Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= F29B9_3
         (501 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17540072|ref|NP_500604.1| ubiquitin conjugating enzyme (19.1 ...   352   3e-96
gi|39587620|emb|CAE58558.1| Hypothetical protein CBG01720 [Caeno...   346   1e-94
gi|39583165|emb|CAE61383.1| Hypothetical protein CBG05231 [Caeno...   322   3e-87
gi|31240017|ref|XP_320422.1| ENSANGP00000009198 [Anopheles gambi...   280   1e-74
gi|47226000|emb|CAG04374.1| unnamed protein product [Tetraodon n...   278   3e-74
gi|47211014|emb|CAF95528.1| unnamed protein product [Tetraodon n...   277   6e-74
gi|30584109|gb|AAP36303.1| Homo sapiens ubiquitin-conjugating en...   276   1e-73
gi|31201253|ref|XP_309574.1| ENSANGP00000003964 [Anopheles gambi...   275   3e-73
gi|20150955|pdb|1KPS|A Chain A, Structural Basis For E2-Mediated...   275   3e-73
gi|2194010|pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzym...   275   3e-73
gi|3212324|pdb|1A3S|  Human Ubc9                                      275   3e-73
gi|4507785|ref|NP_003336.1| ubiquitin-conjugating enzyme E2I; SU...   275   3e-73
gi|18859523|ref|NP_571426.1| ubiquitin-conjugating enzyme E2I; u...   274   5e-73
gi|18859521|ref|NP_571908.1| ubiquitin-conjugating enzyme E2I2 [...   274   7e-73
gi|17136904|ref|NP_476978.1| CG3018-PA [Drosophila melanogaster]...   273   1e-72
gi|2501430|sp|O09181|UBCI_MESAU Ubiquitin-like protein SUMO-1 co...   268   4e-71
gi|1463033|gb|AAC50603.1| ubiquitin-conjugating enzyme 9 (UBC9)       265   4e-70
gi|37779120|gb|AAP20220.1| ubiquitin-conjugating enzyme E2I [Pag...   261   6e-69
gi|30584321|gb|AAP36409.1| Homo sapiens ubiquitin-conjugating en...   247   9e-65
gi|30582859|gb|AAP35656.1| ubiquitin-conjugating enzyme E2I (UBC...   247   9e-65
gi|49076336|ref|XP_402157.1| hypothetical protein UM04542.1 [Ust...   230   8e-60
gi|50256384|gb|EAL19109.1| hypothetical protein CNBH2090 [Crypto...   230   1e-59
gi|32440939|dbj|BAC78820.1| ubiquitin-conjugating enzyme9 [Copri...   228   5e-59
gi|32406058|ref|XP_323642.1| hypothetical protein [Neurospora cr...   218   3e-56
gi|19114116|ref|NP_593204.1| ubiquitin conjugating enzyme [Schiz...   216   1e-55
gi|46136839|ref|XP_390111.1| conserved hypothetical protein [Gib...   214   8e-55
gi|15230881|ref|NP_191346.1| ubiquitin-conjugating enzyme, putat...   213   1e-54
gi|20975734|emb|CAD29823.2| putative ubiquitin-conjugating enzym...   211   7e-54
gi|37536440|ref|NP_922522.1| putative ubiquitin-conjugating enzy...   210   1e-53
gi|37719049|emb|CAE45567.1| SUMO E2 conjugating enzyme SCE1 [Nic...   208   5e-53
gi|49094150|ref|XP_408536.1| conserved hypothetical protein [Asp...   207   6e-53
gi|25446690|gb|AAN74837.1| Putative ubiquitin-conjugating enzyme...   207   1e-52
gi|7621708|gb|AAF65153.1| putative E2 enzyme Ubc9 [Dictyostelium...   204   5e-52
gi|45190662|ref|NP_984916.1| AER056Cp [Eremothecium gossypii] >g...   199   2e-50
gi|50308341|ref|XP_454172.1| unnamed protein product [Kluyveromy...   199   2e-50
gi|23613670|ref|NP_704691.1| ubiquitin conjugating enzyme, putat...   199   3e-50
gi|50286041|ref|XP_445449.1| unnamed protein product [Candida gl...   198   5e-50
gi|6320139|ref|NP_010219.1| SUMO-conjugating enzyme involved in ...   195   4e-49
gi|46437838|gb|EAK97178.1| hypothetical protein CaO19.13782 [Can...   192   2e-48
gi|38102477|gb|EAA49312.1| hypothetical protein MG00970.4 [Magna...   192   3e-48
gi|50408958|ref|XP_456826.1| unnamed protein product [Debaryomyc...   192   3e-48
gi|50547521|ref|XP_501230.1| hypothetical protein [Yarrowia lipo...   188   5e-47
gi|34878117|ref|XP_223442.2| similar to UBE2I protein [Rattus no...   185   3e-46
gi|33944393|ref|XP_340344.1| ubiquitin-conjugating enzyme E2, pu...   181   8e-45
gi|38345867|emb|CAD41164.2| OSJNBa0064M23.9 [Oryza sativa (japon...   174   6e-43
gi|11272348|pir||T50603 ubiquitin-conjugating enzyme [imported] ...   167   1e-40
gi|34851477|ref|XP_226359.2| similar to iroquois homeobox protei...   166   2e-40
gi|29247642|gb|EAA39198.1| GLP_160_24016_23438 [Giardia lamblia ...   163   1e-39
gi|22902256|gb|AAH37635.1| Ube2i protein [Mus musculus]               140   2e-32
gi|39594212|emb|CAE70322.1| Hypothetical protein CBG16850 [Caeno...   127   1e-28
gi|50308591|ref|XP_454298.1| unnamed protein product [Kluyveromy...   124   9e-28
gi|23487849|gb|EAA21159.1| ubiquitin-conjugating enzyme [Plasmod...   123   2e-27
gi|23612890|ref|NP_704429.1| ubiquitin-conjugating enzyme, putat...   122   4e-27
gi|50294532|ref|XP_449677.1| unnamed protein product [Candida gl...   120   1e-26
gi|45185288|ref|NP_983005.1| ABR059Wp [Eremothecium gossypii] >g...   119   3e-26
gi|46438132|gb|EAK97468.1| hypothetical protein CaO19.7329 [Cand...   116   2e-25
gi|29841048|gb|AAP06061.1| similar to NM_019668 ubiquitin-conjug...   115   3e-25
gi|25293669|pir||T51931 hypothetical protein NhRAD6 [imported] -...   115   3e-25
gi|1717855|sp|P52493|UBC2_NEUCR Ubiquitin-conjugating enzyme E2-...   115   4e-25
gi|32404624|ref|XP_322925.1| hypothetical protein ( (AL513444) p...   114   9e-25
gi|38110378|gb|EAA56105.1| hypothetical protein MG01756.4 [Magna...   114   9e-25
gi|50419513|ref|XP_458283.1| unnamed protein product [Debaryomyc...   114   1e-24
gi|16604264|gb|AAK50144.1| UVSJ [Aspergillus nidulans]                114   1e-24
gi|6323664|ref|NP_013735.1| part of the HRDDER pathway of ER-ass...   113   2e-24
gi|50405625|ref|XP_456449.1| unnamed protein product [Debaryomyc...   113   2e-24
gi|6136093|sp|O74201|UBC2_CANAL Ubiquitin-conjugating enzyme E2-...   112   3e-24
gi|49121123|ref|XP_412395.1| conserved hypothetical protein [Asp...   112   3e-24
gi|39592473|emb|CAE63550.1| Hypothetical protein CBG08036 [Caeno...   112   3e-24
gi|19075104|ref|NP_586705.1| UBIQUITIN CONJUGATING ENZYME E2 [En...   112   3e-24
gi|19113788|ref|NP_592876.1| ubiquitin-conjugating enzyme e2-17 ...   112   3e-24
gi|50557022|ref|XP_505919.1| hypothetical protein [Yarrowia lipo...   112   4e-24
gi|11272418|pir||T45220 ubiquitin-protein ligase (EC 6.3.2.19) r...   111   6e-24
gi|46228398|gb|EAK89297.1| protein with UBC domain, ubiquitin co...   110   1e-23
gi|31202935|ref|XP_310416.1| ENSANGP00000017916 [Anopheles gambi...   110   1e-23
gi|24644103|ref|NP_524230.2| CG2013-PA [Drosophila melanogaster]...   110   1e-23
gi|8118527|gb|AAF73016.1| ubiquitin conjugating protein [Avicenn...   110   1e-23
gi|15081749|gb|AAK82529.1| AT5g62540/K19B1_15 [Arabidopsis thali...   110   1e-23
gi|18424601|ref|NP_568956.1| ubiquitin-conjugating enzyme 3 (UBC...   110   2e-23
gi|39579465|emb|CAE56741.1| Hypothetical protein CBG24535 [Caeno...   110   2e-23
gi|23505769|gb|AAN28744.1| At5g62540/K19B1_15 [Arabidopsis thali...   110   2e-23
gi|34810893|pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E...   109   2e-23
gi|103350|pir||A39392 RAD6 DNA-repair homolog Dhr6 - fruit fly (...   109   2e-23
gi|17542650|ref|NP_500480.1| ubiquitin conjugating enzyme (21.5 ...   109   2e-23
gi|31560630|ref|NP_033484.2| ubiquitin-conjugating enzyme E2B, R...   109   2e-23
gi|4507771|ref|NP_003328.1| ubiquitin-conjugating enzyme E2B; ub...   109   2e-23
gi|13516453|dbj|BAB40311.1| ubiquitin-conjugating enzyme (E2) [N...   109   2e-23
gi|18394114|ref|NP_563951.1| ubiquitin-conjugating enzyme 1 (UBC...   109   2e-23
gi|464980|sp|P35130|UBC2_MEDSA Ubiquitin-conjugating enzyme E2-1...   109   2e-23
gi|30585021|gb|AAP36783.1| Homo sapiens ubiquitin-conjugating en...   109   2e-23
gi|17510667|ref|NP_493381.1| ubiquitin conjugating enzyme (19.1 ...   109   3e-23
gi|136640|sp|P25866|UBC2_WHEAT Ubiquitin-conjugating enzyme E2-1...   109   3e-23
gi|13516451|dbj|BAB40310.1| ubiquitin-conjugating enzyme (E2) [N...   109   3e-23
gi|9790041|ref|NP_062642.1| ubiquitin-conjugating enzyme E2A, RA...   108   4e-23
gi|41054359|ref|NP_956013.1| ubiquitin-conjugating enzyme E2B (R...   108   4e-23
gi|33146810|dbj|BAC79758.1| OsRad6 [Oryza sativa (japonica culti...   108   4e-23
gi|49257228|gb|AAH71066.1| Unknown (protein for MGC:78891) [Xeno...   108   4e-23
gi|34932996|ref|XP_216466.2| similar to ubiquitin-conjugating en...   108   4e-23
gi|18844990|dbj|BAB85469.1| Rad6 [Oryza sativa (japonica cultiva...   108   5e-23
gi|18395424|ref|NP_565289.1| ubiquitin-conjugating enzyme 2 (UBC...   108   5e-23
gi|34867269|ref|XP_345523.1| similar to RIKEN cDNA A930001M12 ge...   108   6e-23
gi|46123199|ref|XP_386153.1| conserved hypothetical protein [Gib...   108   6e-23
gi|21314398|gb|AAM46925.1| ubiquitin conjugating enzyme E2A [Fun...   108   6e-23
gi|50260358|gb|EAL23017.1| hypothetical protein CNBA7840 [Crypto...   107   8e-23
gi|32419875|ref|XP_330381.1| UBIQUITIN-CONJUGATING ENZYME E2-17 ...   107   8e-23
gi|49903971|gb|AAH76409.1| Zgc:100921 protein [Danio rerio]           107   1e-22
gi|50289673|ref|XP_447268.1| unnamed protein product [Candida gl...   107   1e-22
gi|50304985|ref|XP_452450.1| unnamed protein product [Kluyveromy...   106   2e-22
gi|38103646|gb|EAA50322.1| hypothetical protein MG04081.4 [Magna...   106   2e-22
gi|18408001|ref|NP_564828.1| ubiquitin-conjugating enzyme, putat...   106   2e-22
gi|108016|pir||A41222 ubiquitin-protein ligase (EC 6.3.2.19) E2A...   106   2e-22
gi|7497060|pir||T32959 hypothetical protein C35B1.1 - Caenorhabd...   105   3e-22
gi|45184981|ref|NP_982699.1| AAR156Cp [Eremothecium gossypii] >g...   105   3e-22
gi|3659954|pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharo...   105   3e-22
gi|6321380|ref|NP_011457.1| Ubiquitin-conjugating enzyme (E2), i...   105   3e-22
gi|32488376|emb|CAE02801.1| OSJNBa0043A12.6 [Oryza sativa (japon...   105   4e-22
gi|464981|sp|P35135|UBC4_LYCES Ubiquitin-conjugating enzyme E2-1...   104   7e-22
gi|31202937|ref|XP_310417.1| ENSANGP00000022394 [Anopheles gambi...   104   7e-22
gi|28569269|gb|AAL99224.1| ubiquitin-conjugating enzyme E2 [Goss...   104   9e-22
gi|28569263|gb|AAL99222.1| ubiquitin-conjugating enzyme E2 [Goss...   104   9e-22
gi|13811942|ref|NP_113070.1| ubiquitin conjugating enzyme [Guill...   104   9e-22
gi|6010087|emb|CAB57250.1| putative ubiquitin carrier [Entodiniu...   103   2e-21
gi|30693863|ref|NP_851114.1| ubiquitin-conjugating enzyme 8 (UBC...   103   2e-21
gi|28569267|gb|AAL99223.1| ubiquitin-conjugating enzyme E2 [Goss...   103   2e-21
gi|5762457|gb|AAD51109.1| ubiquitin-conjugating enzyme UBC2 [Mes...   103   2e-21
gi|29245125|gb|EAA36783.1| GLP_382_5313_4777 [Giardia lamblia AT...   103   2e-21
gi|31198143|ref|XP_308019.1| ENSANGP00000019471 [Anopheles gambi...   103   2e-21
gi|456568|gb|AAA64427.1| ubiquitin conjugating enzyme                 103   2e-21
gi|50725323|dbj|BAD34325.1| putative ubiquitin-conjugating enzym...   103   2e-21
gi|19112570|ref|NP_595778.1| ubiquitin-conjugating enzyme e2-18 ...   102   3e-21
gi|4100646|gb|AAD00911.1| putative ubiquitin conjugating enzyme ...   102   3e-21
gi|20152205|dbj|BAB89355.1| ubiquitin-conjugating enzyme OsUBC5b...   102   3e-21
gi|22597164|gb|AAN03469.1| ubiquitin-conjugation enzyme [Glycine...   102   3e-21
gi|441457|emb|CAA51821.1| ubiquitin conjugating enzyme E2 [Lycop...   102   3e-21
gi|2668744|gb|AAB88617.1| ubiquitin conjugating enzyme [Zea mays]     102   3e-21
gi|32400971|gb|AAP80691.1| ubiquitin-conjugating enzyme [Griffit...   102   3e-21
gi|47209874|emb|CAF90188.1| unnamed protein product [Tetraodon n...   102   3e-21
gi|11272355|pir||T43235 ubiquitin-conjugating enzyme ubcP3 - fis...   102   5e-21
gi|21553796|gb|AAM62889.1| E2, ubiquitin-conjugating enzyme UBC8...   102   5e-21
gi|40287554|gb|AAR83891.1| ubiquitin-conjugating enzyme 8 [Capsi...   102   5e-21
gi|30687803|ref|NP_849462.1| ubiquitin-conjugating enzyme E2-17 ...   102   5e-21
gi|18398206|ref|NP_566331.1| ubiquitin-conjugating enzyme 11 (UB...   102   5e-21
gi|34909292|ref|NP_915993.1| ubiquitin conjugating enzyme [Oryza...   102   5e-21
gi|23613728|ref|NP_704749.1| ubiquitin conjugating enzyme E2, pu...   102   5e-21
gi|18417097|ref|NP_567791.1| ubiquitin-conjugating enzyme E2-17 ...   102   5e-21
gi|11762186|gb|AAG40371.1| AT4g27960 [Arabidopsis thaliana]           102   5e-21
gi|49069068|ref|XP_398823.1| hypothetical protein UM01208.1 [Ust...   102   5e-21
gi|23484233|gb|EAA19635.1| putative ubiquitin-conjugating enzyme...   102   5e-21
gi|19074999|ref|NP_586505.1| UBIQUITIN CONJUGATING ENZYME E2-16k...   101   6e-21
gi|50257940|gb|EAL20637.1| hypothetical protein CNBE3020 [Crypto...   101   6e-21
gi|19113257|ref|NP_596465.1| probable ubiquitin-conjugating enzy...   101   6e-21
gi|7494269|pir||T18512 hypothetical protein C0855w - malaria par...   101   6e-21
gi|28569259|gb|AAL99219.1| ubiquitin-conjugating enzyme E2 [Goss...   101   6e-21
gi|9454557|gb|AAF87880.1| Putative ubiquitin carrier protein [Ar...   101   6e-21
gi|18403097|ref|NP_564572.1| ubiquitin-conjugating enzyme 20 (UB...   101   6e-21
gi|25293673|pir||D96541 hypothetical protein F17J6.3 [imported] ...   101   6e-21
gi|16805277|ref|NP_473305.1| ubiquitin-conjugating enzyme, putat...   101   6e-21
gi|30693871|ref|NP_568595.2| ubiquitin-conjugating enzyme 8 (UBC...   101   8e-21
gi|24642559|ref|NP_524684.2| CG4443-PA [Drosophila melanogaster]...   100   1e-20
gi|7799043|emb|CAB90824.1| ubiquitin conjugating enzyme [Drosoph...   100   1e-20
gi|21618179|gb|AAM67229.1| E2, ubiquitin-conjugating enzyme, put...   100   1e-20
gi|25293664|pir||D96666 protein F22C12.2 [imported] - Arabidopsi...   100   1e-20
gi|18423494|ref|NP_568788.1| ubiquitin-conjugating enzyme 10 (UB...   100   1e-20
gi|20152203|dbj|BAB89354.1| ubiquitin-conjugating enzyme OsUBC5a...   100   2e-20
gi|46227653|gb|EAK88588.1| ubiquitin conjugating enzyme [Cryptos...   100   2e-20
gi|19074740|ref|NP_586246.1| UBIQUITIN CONJUGATING ENZYME E2-17k...   100   2e-20
gi|23508735|ref|NP_701403.1| ubiquitin-conjugating enzyme e2, pu...   100   2e-20
gi|50752092|ref|XP_422648.1| PREDICTED: similar to ubiquitin-con...   100   2e-20
gi|50550765|ref|XP_502855.1| hypothetical protein [Yarrowia lipo...    99   3e-20
gi|49071504|ref|XP_400041.1| hypothetical protein UM02426.1 [Ust...    99   4e-20
gi|50548071|ref|XP_501505.1| hypothetical protein [Yarrowia lipo...    99   4e-20
gi|21554343|gb|AAM63450.1| E2, ubiquitin-conjugating enzyme 10 (...    99   4e-20
gi|6320264|ref|NP_010344.1| Ubiquitin-conjugating enzyme that me...    99   4e-20
gi|30584075|gb|AAP36286.1| Homo sapiens ubiquitin-conjugating en...    99   5e-20
gi|19347859|gb|AAL85988.1| putative E2, ubiquitin-conjugating en...    99   5e-20
gi|20806111|ref|NP_062777.2| ubiquitin-conjugating enzyme E2G 2;...    99   5e-20
gi|34852367|ref|XP_215371.2| similar to ubiquitin-conjugating en...    99   5e-20
gi|18398199|ref|NP_565391.1| ubiquitin-conjugating enzyme, putat...    98   7e-20
gi|18423829|ref|NP_568835.1| ubiquitin-conjugating enzyme, putat...    98   7e-20
gi|30025160|gb|AAP04430.1| ubiquitin-conjugating enzyme [Hordeum...    98   7e-20
gi|6320259|ref|NP_010339.1| Ubiquitin-conjugating enzyme or E2; ...    98   9e-20
gi|18402475|ref|NP_566653.1| ubiquitin-conjugating enzyme 19 (UB...    98   9e-20
gi|50368789|gb|AAH76753.1| Unknown (protein for MGC:82328) [Xeno...    98   9e-20
gi|45200894|ref|NP_986464.1| AGL203Cp [Eremothecium gossypii] >g...    98   9e-20
gi|18398208|ref|NP_566332.1| ubiquitin-conjugating enzyme, putat...    97   1e-19
gi|3347990|gb|AAC27763.1| ubiquitin-conjugating enzyme protein U...    97   1e-19
gi|50755162|ref|XP_414634.1| PREDICTED: similar to ubiquitin con...    97   1e-19
gi|24664701|ref|NP_730059.1| CG7656-PA [Drosophila melanogaster]...    97   1e-19
gi|30584383|gb|AAP36440.1| Homo sapiens ubiquitin-conjugating en...    97   1e-19
gi|41052626|dbj|BAD08135.1| ubiquitin-conjugating enzyme [Oryza ...    97   1e-19
gi|4507773|ref|NP_003329.1| ubiquitin-conjugating enzyme E2D 1; ...    97   1e-19
gi|50426447|ref|XP_461820.1| unnamed protein product [Debaryomyc...    97   2e-19
gi|50286917|ref|XP_445888.1| unnamed protein product [Candida gl...    96   2e-19
gi|49096042|ref|XP_409481.1| hypothetical protein AN5344.2 [Aspe...    96   2e-19
gi|24664697|ref|NP_730058.1| CG7656-PC [Drosophila melanogaster]...    96   2e-19
gi|11022580|emb|CAC14238.1| probable ubiquitin-conjugating enzym...    96   2e-19
gi|18308140|gb|AAL67839.1| putative ubiquitin [Pinus pinaster]         96   2e-19
gi|3004909|gb|AAC32312.1| ubiquitin conjugating enzyme G2 [Homo ...    96   2e-19
gi|24656930|ref|NP_647823.1| CG10862-PA [Drosophila melanogaster...    96   3e-19
gi|20086317|gb|AAM08126.1| elicitor and UV light related transcr...    96   3e-19
gi|19112075|ref|NP_595283.1| ubiquitin-conjugating enzyme e2-16 ...    96   3e-19
gi|50286929|ref|XP_445894.1| unnamed protein product [Candida gl...    96   3e-19
gi|45190777|ref|NP_985031.1| AER173Cp [Eremothecium gossypii] >g...    96   3e-19
gi|27805767|sp|Q9UVR2|UBC1_MAGGR Ubiquitin-conjugating enzyme E2...    96   3e-19
gi|34852447|ref|XP_342126.1| similar to ubiquitin-conjugating en...    96   4e-19
gi|34911986|ref|NP_917340.1| P0694A04.26 [Oryza sativa (japonica...    96   4e-19
gi|7437989|pir||T01329 ubiquitin-conjugating enzyme E2 - maize >...    96   4e-19
gi|49899030|gb|AAH76728.1| Unknown (protein for MGC:81261) [Xeno...    96   4e-19
gi|40287568|gb|AAR83898.1| ubiquitin-conjugating protein [Capsic...    96   4e-19
gi|41058172|gb|AAR99131.1| RE15288p [Drosophila melanogaster]          95   6e-19
gi|29246580|gb|EAA38171.1| GLP_675_13414_12824 [Giardia lamblia ...    95   6e-19
gi|24646683|ref|NP_650309.1| CG9602-PA [Drosophila melanogaster]...    95   6e-19
gi|25010062|gb|AAN71196.1| GH25305p [Drosophila melanogaster]          95   6e-19
gi|13386314|ref|NP_082778.1| RIKEN cDNA 1700013N18 [Mus musculus...    95   7e-19
gi|18400088|ref|NP_564472.1| ubiquitin-conjugating enzyme family...    95   7e-19
gi|6319556|ref|NP_009638.1| Ubiquitin-conjugating enzyme that me...    94   9e-19
gi|38086695|ref|XP_142081.3| similar to ubiquitin-conjugating en...    94   9e-19
gi|41152425|ref|NP_955958.1| Unknown (protein for MGC:73096); wu...    94   9e-19
gi|49068616|ref|XP_398597.1| UBC1_COLGL Ubiquitin-conjugating en...    94   9e-19
gi|42734055|gb|AAS38927.1| similar to Drosophila melanogaster (F...    94   9e-19
gi|17553684|ref|NP_498198.1| ubiquitin E2 conjugating enzyme Var...    94   1e-18
gi|4388942|pdb|2E2C|  E2-C, An Ubiquitin Conjugating Enzyme Requ...    94   1e-18
gi|33149322|ref|NP_871621.1| ubiquitin-conjugating enzyme E2D 3 ...    94   1e-18
gi|47900319|gb|AAT39166.1| putative ubiquitin-conjugating enzyme...    94   1e-18
gi|2130087|pir||S61417 ubiquitin-protein ligase (EC 6.3.2.19) - ...    94   1e-18
gi|4507775|ref|NP_003330.1| ubiquitin-conjugating enzyme E2D 2 i...    94   1e-18
gi|3915196|sp|Q95044|UBCB_SPISO Ubiquitin-conjugating enzyme E2-...    94   1e-18
gi|2136339|pir||I59365 ubiquitin conjugating enzyme - human >gnl...    94   1e-18
gi|24646906|ref|NP_731941.1| CG7425-PA [Drosophila melanogaster]...    94   1e-18
gi|50257678|gb|EAL20383.1| hypothetical protein CNBF1930 [Crypto...    94   1e-18
gi|18408206|ref|NP_566884.1| ubiquitin-conjugating enzyme 13 (UB...    94   2e-18
gi|49259382|pdb|1UR6|A Chain A, Nmr Based Structural Model Of Th...    94   2e-18
gi|27805755|sp|O74196|UBC1_COLGL Ubiquitin-conjugating enzyme E2...    94   2e-18
gi|8393719|ref|NP_057067.1| ubiquitin-conjugating enzyme HBUCE1 ...    94   2e-18
gi|18410268|ref|NP_567020.1| ubiquitin-conjugating enzyme 14 (UB...    93   2e-18
gi|31211617|ref|XP_314778.1| ENSANGP00000014351 [Anopheles gambi...    93   2e-18
gi|50306989|ref|XP_453472.1| unnamed protein product [Kluyveromy...    93   2e-18
gi|7437988|pir||T02943 ubiquitin-conjugating enzyme - maize >gnl...    93   2e-18
gi|41055694|ref|NP_957253.1| similar to ubiquitin-conjugating en...    93   2e-18
gi|48095652|ref|XP_392337.1| similar to Ubiquitin-conjugating en...    93   2e-18
gi|12833659|dbj|BAB22614.1| unnamed protein product [Mus musculus]     93   2e-18
gi|23394352|gb|AAN31466.1| ubiquitin-conjugating enzyme [Phytoph...    93   2e-18
gi|38086696|ref|XP_284734.2| RIKEN cDNA 4930524E20 [Mus musculus]      93   2e-18
gi|46138581|ref|XP_390981.1| UBC1_COLGL Ubiquitin-conjugating en...    93   3e-18
gi|50309021|ref|XP_454516.1| unnamed protein product [Kluyveromy...    93   3e-18
gi|47216207|emb|CAG01241.1| unnamed protein product [Tetraodon n...    93   3e-18
gi|1174848|sp|P43102|UBC4_CANAL Ubiquitin-conjugating enzyme E2 ...    93   3e-18
gi|4507777|ref|NP_003331.1| ubiquitin-conjugating enzyme E2D 3 i...    93   3e-18
gi|17541470|ref|NP_502065.1| UBiquitin Conjugating enzyme E2, Ub...    93   3e-18
gi|44890748|gb|AAH66917.1| Ubiquitin-conjugating enzyme E2D 3, i...    93   3e-18
gi|48145949|emb|CAG33197.1| UBE2D3 [Homo sapiens]                      93   3e-18
gi|9628248|ref|NP_042834.1| ubiquitin-conjugating enzyme [Africa...    93   3e-18
gi|7108763|gb|AAF36529.1| RAD6 homolog [Equus caballus]                93   3e-18
gi|7108765|gb|AAF36530.1| RAD6 homolog [Bos taurus]                    93   3e-18
gi|34908132|ref|NP_915413.1| putative Ubiquitin carrier protein ...    92   4e-18
gi|49090874|ref|XP_406898.1| UBC1_COLGL Ubiquitin-conjugating en...    92   4e-18
gi|33149324|ref|NP_871622.1| ubiquitin-conjugating enzyme E2D 3 ...    92   5e-18
gi|421856|pir||S32673 ubiquitin-protein ligase (EC 6.3.2.19) UBC...    92   5e-18
gi|41152398|ref|NP_956246.1| Unknown (protein for MGC:73200); wu...    92   5e-18
gi|38110946|gb|EAA56591.1| hypothetical protein MG06562.4 [Magna...    92   5e-18
gi|46226745|gb|EAK87724.1| ubiquitin-conjugating enzyme [Cryptos...    92   5e-18
gi|34881346|ref|XP_228445.2| similar to testis protein TEX16 [Ra...    92   6e-18
gi|41054778|ref|NP_957404.1| similar to UBiquitin Conjugating en...    92   6e-18
gi|32421243|ref|XP_331065.1| hypothetical protein ( (XM_016084) ...    92   6e-18
gi|31204097|ref|XP_310997.1| ENSANGP00000023324 [Anopheles gambi...    92   6e-18
gi|29247608|gb|EAA39165.1| GLP_178_29935_30414 [Giardia lamblia ...    91   8e-18
gi|31204099|ref|XP_310998.1| ENSANGP00000019908 [Anopheles gambi...    91   8e-18
gi|19074703|ref|NP_586209.1| UBIQUITIN-CONJUGATING ENZYME E2 SUB...    91   8e-18
gi|477134|pir||A48145 ubiquitin-conjugating enzyme ubc-2 - Caeno...    91   8e-18
gi|50746901|ref|XP_420667.1| PREDICTED: similar to ubiquitin-con...    91   8e-18
gi|19347846|gb|AAL86003.1| putative E2, ubiquitin-conjugating en...    91   1e-17
gi|31088843|sp|Q42540|UBC7_ARATH Ubiquitin-conjugating enzyme E2...    91   1e-17
gi|18424219|ref|NP_568902.1| ubiquitin-conjugating enzyme 7 (UBC...    91   1e-17
gi|136647|sp|P25868|UBC7_WHEAT Ubiquitin-conjugating enzyme E2 7...    91   1e-17
gi|28973769|gb|AAO64200.1| putative E2, ubiquitin-conjugating en...    91   1e-17
gi|16152184|gb|AAL14998.1| RAD6-like protein HR6A [Bos taurus]         91   1e-17
gi|33188456|ref|NP_862821.1| ubiquitin-conjugating enzyme E2D 2 ...    91   1e-17
gi|6649658|gb|AAF21503.1| Ubc7p homolog [Mus musculus]                 91   1e-17
gi|1373001|gb|AAB02168.1| ubiquitin conjugating enzyme                 91   1e-17
gi|34903234|ref|NP_912964.1| unnamed protein product [Oryza sati...    91   1e-17
gi|49250425|gb|AAH74529.1| Unknown (protein for MGC:69351) [Xeno...    91   1e-17
gi|7108761|gb|AAF36528.1| RAD6 homolog [Sus scrofa]                    91   1e-17
gi|50540444|ref|NP_001002688.1| zgc:91847 [Danio rerio] >gnl|BL_...    91   1e-17
gi|19115841|ref|NP_594929.1| ubiquitin-conjugating enzyme [Schiz...    90   2e-17
gi|20984341|ref|XP_135925.1| similar to Ubiquitin-conjugating en...    90   2e-17
gi|49096056|ref|XP_409488.1| hypothetical protein AN5351.2 [Aspe...    90   2e-17
gi|41054637|ref|NP_955865.1| ubiquitin-conjugating enzyme E2D 2;...    90   2e-17
gi|24580841|ref|NP_608594.1| CG5440-PA [Drosophila melanogaster]...    90   2e-17
gi|17553748|ref|NP_499133.1| ubiquitin conjugating enzyme (18.9 ...    90   2e-17
gi|28175616|gb|AAH45129.1| MGC53533 protein [Xenopus laevis]           89   3e-17
gi|49067328|ref|XP_397954.1| hypothetical protein UM00339.1 [Ust...    89   4e-17
gi|41055692|ref|NP_957252.1| similar to ubiquitin-conjugating en...    89   4e-17
gi|47221747|emb|CAG08801.1| unnamed protein product [Tetraodon n...    89   4e-17
gi|29245557|gb|EAA37189.1| GLP_243_16653_17147 [Giardia lamblia ...    89   4e-17
gi|47215198|emb|CAG01405.1| unnamed protein product [Tetraodon n...    89   5e-17
gi|50540266|ref|NP_001002600.1| zgc:92307 [Danio rerio] >gnl|BL_...    89   5e-17
gi|39590794|emb|CAE65167.1| Hypothetical protein CBG10037 [Caeno...    89   5e-17
gi|136651|sp|P25869|UBC_ASFM2 Ubiquitin-conjugating enzyme E2-21...    88   7e-17
gi|29841267|gb|AAP06299.1| similar to GenBank Accession Number U...    88   7e-17
gi|16357477|ref|NP_004350.1| cell division cycle 34; ubiquitin-c...    88   9e-17
gi|33359701|ref|NP_872630.1| ubiquitin-conjugating enzyme E2G 2 ...    88   9e-17
gi|2136341|pir||A49630 ubiquitin conjugating enzyme - human (fra...    88   9e-17
gi|30584917|gb|AAP36715.1| Homo sapiens cell division cycle 34 [...    88   9e-17
gi|27717493|ref|XP_216827.1| similar to cell division cycle 34; ...    88   9e-17
gi|29243988|ref|NP_808281.1| cell division cycle 34 homolog [Mus...    88   9e-17
gi|47226201|emb|CAG08348.1| unnamed protein product [Tetraodon n...    87   1e-16
gi|17646076|emb|CAC80335.1| ubiquitin coniugating enzyme 3b [Mus...    87   1e-16
gi|50418605|ref|XP_457821.1| unnamed protein product [Debaryomyc...    87   2e-16
gi|12843975|dbj|BAB26188.1| unnamed protein product [Mus musculus]     87   2e-16
gi|26376813|dbj|BAC25019.1| unnamed protein product [Mus musculus]     87   2e-16
gi|1381181|gb|AAB02656.1| ubiquitin-conjugating enzyme E2-32k          87   2e-16
gi|27675436|ref|XP_214806.1| similar to RIKEN cDNA 6720465F12 [R...    87   2e-16
gi|19527004|ref|NP_598538.1| ubiquitin-conjugating enzyme E2S [M...    87   2e-16
gi|33585636|gb|AAH56005.1| Ube2r2-prov protein [Xenopus laevis] ...    87   2e-16
gi|13385778|ref|NP_080551.1| ubiquitin-conjugating enzyme E2R 2 ...    87   2e-16
gi|26344497|dbj|BAC35899.1| unnamed protein product [Mus musculus]     87   2e-16
gi|49096344|ref|XP_409632.1| hypothetical protein AN5495.2 [Aspe...    86   3e-16
gi|19074140|ref|NP_584746.1| UBIQUITIN CONJUGATING ENZYME E2 18k...    86   3e-16
gi|47213200|emb|CAF95316.1| unnamed protein product [Tetraodon n...    86   3e-16
gi|25143513|ref|NP_490882.2| ubiquitin conjugating enzyme (ubc-3...    86   4e-16
gi|40363447|dbj|BAD06214.1| ubiquitin conjugating enzyme E2 [Xen...    86   4e-16
gi|31216813|ref|XP_316306.1| ENSANGP00000020629 [Anopheles gambi...    85   6e-16
gi|47221645|emb|CAF97910.1| unnamed protein product [Tetraodon n...    85   6e-16
gi|34869227|ref|XP_341289.1| similar to cDNA sequence BC016265 [...    85   6e-16
gi|17946312|gb|AAL49196.1| RE63412p [Drosophila melanogaster] >g...    85   6e-16
gi|50732762|ref|XP_418751.1| PREDICTED: similar to ubiquitin-con...    85   6e-16
gi|32412402|ref|XP_326681.1| hypothetical protein [Neurospora cr...    85   6e-16
gi|21450233|ref|NP_659088.1| ubiquitin-conjugating enzyme E2E 2 ...    85   6e-16
gi|22749327|ref|NP_689866.1| ubiquitin-conjugating enzyme E2E 2 ...    85   6e-16
gi|39589388|emb|CAE74417.1| Hypothetical protein CBG22149 [Caeno...    85   8e-16
gi|46128361|ref|XP_388734.1| conserved hypothetical protein [Gib...    85   8e-16
gi|41055506|ref|NP_957215.1| ubiquitin-conjugating enzyme E2E 3;...    85   8e-16
gi|40363453|dbj|BAD06217.1| ubiquitin conjugating enzyme E2 [Xen...    85   8e-16
gi|1072386|emb|CAA63352.1| ubiquitin-conjugating enzyme UbcM2 [M...    85   8e-16
gi|45361457|ref|NP_989305.1| hypothetical protein MGC76120 [Xeno...    85   8e-16
gi|5454146|ref|NP_006348.1| ubiquitin-conjugating enzyme E2E 3; ...    85   8e-16
gi|50750373|ref|XP_421975.1| PREDICTED: similar to ubiquitin-con...    85   8e-16
gi|19075569|ref|NP_588069.1| ubiquitin conjugating enzyme [Schiz...    85   8e-16
gi|27371275|gb|AAH41263.1| MGC52831 protein [Xenopus laevis]           85   8e-16
gi|50555277|ref|XP_505047.1| hypothetical protein [Yarrowia lipo...    85   8e-16
gi|32398994|emb|CAD98459.1| putative ubiquitin-conjugating enzym...    84   1e-15
gi|50414876|gb|AAH77801.1| Unknown (protein for MGC:80411) [Xeno...    84   1e-15
gi|17530929|ref|NP_511150.1| CG18319-PA [Drosophila melanogaster...    84   1e-15
gi|46442744|gb|EAL02031.1| hypothetical protein CaO19.13882 [Can...    84   1e-15
gi|7657046|ref|NP_055316.1| ubiquitin carrier protein; ubiquitin...    84   1e-15
gi|23829978|sp|Q16763|UBCE_HUMAN Ubiquitin-conjugating enzyme E2...    84   1e-15
gi|7020506|dbj|BAA91156.1| unnamed protein product [Homo sapiens]      84   1e-15
gi|345829|pir||B42856 ubiquitin carrier protein E2 - human             84   1e-15
gi|50257543|gb|EAL20248.1| hypothetical protein CNBF0600 [Crypto...    84   2e-15
gi|23487093|gb|EAA20958.1| ubiquitin conjugating enzyme [Plasmod...    84   2e-15
gi|18376280|emb|CAD21393.1| probable ubiquitin-conjugating enzym...    84   2e-15
gi|40363451|dbj|BAD06216.1| ubiquitin conjugating enzyme E2 [Xen...    84   2e-15
gi|4097684|gb|AAD00154.1| ubiquitin conjugating enzyme [Metarhiz...    84   2e-15
gi|38100154|gb|EAA47325.1| hypothetical protein MG02568.4 [Magna...    84   2e-15
gi|50370097|gb|AAH76483.1| Unknown (protein for MGC:92467) [Dani...    84   2e-15
gi|13489085|ref|NP_003333.1| ubiquitin-conjugating enzyme E2G 1 ...    83   2e-15
gi|41054097|ref|NP_956157.1| ubiquitin-conjugating enzyme E2G 1;...    83   2e-15
gi|45360717|ref|NP_989032.1| hypothetical protein MGC75971 [Xeno...    83   2e-15
gi|47210823|emb|CAF90880.1| unnamed protein product [Tetraodon n...    83   2e-15
gi|47214413|emb|CAG00254.1| unnamed protein product [Tetraodon n...    83   2e-15
gi|4507779|ref|NP_003332.1| ubiquitin-conjugating enzyme E2E 1 i...    83   2e-15
gi|6678479|ref|NP_033481.1| ubiquitin-conjugating enzyme E2E 1, ...    83   2e-15
gi|50732764|ref|XP_418752.1| PREDICTED: similar to Ubiquitin-con...    83   2e-15
gi|19115771|ref|NP_594859.1| ubiquitin-conjugating enzyme e2-16 ...    83   2e-15
gi|31197971|ref|XP_307933.1| ENSANGP00000021824 [Anopheles gambi...    83   2e-15
gi|33359691|ref|NP_872607.1| ubiquitin-conjugating enzyme E2E 1 ...    83   2e-15
gi|30585349|gb|AAP36947.1| Homo sapiens ubiquitin-conjugating en...    83   2e-15
gi|32417650|ref|XP_329303.1| hypothetical protein [Neurospora cr...    83   2e-15
gi|7488595|pir||T14451 ubiquitin conjugating enzyme, E2 - wild c...    83   3e-15
gi|46441146|gb|EAL00445.1| hypothetical protein CaO19.7571 [Cand...    83   3e-15
gi|48103517|ref|XP_395589.1| similar to ENSANGP00000010118 [Apis...    83   3e-15
gi|23619484|ref|NP_705446.1| ubiquitin-conjugating enzyme, putat...    83   3e-15
gi|45360755|ref|NP_989051.1| hypothetical protein MGC75869 [Xeno...    83   3e-15
gi|46229312|gb|EAK90161.1| ubiquitin-conjugating enzyme [Cryptos...    83   3e-15
gi|6996506|emb|CAB75567.1| ubiquitin-conjugating enzyme E2 [Leis...    83   3e-15
gi|17137158|ref|NP_477137.1| CG6720-PA [Drosophila melanogaster]...    83   3e-15
gi|38048399|gb|AAR10102.1| similar to Drosophila melanogaster cr...    82   4e-15
gi|17978813|gb|AAL49960.1| ubiquitin-conjugating enzyme [Mus mus...    82   4e-15
gi|31210263|ref|XP_314098.1| ENSANGP00000010475 [Anopheles gambi...    82   4e-15
gi|25153953|ref|NP_500272.2| ubiquitin conjugating enzyme (16.9 ...    82   4e-15
gi|34391429|gb|AAN16046.1| ubiquitin-conjugating enzyme E2 [Pavl...    82   5e-15
gi|7688217|emb|CAB89853.1| dJ680N4.2 (ubiquitin-conjugating enzy...    82   5e-15
gi|48103877|ref|XP_392901.1| similar to ENSANGP00000010475 [Apis...    82   5e-15
gi|50259390|gb|EAL22063.1| hypothetical protein CNBC2010 [Crypto...    82   5e-15
gi|47212904|emb|CAF90794.1| unnamed protein product [Tetraodon n...    82   6e-15
gi|27696459|gb|AAH44029.1| Hspc150-prov protein [Xenopus laevis]       82   6e-15
gi|23613292|ref|NP_703614.1| ubiquitin-conjugating enzyme, putat...    82   6e-15
gi|50418285|gb|AAH77923.1| Unknown (protein for MGC:80856) [Xeno...    81   8e-15
gi|38105743|gb|EAA52133.1| hypothetical protein MG03728.4 [Magna...    81   8e-15
gi|45549578|ref|NP_573237.2| CG8188-PA [Drosophila melanogaster]...    81   1e-14
gi|47223770|emb|CAF98540.1| unnamed protein product [Tetraodon n...    81   1e-14
gi|37606125|emb|CAE50620.1| SI:zK83D9.5 (novel protein similar t...    81   1e-14
gi|47087229|ref|NP_998695.1| zgc:55321 [Danio rerio] >gnl|BL_ORD...    81   1e-14
gi|15450383|gb|AAK96485.1| unknown protein [Arabidopsis thaliana...    81   1e-14
gi|18404220|ref|NP_566751.1| ubiquitin-conjugating enzyme, putat...    81   1e-14
gi|31225040|ref|XP_317521.1| ENSANGP00000010118 [Anopheles gambi...    81   1e-14
gi|50257765|gb|EAL20466.1| hypothetical protein CNBE3870 [Crypto...    81   1e-14
gi|15076898|gb|AAK82982.1| putative ubiquitin-conjugating enzyme...    81   1e-14
gi|50555001|ref|XP_504909.1| hypothetical protein [Yarrowia lipo...    80   1e-14
gi|50758062|ref|XP_415742.1| PREDICTED: similar to KIAA1255 prot...    80   1e-14
gi|47217548|emb|CAG02475.1| unnamed protein product [Tetraodon n...    80   1e-14
gi|18087414|gb|AAL58874.1| ubiquitin-conjugating enzyme [Homo sa...    80   1e-14
gi|28828661|gb|AAO51264.1| similar to E2, ubiquitin-conjugating ...    80   1e-14
gi|6324915|ref|NP_014984.1| Ubiquitin-conjugating enzyme most si...    80   1e-14
gi|45219794|gb|AAH66948.1| UBE2S protein [Homo sapiens]                80   1e-14
gi|47218772|emb|CAG02758.1| unnamed protein product [Tetraodon n...    80   1e-14
gi|39587909|emb|CAE67928.1| Hypothetical protein CBG13528 [Caeno...    80   1e-14
gi|49067948|ref|XP_398263.1| hypothetical protein UM00648.1 [Ust...    80   1e-14
gi|47219797|emb|CAG03424.1| unnamed protein product [Tetraodon n...    80   2e-14
gi|48095539|ref|XP_394467.1| similar to ENSANGP00000020629 [Apis...    80   2e-14
gi|46575928|ref|NP_997236.1| ubiquitin-conjugating enzyme UbcM2 ...    80   2e-14
gi|46438455|gb|EAK97785.1| hypothetical protein CaO19.933 [Candi...    80   2e-14
gi|46431269|gb|EAK90863.1| hypothetical protein CaO19.2225 [Cand...    80   2e-14
gi|42662656|ref|XP_208431.2| similar to ubiquitin-conjugating en...    80   2e-14
gi|49089228|ref|XP_406349.1| hypothetical protein AN2212.2 [Aspe...    80   2e-14
gi|3915189|sp|P56616|UBCB_XENLA Ubiquitin-conjugating enzyme X (...    79   3e-14
gi|50422541|ref|XP_459842.1| unnamed protein product [Debaryomyc...    79   3e-14
gi|16041138|dbj|BAB69736.1| hypothetical protein [Macaca fascicu...    79   3e-14
gi|32414141|ref|XP_327550.1| hypothetical protein [Neurospora cr...    79   4e-14
gi|48095134|ref|XP_392244.1| similar to CG8188-PA [Apis mellifera]     79   4e-14
gi|5381319|gb|AAD42941.1| ubiquitin-conjugating enzyme E2 [Catha...    79   4e-14
gi|50258618|gb|EAL21305.1| hypothetical protein CNBD3590 [Crypto...    79   4e-14
gi|49071612|ref|XP_400095.1| hypothetical protein UM02480.1 [Ust...    79   4e-14
gi|1510110|dbj|BAA09092.1| ubiquitin-conjugating enzyme [Paramec...    79   5e-14
gi|24663332|ref|NP_648582.1| CG10682-PA [Drosophila melanogaster...    79   5e-14
gi|19075112|ref|NP_586713.1| UBIQUITIN CONJUGATING ENZYME E2 [En...    78   7e-14
gi|38074655|ref|XP_196253.2| similar to Ubiquitin-conjugating en...    78   7e-14
gi|38101490|gb|EAA48445.1| hypothetical protein MG00103.4 [Magna...    78   7e-14
gi|50550159|ref|XP_502552.1| hypothetical protein [Yarrowia lipo...    78   7e-14
gi|50547641|ref|XP_501290.1| hypothetical protein [Yarrowia lipo...    78   7e-14
gi|22749027|ref|NP_689702.1| hypothetical protein MGC35130 [Homo...    78   9e-14
gi|50288567|ref|XP_446713.1| unnamed protein product [Candida gl...    78   9e-14
gi|23490884|gb|EAA22551.1| putative ubiquitin-conjugating enzyme...    78   9e-14
gi|4868141|gb|AAD31181.1| ubiquitin-conjugating enzyme 1 isoform...    78   9e-14
gi|46433436|gb|EAK92876.1| hypothetical protein CaO19.8686 [Cand...    77   1e-13
gi|45201217|ref|NP_986787.1| AGR121Cp [Eremothecium gossypii] >g...    77   1e-13
gi|46433463|gb|EAK92902.1| hypothetical protein CaO19.1085 [Cand...    77   1e-13
gi|41150698|ref|XP_372660.1| similar to Ubiquitin-conjugating en...    77   2e-13
gi|23491070|gb|EAA22697.1| probable ubiquitin-conjugating enzyme...    77   2e-13
gi|19921342|ref|NP_609715.1| CG3473-PA [Drosophila melanogaster]...    77   2e-13
gi|47209021|emb|CAF89770.1| unnamed protein product [Tetraodon n...    77   2e-13
gi|34900028|ref|NP_911360.1| putative Rad6 [Oryza sativa (japoni...    77   2e-13
gi|32967287|ref|NP_861517.1| ubiquitin-conjugating enzyme E2C is...    77   2e-13
gi|7510556|pir||T27470 hypothetical protein Y87G2A.r - Caenorhab...    77   2e-13
gi|30583869|gb|AAP36183.1| Homo sapiens ubiquitin-conjugating en...    77   2e-13
gi|45198832|ref|NP_985861.1| AFR314Wp [Eremothecium gossypii] >g...    77   2e-13
gi|5902146|ref|NP_008950.1| ubiquitin-conjugating enzyme E2C iso...    77   2e-13
gi|27704688|ref|XP_215924.1| similar to ubiquitin-conjugating en...    77   2e-13
gi|29841409|gb|AAP06441.1| similar to NM_007019 ubiquitin-conjug...    77   2e-13
gi|47211211|emb|CAF90168.1| unnamed protein product [Tetraodon n...    77   2e-13
gi|49128246|ref|XP_412839.1| hypothetical protein AN8702.2 [Aspe...    77   2e-13
gi|629564|pir||S43786 ubiquitin-protein ligase (EC 6.3.2.19) - A...    76   3e-13
gi|23394373|gb|AAN31476.1| ubiquitin-conjugating enzyme [Phytoph...    76   3e-13
gi|25293655|pir||A96663 hypothetical protein T12P18.18 [imported...    76   3e-13
gi|50258359|gb|EAL21048.1| hypothetical protein CNBD4240 [Crypto...    76   3e-13
gi|18414783|ref|NP_568148.1| ubiquitin-conjugating enzyme, putat...    76   3e-13
gi|22330406|ref|NP_564817.2| ubiquitin-conjugating enzyme 5 (UBC...    76   3e-13
gi|32450396|gb|AAH53797.1| Ube2n-prov protein [Xenopus laevis]         76   3e-13
gi|6097072|dbj|BAA85660.1| cyclin-selective ubiquitin carrier pr...    75   5e-13
gi|30693868|ref|NP_851116.1| ubiquitin-conjugating enzyme 8 (UBC...    75   5e-13
gi|50417686|gb|AAH77833.1| Unknown (protein for MGC:80512) [Xeno...    75   5e-13
gi|45360567|ref|NP_988956.1| hypothetical protein MGC75750 [Xeno...    75   5e-13
gi|48102172|ref|XP_392749.1| similar to ENSANGP00000013586 [Apis...    75   5e-13
gi|50255590|gb|EAL18323.1| hypothetical protein CNBJ2460 [Crypto...    75   5e-13
gi|20862207|ref|XP_141534.1| ubiquitin-conjugating enzyme E2C [M...    75   5e-13
gi|50405051|ref|YP_054143.1| Ubiquitin-conjugating enzyme, putat...    75   5e-13
gi|38048037|gb|AAR09921.1| similar to Drosophila melanogaster ef...    75   6e-13
gi|49084306|ref|XP_404363.1| hypothetical protein AN0226.2 [Aspe...    75   6e-13
gi|38078603|ref|XP_355502.1| similar to hypothetical protein [Mu...    75   6e-13
gi|7287841|gb|AAF44879.1| hypothetical protein [Drosophila melan...    75   6e-13
gi|45361601|ref|NP_989375.1| hypothetical protein MGC75672 [Xeno...    75   6e-13
gi|50775202|ref|XP_423237.1| PREDICTED: similar to ubiquitin con...    75   8e-13
gi|1362103|pir||S57619 ubiquitin conjugating enzyme - tomato >gn...    75   8e-13
gi|47213663|emb|CAF95616.1| unnamed protein product [Tetraodon n...    75   8e-13
gi|18394416|ref|NP_564011.1| ubiquitin-conjugating enzyme, putat...    75   8e-13
gi|41054401|ref|NP_956636.1| hypothetical protein MGC63901 [Dani...    75   8e-13
gi|7661808|ref|NP_054895.1| HSPC150 protein similar to ubiquitin...    75   8e-13
gi|50421683|ref|XP_459396.1| unnamed protein product [Debaryomyc...    75   8e-13
gi|12838544|dbj|BAB24239.1| unnamed protein product [Mus musculus]     75   8e-13
gi|16758810|ref|NP_446380.1| ubiquitin-conjugating enzyme E2N (h...    75   8e-13
gi|19113031|ref|NP_596239.1| ubiquitin-conjugating enzyme [Schiz...    74   1e-12
gi|18422085|ref|NP_568589.1| ubiquitin-conjugating enzyme 4 (UBC...    74   1e-12
gi|50728482|ref|XP_416140.1| PREDICTED: similar to Ube2n protein...    74   1e-12
gi|28174992|gb|AAH34898.2| Ube2n protein [Mus musculus]                74   1e-12
gi|34391575|gb|AAN46746.1| E2 ubiquitin-conjugating enzyme UbcH5...    74   1e-12
gi|30583959|gb|AAP36228.1| Homo sapiens ubiquitin-conjugating en...    74   1e-12
gi|6320297|ref|NP_010377.1| Ubiquitin-conjugating enzyme involve...    74   1e-12
gi|18412149|ref|NP_565192.1| ubiquitin-conjugating enzyme, putat...    74   1e-12
gi|13812002|ref|NP_113132.1| ubiquitin-conjugating enzyme E2-17 ...    74   1e-12
gi|7493573|pir||T40123 ubiquitin-conjugating enzyme - fission ye...    74   1e-12
gi|47087307|ref|NP_998651.1| zgc:55726 [Danio rerio] >gnl|BL_ORD...    74   1e-12
gi|46136229|ref|XP_389806.1| hypothetical protein FG09630.1 [Gib...    74   1e-12
gi|14719686|pdb|1JAT|A Chain A, Mms2UBC13 UBIQUITIN CONJUGATING ...    74   1e-12
gi|47228355|emb|CAG07750.1| unnamed protein product [Tetraodon n...    74   1e-12
gi|15241303|ref|NP_199900.1| ubiquitin-conjugating enzyme, putat...    74   1e-12
gi|4507793|ref|NP_003339.1| ubiquitin-conjugating enzyme E2N; be...    74   1e-12
gi|50306051|ref|XP_452987.1| unnamed protein product [Kluyveromy...    74   1e-12
gi|47222043|emb|CAG12069.1| unnamed protein product [Tetraodon n...    74   1e-12
gi|34880242|ref|XP_341125.1| similar to RIKEN cDNA 2700084L22 [R...    74   1e-12
gi|34911052|ref|NP_916873.1| ubiquitin-conjugating enzyme E2 [Or...    74   1e-12
gi|47214985|emb|CAG01319.1| unnamed protein product [Tetraodon n...    74   1e-12


>gi|17540072|ref|NP_500604.1| ubiquitin conjugating enzyme (19.1 kD)
           (ubc-9C) [Caenorhabditis elegans]
 gi|50401647|sp|Q95017|UBC9_CAEEL Ubiquitin-conjugating enzyme E2 9
           (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein
           9)
 gi|7500139|pir||T29929 hypothetical protein F29B9.6 -
           Caenorhabditis elegans
 gi|4038452|gb|AAC97374.1| ubiquitin-conjugating enzyme 9 homolog
           [Caenorhabditis elegans]
 gi|14550375|gb|AAK67232.1| Ubiquitin conjugating enzyme protein 9
           [Caenorhabditis elegans]
          Length = 166

 Score =  352 bits (902), Expect = 3e-96
 Identities = 166/166 (100%), Positives = 166/166 (100%)
 Frame = +1

Query: 1   MSGIAAGRLAEERKHWRKDHPFGFIAKPVKNADGTLNLFNWECAIPGRKDTIWEGGLYRI 180
           MSGIAAGRLAEERKHWRKDHPFGFIAKPVKNADGTLNLFNWECAIPGRKDTIWEGGLYRI
Sbjct: 1   MSGIAAGRLAEERKHWRKDHPFGFIAKPVKNADGTLNLFNWECAIPGRKDTIWEGGLYRI 60

Query: 181 RMLFKDDFPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDENKDWKPSISIKQLLIGIQDLL 360
           RMLFKDDFPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDENKDWKPSISIKQLLIGIQDLL
Sbjct: 61  RMLFKDDFPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDENKDWKPSISIKQLLIGIQDLL 120

Query: 361 NHPNIEDPAQAEAYQIYCQNRAEYEKRVKKEAVKYAAELVQKQMLE 498
           NHPNIEDPAQAEAYQIYCQNRAEYEKRVKKEAVKYAAELVQKQMLE
Sbjct: 121 NHPNIEDPAQAEAYQIYCQNRAEYEKRVKKEAVKYAAELVQKQMLE 166




[DB home][top]