 3e-09
gi|6435840|gb|AAF08544.1| SPLF2 glycoprotein [Cercopithecine her... 65 3e-09
gi|49111144|ref|XP_411791.1| hypothetical protein AN7654.2 [Aspe... 65 3e-09
gi|48841332|ref|ZP_00298258.1| hypothetical protein Meth02000932... 65 3e-09
gi|48839559|ref|ZP_00296490.1| COG1404: Subtilisin-like serine p... 65 4e-09
gi|39581619|emb|CAE58404.1| Hypothetical protein CBG01534 [Caeno... 65 4e-09
gi|31209367|ref|XP_313650.1| ENSANGP00000003674 [Anopheles gambi... 65 4e-09
gi|19075531|ref|NP_588031.1| hypothetical protein with large rep... 65 4e-09
gi|7507975|pir||T34369 hypothetical protein T19D12.1 - Caenorhab... 64 5e-09
gi|17536319|ref|NP_495357.1| putative protein family member (2G9... 64 5e-09
gi|46445432|gb|EAL04701.1| hypothetical protein CaO19.12372 [Can... 64 5e-09
gi|2133239|pir||JC4566 chitinase (EC 3.2.1.14) 2 precursor - Coc... 64 5e-09
gi|39590304|emb|CAE66043.1| Hypothetical protein CBG11242 [Caeno... 64 5e-09
gi|1705806|sp|P54197|CHI2_COCIM Endochitinase 2 precursor >gnl|B... 64 5e-09
gi|46090783|dbj|BAD13529.1| collagen-binding adhesin [Streptococ... 64 5e-09
gi|6984160|gb|AAF34780.1| srpA [Streptococcus cristatus] 64 7e-09
gi|17561266|ref|NP_505801.1| protein of unknown function C6 and ... 64 7e-09
gi|24650473|ref|NP_651520.1| CG6296-PA [Drosophila melanogaster]... 64 7e-09
gi|46139599|ref|XP_391490.1| hypothetical protein FG11314.1 [Gib... 64 9e-09
gi|30421167|gb|AAP31051.1| D-Hordein [Hordeum vulgare] 64 9e-09
gi|41147656|ref|XP_168583.4| similar to intestinal membrane muci... 64 9e-09
gi|19112670|ref|NP_595878.1| hypothetical serine-rich repeat pro... 64 9e-09
gi|22086978|gb|AAM90827.1| basal body protein NBP-2 [Naegleria g... 64 9e-09
gi|38109209|gb|EAA55116.1| predicted protein [Magnaporthe grisea... 64 9e-09
gi|45686084|ref|YP_003847.1| unknown [Regina ranavirus] >gnl|BL_... 63 1e-08
gi|120184|sp|P06916|FIRA_PLAFF 300 KD ANTIGEN AG231 >gnl|BL_ORD_... 63 1e-08
gi|46117599|ref|XP_384810.1| hypothetical protein FG04634.1 [Gib... 63 1e-08
gi|50304613|ref|XP_452262.1| unnamed protein product [Kluyveromy... 63 2e-08
gi|28378774|ref|NP_785666.1| extracellular protein, gamma-D-glut... 63 2e-08
gi|23956252|ref|NP_536705.1| mucin 4 [Mus musculus] >gnl|BL_ORD_... 63 2e-08
gi|1363798|pir||S59310 probable membrane protein YMR317w - yeast... 63 2e-08
gi|41197087|ref|XP_371809.1| chromosome 6 open reading frame 205... 63 2e-08
gi|50308337|ref|XP_454170.1| unnamed protein product [Kluyveromy... 63 2e-08
gi|17563696|ref|NP_506388.1| tenascin (5O183) [Caenorhabditis el... 62 2e-08
gi|38050553|ref|XP_138063.2| similar to A-kinase anchor protein ... 62 2e-08
gi|23612219|ref|NP_703799.1| hypothetical protein [Plasmodium fa... 62 2e-08
gi|17536887|ref|NP_494654.1| brain-specific angiogenesis inhibit... 62 2e-08
gi|32412592|ref|XP_326776.1| hypothetical protein [Neurospora cr... 62 2e-08
gi|46126115|ref|XP_387611.1| hypothetical protein FG07435.1 [Gib... 62 2e-08
gi|4725988|emb|CAB41740.1| secretory protein (LS110p) [Litomosoi... 62 3e-08
gi|34872040|ref|XP_342942.1| similar to UROMODULIN PRECURSOR (TA... 62 3e-08
gi|48474505|sp|Q8TFG9|YL61_SCHPO Hypothetical serine/threonine-r... 62 3e-08
gi|46121707|ref|XP_385408.1| hypothetical protein FG05232.1 [Gib... 62 3e-08
gi|8885520|dbj|BAA97453.1| streptococcal hemagglutinin [Streptoc... 62 3e-08
gi|50410371|ref|XP_456954.1| unnamed protein product [Debaryomyc... 62 3e-08
gi|19571553|emb|CAD27464.1| SPAPB15E9.01c [Schizosaccharomyces p... 62 3e-08
gi|39582656|emb|CAE73760.1| Hypothetical protein CBG21295 [Caeno... 62 3e-08
gi|50746892|ref|XP_420663.1| PREDICTED: similar to endomucin-1, ... 62 3e-08
gi|39592304|emb|CAE75525.1| Hypothetical protein CBG23547 [Caeno... 62 3e-08
gi|17384256|emb|CAC83675.1| mucin 5 [Homo sapiens] 62 3e-08
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand... 62 3e-08
gi|39591918|emb|CAE75138.1| Hypothetical protein CBG23067 [Caeno... 62 3e-08
gi|39597992|emb|CAE68684.1| Hypothetical protein CBG14595 [Caeno... 62 3e-08
gi|1155358|gb|AAA97877.1| microfilarial sheath protein SHP3 prec... 62 3e-08
gi|7521941|pir||T17451 fimbriae-associated protein Fap1 - Strept... 61 4e-08
gi|7510771|pir||T29919 hypothetical protein ZC449.5 - Caenorhabd... 61 4e-08
gi|50547915|ref|XP_501427.1| hypothetical protein [Yarrowia lipo... 61 4e-08
gi|17570615|ref|NP_508857.1| putative protein (XF654) [Caenorhab... 61 4e-08
gi|46440903|gb|EAL00204.1| hypothetical protein CaO19.5537 [Cand... 61 4e-08
gi|23484531|gb|EAA19833.1| hypothetical protein [Plasmodium yoel... 61 4e-08
gi|39585368|emb|CAE61690.1| Hypothetical protein CBG05636 [Caeno... 61 4e-08
gi|46432363|gb|EAK91848.1| hypothetical protein CaO19.6302 [Cand... 61 6e-08
gi|46127509|ref|XP_388308.1| hypothetical protein FG08132.1 [Gib... 61 6e-08
gi|5911171|gb|AAD55679.1| mucin 11 [Homo sapiens] 60 8e-08
gi|46139243|ref|XP_391312.1| hypothetical protein FG11136.1 [Gib... 60 8e-08
gi|7511304|pir||T34513 hypothetical protein ZK783.1 - Caenorhabd... 60 8e-08
gi|2853297|gb|AAC02270.1| intestinal mucin [Homo sapiens] 60 8e-08
gi|50556390|ref|XP_505603.1| hypothetical protein [Yarrowia lipo... 60 8e-08
gi|46111927|ref|XP_383021.1| hypothetical protein FG02845.1 [Gib... 60 8e-08
gi|112674|sp|P13813|110K_PLAKN 110 kDa antigen (PK110) >gnl|BL_O... 60 8e-08
gi|21229025|ref|NP_634947.1| hypothetical protein MM2923 [Methan... 60 1e-07
gi|39595323|emb|CAE60360.1| Hypothetical protein CBG03957 [Caeno... 60 1e-07
gi|32565577|ref|NP_496139.2| sushi domain/SCR domain/CCP module ... 60 1e-07
gi|46121725|ref|XP_385417.1| hypothetical protein FG05241.1 [Gib... 60 1e-07
gi|172526|gb|AAA35015.1| S1 protein 60 1e-07
gi|9246950|gb|AAF86217.1| SagA [Enterococcus faecium] >gnl|BL_OR... 60 1e-07
gi|7499889|pir||T21389 hypothetical protein F26C11.3 - Caenorhab... 60 1e-07
gi|31207057|ref|XP_312495.1| ENSANGP00000022047 [Anopheles gambi... 60 1e-07
gi|48825680|ref|ZP_00286921.1| COG3883: Uncharacterized protein ... 60 1e-07
gi|46122683|ref|XP_385895.1| hypothetical protein FG05719.1 [Gib... 60 1e-07
gi|19913101|emb|CAC83649.1| putative autolysin [Staphylococcus c... 60 1e-07
gi|38083974|ref|XP_357599.1| similar to interspersed repeat anti... 60 1e-07
gi|1314324|gb|AAC59877.1| mucin-like; down-regulated by thyroid ... 60 1e-07
gi|282110|pir||C41859 IgA-specific metalloendopeptidase (EC 3.4.... 60 1e-07
gi|1170517|sp|P45386|IGA4_HAEIN Immunoglobulin A1 protease precu... 60 1e-07
gi|50553722|ref|XP_504272.1| hypothetical protein [Yarrowia lipo... 60 1e-07
gi|134786|sp|P10667|MUA1_XENLA Integumentary mucin A.1 precursor... 59 2e-07
gi|50304909|ref|XP_452410.1| unnamed protein product [Kluyveromy... 59 2e-07
gi|23510106|ref|NP_702772.1| DNA polymerase alpha [Plasmodium fa... 59 2e-07
gi|46435701|gb|EAK95077.1| hypothetical protein CaO19.8206 [Cand... 59 2e-07
gi|31206661|ref|XP_312297.1| ENSANGP00000021083 [Anopheles gambi... 59 2e-07
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb... 59 2e-07
gi|1085433|pir||S55316 mucin (clone PGM-2B) - pig >gnl|BL_ORD_ID... 59 2e-07
gi|50290765|ref|XP_447815.1| unnamed protein product [Candida gl... 59 2e-07
gi|17221140|gb|AAK58437.1| glycoprotein gp2 [Equine herpesvirus 4] 59 2e-07
gi|11346533|pir||T44657 protein GP80 [imported] - bovine herpesv... 59 2e-07
gi|24643200|ref|NP_573364.1| CG7874-PA [Drosophila melanogaster]... 59 2e-07
gi|6320756|ref|NP_010835.1| Hypothetical ORF; Yel077cp [Saccharo... 59 2e-07
gi|45934744|gb|AAS79426.1| dextransucrase [Leuconostoc mesentero... 59 2e-07
gi|46139783|ref|XP_391582.1| hypothetical protein FG11406.1 [Gib... 59 3e-07
gi|19923672|ref|NP_036922.2| dentin sailophosphoprotein; Dentin ... 59 3e-07
gi|46127731|ref|XP_388419.1| hypothetical protein FG08243.1 [Gib... 59 3e-07
gi|39584983|emb|CAE64407.1| Hypothetical protein CBG09099 [Caeno... 59 3e-07
gi|17534737|ref|NP_495358.1| g-protein beta WD-40 repeat family ... 59 3e-07
gi|48095295|ref|XP_394403.1| similar to ENSANGP00000017739 [Apis... 59 3e-07
gi|18766204|gb|AAL78899.1| merozoite surface protein-9 precursor... 58 4e-07
gi|13095628|ref|NP_076543.1| glycoprotein gp80 [Bovine herpesvir... 58 4e-07
gi|46126289|ref|XP_387698.1| hypothetical protein FG07522.1 [Gib... 58 4e-07
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand... 58 4e-07
gi|46432914|gb|EAK92376.1| hypothetical protein CaO19.3380 [Cand... 58 4e-07
gi|21402734|ref|NP_658719.1| FtsK_SpoIIIE, FtsK/SpoIIIE family [... 58 4e-07
gi|49187578|ref|YP_030831.1| FtsK/SpoIIIE family protein [Bacill... 58 4e-07
gi|45551991|ref|NP_733241.2| CG31253-PA [Drosophila melanogaster... 58 4e-07
gi|24637972|gb|AAN63949.1| peritrophic matrix insect intestinal ... 58 4e-07
gi|46431066|gb|EAK90720.1| hypothetical protein CaO19.63 [Candid... 58 4e-07
gi|24650773|ref|NP_733243.1| CG31131-PA [Drosophila melanogaster... 58 4e-07
gi|7263944|emb|CAB81773.1| mucin 4 [Homo sapiens] >gnl|BL_ORD_ID... 58 5e-07
gi|39579415|emb|CAE56721.1| Hypothetical protein CBG24508 [Caeno... 58 5e-07
gi|10944937|emb|CAC14134.1| MUC4 protein splice variant sv12 [Ho... 58 5e-07
gi|11071533|emb|CAC14585.1| MUC4 protein splice variant sv11 [Ho... 58 5e-07
gi|39589129|emb|CAE57862.1| Hypothetical protein CBG00900 [Caeno... 58 5e-07
gi|10944943|emb|CAC14137.1| MUC4 protein splice variant sv15 [Ho... 58 5e-07
gi|46133229|ref|ZP_00156849.2| COG3468: Type V secretory pathway... 58 5e-07
gi|10944949|emb|CAC14140.1| MUC4 protein splice variant sv18 [Ho... 58 5e-07
gi|10944951|emb|CAC14141.1| MUC4 protein splice variant sv19 [Ho... 58 5e-07
gi|1168933|sp|P40954|CHI3_CANAL Chitinase 3 precursor >gnl|BL_OR... 58 5e-07
gi|10944953|emb|CAC14142.1| MUC4 protein splice variant sv20 [Ho... 58 5e-07
gi|10944947|emb|CAC14139.1| MUC4 protein splice variant sv17 [Ho... 58 5e-07
gi|10303252|emb|CAC10062.1| MUC4 protein variant VI1 [Homo sapie... 58 5e-07
gi|10944955|emb|CAC14143.1| MUC4 protein splice variant sv21 [Ho... 58 5e-07
gi|10303250|emb|CAC10061.1| mucin 4, variant V3 [Homo sapiens] 58 5e-07
gi|10944945|emb|CAC14138.1| MUC4 protein splice variant sv16 [Ho... 58 5e-07
gi|46226738|gb|EAK87717.1| uncharacterized secreted protein with... 58 5e-07
gi|29374894|ref|NP_814047.1| N-acetylmuramoyl-L-alanine amidase,... 58 5e-07
gi|25012657|gb|AAN71424.1| RE50074p [Drosophila melanogaster] 57 6e-07
gi|2507049|sp|P46593|HWP1_CANAL Hyphal wall protein 1 (Cell elon... 57 6e-07
gi|46434426|gb|EAK93836.1| hypothetical protein CaO19.8901 [Cand... 57 6e-07
gi|2275336|gb|AAB64014.1| differentially expressed in relation t... 57 6e-07
gi|33944711|ref|XP_340503.1| hypothetical protein Tb927.2.4050 [... 57 6e-07
gi|15926464|ref|NP_373997.1| fibrinogen-binding protein A, clump... 57 6e-07
gi|31220056|ref|XP_316870.1| ENSANGP00000017739 [Anopheles gambi... 57 6e-07
gi|41148032|ref|XP_374501.1| similar to intestinal mucin 3 [Homo... 57 6e-07
gi|3551821|gb|AAC34750.1| mucin 4 [Homo sapiens] 57 6e-07
gi|46443625|gb|EAL02905.1| hypothetical protein CaO19.1616 [Cand... 57 6e-07
gi|17221138|gb|AAK58436.1| glycoprotein gp2 [Equine herpesvirus 4] 57 6e-07
gi|41147654|ref|XP_168578.4| mucin 3B [Homo sapiens] 57 6e-07
gi|15923801|ref|NP_371335.1| fibrinogen-binding protein [Staphyl... 57 6e-07
gi|1083599|pir||A53577 ascites sialoglycoprotein 1 - rat (fragme... 57 6e-07
gi|48890820|ref|ZP_00324431.1| COG0008: Glutamyl- and glutaminyl... 57 6e-07
gi|46139373|ref|XP_391377.1| hypothetical protein FG11201.1 [Gib... 57 6e-07
gi|5001993|gb|AAD37247.1| chimeric AFGP/trypsinogen-like serine ... 57 6e-07
gi|20143937|ref|NP_060876.2| mucin 4 isoform a [Homo sapiens] 57 8e-07
gi|3649741|emb|CAA03985.1| mucin [Homo sapiens] 57 8e-07
gi|42520576|ref|NP_966491.1| hypothetical protein WD0733 [Wolbac... 57 8e-07
gi|20143920|ref|NP_612155.1| mucin 4 isoform b [Homo sapiens] 57 8e-07
gi|20143924|ref|NP_612156.1| mucin 4 isoform c [Homo sapiens] 57 8e-07
gi|111978|pir||S24169 mucin - rat 57 8e-07
gi|50542920|ref|XP_499626.1| hypothetical protein [Yarrowia lipo... 57 8e-07
gi|14210081|gb|AAK56925.1| Iga1 protease type 2 [Haemophilus inf... 57 8e-07
gi|12644358|sp|P80544|PLS_STAAU Surface protein precursor (Plasm... 57 8e-07
gi|48122345|ref|XP_396511.1| similar to DNA-binding protein D-ET... 57 1e-06
gi|48374047|ref|NP_997126.2| mucin 19; sublingual apomucin [Mus ... 57 1e-06
gi|17538770|ref|NP_502375.1| predicted CDS, receptor for egg jel... 57 1e-06
gi|6324467|ref|NP_014536.1| cell wall integrity and stress respo... 57 1e-06
gi|23508335|ref|NP_701004.1| hypothetical protein [Plasmodium fa... 57 1e-06
gi|46441026|gb|EAL00326.1| hypothetical protein CaO19.12983 [Can... 57 1e-06
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 57 1e-06
gi|46109412|ref|XP_381764.1| hypothetical protein FG01588.1 [Gib... 56 1e-06
gi|6324372|ref|NP_014442.1| Anchorage subunit of a-agglutinin of... 56 1e-06
gi|34014801|gb|AAO49800.1| MUC19 [Mus musculus] 56 1e-06
gi|17542476|ref|NP_499893.1| putative nuclear protein (4B23) [Ca... 56 1e-06
gi|50412662|ref|XP_457149.1| unnamed protein product [Debaryomyc... 56 1e-06
gi|38077118|ref|XP_354871.1| similar to sublingual apomucin [Mus... 56 1e-06
gi|48868961|ref|ZP_00322244.1| COG3468: Type V secretory pathway... 56 1e-06
gi|4585623|emb|CAB40845.1| conidiospore surface protein [Hypocre... 56 1e-06
gi|49093974|ref|XP_408448.1| hypothetical protein AN4311.2 [Aspe... 56 1e-06
gi|32566278|ref|NP_500256.2| predicted CDS, putative membrane pr... 56 2e-06
gi|34880471|ref|XP_213903.2| similar to This gene is isolated by... 56 2e-06
gi|13529407|gb|AAH05441.1| Mucin 1, transmembrane [Mus musculus] 56 2e-06
gi|49617209|gb|AAT67387.1| cell wall mannoprotein [Candida glabr... 56 2e-06
gi|2077900|dbj|BAA19915.1| flocculin [Saccharomyces cerevisiae] 56 2e-06
gi|17560816|ref|NP_506530.1| predicted CDS, sushi domain/SCR dom... 56 2e-06
gi|9631242|ref|NP_048023.1| glycoprotein [Ateline herpesvirus 3]... 56 2e-06
gi|7592614|dbj|BAA86640.2| hypothetical protein [Staphylococcus ... 55 2e-06
gi|30313663|gb|AAO38851.1| sublingual apomucin [Mus musculus] 55 2e-06
gi|11360494|pir||T44768 antifreeze glycopeptide AFGP polyprotein... 55 2e-06
gi|31204945|ref|XP_311421.1| ENSANGP00000018591 [Anopheles gambi... 55 2e-06
gi|410720|gb|AAB28217.1| DNA polymerase alpha, DNAPol alpha [Pla... 55 2e-06
gi|542425|pir||S41649 DNA polymerase - malaria parasite (Plasmod... 55 2e-06
gi|46436654|gb|EAK96013.1| hypothetical protein CaO19.7251 [Cand... 55 2e-06
gi|19571560|emb|CAD27470.1| SPAPB18E9.04c [Schizosaccharomyces p... 55 2e-06
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib... 55 2e-06
gi|34869251|ref|XP_221384.2| similar to Heterodimeric complex co... 55 2e-06
gi|49120840|ref|XP_412378.1| hypothetical protein AN8241.2 [Aspe... 55 3e-06
gi|50555151|ref|XP_504984.1| YlTSR1 [Yarrowia lipolytica] >gnl|B... 55 3e-06
gi|29835191|gb|AAH51076.1| BC051076 protein [Mus musculus] 55 3e-06
gi|39590522|emb|CAE66262.1| Hypothetical protein CBG11506 [Caeno... 55 3e-06
gi|50758224|ref|XP_415818.1| PREDICTED: similar to mitotic spind... 55 3e-06
gi|38080239|ref|XP_144407.3| similar to BC051076 protein [Mus mu... 55 3e-06
gi|50290763|ref|XP_447814.1| unnamed protein product [Candida gl... 55 3e-06
gi|2827458|gb|AAC39772.1| hepatitis A virus cellular receptor 1 ... 55 4e-06
gi|31208407|ref|XP_313170.1| ENSANGP00000024051 [Anopheles gambi... 55 4e-06
gi|46434432|gb|EAK93842.1| hypothetical protein CaO19.8907 [Cand... 55 4e-06
gi|2827456|gb|AAC39771.1| hepatitis A virus cellular receptor 1 ... 55 4e-06
gi|46434465|gb|EAK93874.1| hypothetical protein CaO19.1327 [Cand... 55 4e-06
gi|39580034|emb|CAE71560.1| Hypothetical protein CBG18509 [Caeno... 55 4e-06
gi|15801378|ref|NP_287395.1| putative membrane protein of propha... 55 4e-06
gi|50550625|ref|XP_502785.1| hypothetical protein [Yarrowia lipo... 55 4e-06
gi|15830904|ref|NP_309677.1| putative tail fiber protein [Escher... 55 4e-06
gi|16129333|ref|NP_415890.1| side tail fiber protein homolog fro... 54 5e-06
gi|50591074|ref|ZP_00332403.1| COG4932: Predicted outer membrane... 54 5e-06
gi|6322961|ref|NP_013033.1| Hypothetical ORF; Yll067cp [Saccharo... 54 5e-06
gi|543415|pir||PC2022 mucin like protein Muc2 precursor - rat (f... 54 5e-06
gi|529767|gb|AAA85517.1| pSMC gene product 54 5e-06
gi|24138410|dbj|BAC21707.1| mucin 6 [Rattus norvegicus] 54 5e-06
gi|9963982|gb|AAG09787.1| repressed by TUP1 protein 1; Rbt1p [Ca... 54 5e-06
gi|12643676|sp|P76072|STFR_ECOLI Side tail fiber protein homolog... 54 5e-06
gi|34861766|ref|XP_215127.2| similar to secreted gel-forming muc... 54 5e-06
gi|50760057|ref|XP_417882.1| PREDICTED: similar to MEGF11 protei... 54 5e-06
gi|11362263|pir||T46740 microfilarial sheath protein SHP3 [impor... 54 5e-06
gi|28571214|ref|NP_727928.2| CG32580-PA [Drosophila melanogaster... 54 5e-06
gi|33303432|gb|AAQ02292.1| dentin matrix protein 1 [Onychomys ar... 54 5e-06
gi|38086904|ref|XP_358236.1| similar to interspersed repeat anti... 54 5e-06
gi|6325462|ref|NP_015530.1| subtelomerically-encoded DNA helicas... 54 5e-06
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 54 5e-06
gi|7489925|pir||T31108 cyst germination specific acidic repeat p... 54 5e-06
gi|6323498|ref|NP_013571.1| Helicase encoded by the Y' element o... 54 7e-06
gi|6320754|ref|NP_010834.1| Helicase encoded by the Y' element o... 54 7e-06
gi|3721904|dbj|BAA33739.1| Y'-helicase protein 1 [Saccharomyces ... 54 7e-06
gi|6322005|ref|NP_012081.1| Lectin-like protein involved in floc... 54 7e-06
gi|113538|sp|P24587|AK15_RAT A-kinase anchor protein 150 (AKAP 1... 54 7e-06
gi|49091634|ref|XP_407278.1| hypothetical protein AN3141.2 [Aspe... 54 7e-06
gi|18644718|ref|NP_062213.1| regulator of G-protein signaling 3 ... 54 7e-06
gi|47219400|emb|CAG01563.1| unnamed protein product [Tetraodon n... 54 7e-06
gi|48104080|ref|XP_395710.1| similar to CG33265-PA [Apis mellifera] 54 7e-06
gi|9755360|ref|NP_061495.1| Hypothetical ORF; Yor396wp [Saccharo... 54 7e-06
gi|283170|pir||S28368 hypothetical protein Y'.2 - yeast (Sacchar... 54 7e-06
gi|50425993|ref|XP_461593.1| unnamed protein product [Debaryomyc... 54 7e-06
gi|24663552|ref|NP_648610.1| CG14120-PA [Drosophila melanogaster... 54 7e-06
gi|46432918|gb|EAK92380.1| hypothetical protein CaO19.3384 [Cand... 54 7e-06
gi|6006448|emb|CAB56789.1| IgA1 protease [Haemophilus influenzae] 54 7e-06
gi|16272928|ref|NP_439153.1| immunoglobin A1 protease [Haemophil... 54 7e-06
gi|6322383|ref|NP_012457.1| Protein of unknown function, has sim... 54 7e-06
gi|50304493|ref|XP_452197.1| unnamed protein product [Kluyveromy... 54 7e-06
gi|46123493|ref|XP_386300.1| hypothetical protein FG06124.1 [Gib... 54 9e-06
gi|479426|pir||S33850 fibronecin-binding protein - Streptococcus... 54 9e-06
gi|39580008|emb|CAE56813.1| Hypothetical protein CBG24626 [Caeno... 54 9e-06
gi|50411243|ref|XP_457029.1| unnamed protein product [Debaryomyc... 54 9e-06
gi|48098554|ref|XP_394100.1| similar to CG17274-PA [Apis mellifera] 54 9e-06
gi|6322962|ref|NP_013034.1| Hypothetical ORF; Yll066cp [Saccharo... 54 9e-06
gi|34865153|ref|XP_347180.1| similar to MUC6 [Rattus norvegicus] 54 9e-06
gi|19115042|ref|NP_594130.1| putative glucoamylase I (alpha-1,4-... 54 9e-06
gi|19424156|ref|NP_598199.1| A-kinase anchor protein 5; RII-B-bi... 54 9e-06
gi|46443495|gb|EAL02776.1| hypothetical protein CaO19.9183 [Cand... 54 9e-06
gi|49090670|ref|XP_406796.1| hypothetical protein AN2659.2 [Aspe... 54 9e-06
gi|6322015|ref|NP_012091.1| Hypothetical ORF; Yhr219wp [Saccharo... 53 1e-05
gi|50549699|ref|XP_502320.1| hypothetical protein [Yarrowia lipo... 53 1e-05
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ... 53 1e-05
gi|28379506|ref|NP_786398.1| muramidase (putative) [Lactobacillu... 53 1e-05
gi|1583722|prf||2121355A Vlp surface protein 53 1e-05
gi|19113482|ref|NP_596690.1| hypothetical serine-rich secreted p... 53 1e-05
gi|19112962|ref|NP_596170.1| putative glycoprotein [Schizosaccha... 53 1e-05
gi|39589982|emb|CAE60980.1| Hypothetical protein CBG04714 [Caeno... 53 1e-05
gi|39582817|emb|CAE74280.1| Hypothetical protein CBG21976 [Caeno... 53 1e-05
gi|2833432|sp|Q49536|VLPD_MYCHR Variant surface antigen D precur... 53 1e-05
gi|46444258|gb|EAL03534.1| hypothetical protein CaO19.12440 [Can... 53 1e-05
gi|231543|sp|P29760|AMYI_SACDI Glucoamylase S2 precursor (Glucan... 53 1e-05
gi|1170456|sp|P46591|HYR1_CANAL Hyphally regulated protein precu... 53 1e-05
gi|2131138|pir||S58135 hyphally regulated protein - yeast (Candi... 53 1e-05
gi|20301990|ref|NP_620203.1| podocalyxin-like [Rattus norvegicus... 53 1e-05
gi|46444135|gb|EAL03412.1| hypothetical protein CaO19.4975 [Cand... 53 1e-05
gi|32414167|ref|XP_327563.1| hypothetical protein [Neurospora cr... 53 1e-05
gi|14251025|ref|NP_116387.1| T38 [Tupaia herpesvirus] >gnl|BL_OR... 53 1e-05
gi|24430367|emb|CAD55813.1| lipoprotein [Mycoplasma conjunctivae] 53 2e-05
gi|39585478|emb|CAE70561.1| Hypothetical protein CBG17208 [Caeno... 53 2e-05
gi|42630174|ref|ZP_00155718.1| COG3468: Type V secretory pathway... 53 2e-05
gi|67392|pir||ALBYG glucan 1,4-alpha-glucosidase (EC 3.2.1.3) pr... 53 2e-05
gi|24662804|ref|NP_648488.1| CG6071-PA [Drosophila melanogaster]... 53 2e-05
gi|83626|pir||JU0474 glucan 1,4-alpha-glucosidase (EC 3.2.1.3) S... 53 2e-05
gi|113798|sp|P04065|AMYH_SACDI Glucoamylase S1 precursor (Glucan... 53 2e-05
gi|46117194|ref|XP_384615.1| hypothetical protein FG04439.1 [Gib... 53 2e-05
gi|24640934|ref|NP_572598.1| CG2989-PA [Drosophila melanogaster]... 52 2e-05
gi|48098281|ref|XP_392041.1| similar to EIB-55kDa associated pro... 52 2e-05
gi|40549138|gb|AAR87662.1| heart of glass soluble isoform 1 [Dan... 52 2e-05
gi|47085721|ref|NP_998133.1| heart of glass [Danio rerio] >gnl|B... 52 2e-05
gi|28379376|ref|NP_786268.1| cell surface protein precursor [Lac... 52 2e-05
gi|529773|gb|AAA85523.1| Heterodimeric complex composed of a muc... 52 2e-05
gi|46441846|gb|EAL01140.1| hypothetical protein CaO19.301 [Candi... 52 2e-05
gi|50302409|ref|XP_451139.1| unnamed protein product [Kluyveromy... 52 2e-05
gi|542705|pir||A44146 syndecan-3 - chicken (fragment) 52 2e-05
gi|42659788|ref|XP_039877.8| mucin 5, subtype B, tracheobronchia... 52 2e-05
gi|23025177|ref|ZP_00064343.1| COG5263: FOG: Glucan-binding doma... 52 2e-05
gi|45382403|ref|NP_990714.1| syndecan-3 proteoglycan [Gallus gal... 52 2e-05
gi|6319255|ref|NP_009338.1| Lectin-like protein with similarity ... 52 2e-05
gi|24419041|gb|AAL65133.2| ovarian cancer related tumor marker C... 52 2e-05
gi|19921106|ref|NP_609433.1| CG17104-PA [Drosophila melanogaster... 52 2e-05
gi|18858041|ref|NP_572269.1| CG15765-PA [Drosophila melanogaster... 52 2e-05
gi|40549140|gb|AAR87663.1| heart of glass soluble isoform 2 [Dan... 52 2e-05
gi|23509024|ref|NP_701692.1| hypothetical protein [Plasmodium fa... 52 2e-05
gi|50288077|ref|XP_446467.1| unnamed protein product [Candida gl... 52 2e-05
gi|49106150|ref|XP_411399.1| hypothetical protein AN7262.2 [Aspe... 52 2e-05
gi|1077492|pir||S51959 hypothetical protein YAL063c - yeast (Sac... 52 2e-05
gi|32477034|ref|NP_870028.1| hypothetical protein-signal peptide... 52 3e-05
gi|39590898|emb|CAE58678.1| Hypothetical protein CBG01852 [Caeno... 52 3e-05
gi|34867741|ref|XP_235593.2| similar to submaxillary apomucin [R... 52 3e-05
gi|49091078|ref|XP_407000.1| hypothetical protein AN2863.2 [Aspe... 52 3e-05
gi|50548263|ref|XP_501601.1| hypothetical protein [Yarrowia lipo... 52 3e-05
>gi|17533675|ref|NP_496739.1| mature parasite-infected erythrocyte
surface antigen like precursor (2N179) [Caenorhabditis
elegans]
gi|7500473|pir||T21752 hypothetical protein F35C5.3 - Caenorhabditis
elegans
gi|3876678|emb|CAB03052.1| Hypothetical protein F35C5.3
[Caenorhabditis elegans]
Length = 394
Score = 602 bits (1551), Expect = e-171
Identities = 318/377 (84%), Positives = 318/377 (84%)
Frame = +1
Query: 52 DTAPVDFNKIFVTFVEELMDAINQLILEQMGAIRPSTTPLQSXXXXXXXXXXXXXXXXXX 231
DTAPVDFNKIFVTFVEELMDAINQLILEQMGAIRPSTTPLQS
Sbjct: 18 DTAPVDFNKIFVTFVEELMDAINQLILEQMGAIRPSTTPLQSIPPITATDAPTTADTTAE 77
Query: 232 XXKAHETTVAQEATSEGAETHETTVGQDTTVRSGESQETTVSQGTTVSQENTVSQETTVS 411
KAHETTVAQEATSEGAETHETTVGQDTTVRSGESQETTVSQGTTVSQENTVSQETTVS
Sbjct: 78 PTKAHETTVAQEATSEGAETHETTVGQDTTVRSGESQETTVSQGTTVSQENTVSQETTVS 137
Query: 412 QDTTVSQETTVSQDTTVSQDTTVSQESTVSQETTVSQDTTVSQETSVSHETNVSPDTTVS 591
QDTTVSQETTVSQDTTVSQDTTVSQESTVSQETTVSQDTTVSQETSVSHETNVSPDTTVS
Sbjct: 138 QDTTVSQETTVSQDTTVSQDTTVSQESTVSQETTVSQDTTVSQETSVSHETNVSPDTTVS 197
Query: 592 QESTVSQDTTVSQETTLSQETTVSQETTVSQDTTVSQEXXXXXXXXXXXXXXXXXXXXXV 771
QESTVSQDTTVSQETTLSQETTVSQETTVSQDTTVSQE V
Sbjct: 198 QESTVSQDTTVSQETTLSQETTVSQETTVSQDTTVSQETTASQDTTVSQDTTVSQDTTVV 257
Query: 772 PQETTVEATKASEATEENGTTAVTPGESDPCDTTEAPTGGSTVGESEPCDTTEASEPTGH 951
PQETTVEATKASEATEENGTTAVTPGESDPCDTTEAPTGGSTVGESEPCDTTEASEPTGH
Sbjct: 258 PQETTVEATKASEATEENGTTAVTPGESDPCDTTEAPTGGSTVGESEPCDTTEASEPTGH 317
Query: 952 TDQAETVTDPASQATASATIIGGVDQTGSTNLEATTEQICKHPXXXXXXXXXXXXXXXXX 1131
TDQAETVTDPASQATASATIIGGVDQTGSTNLEATTEQICKHP
Sbjct: 318 TDQAETVTDPASQATASATIIGGVDQTGSTNLEATTEQICKHPTKDSEEEKTDENKDEKT 377
Query: 1132 XRAGTNVHRPEREDILK 1182
RAGTNVHRPEREDILK
Sbjct: 378 TRAGTNVHRPEREDILK 394