Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F28H6_7
(854 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25146791|ref|NP_510357.2| AKT kinase (55.8 kD) (akt-2) [Caeno... 585 e-166
gi|7500109|pir||T21523 protein kinase (EC 2.7.1.37) akt-2 long s... 585 e-166
gi|17557832|ref|NP_505637.1| AKT kinase (62.2 kD) (akt-1) [Caeno... 366 e-100
gi|39593304|emb|CAE64774.1| Hypothetical protein CBG09565 [Caeno... 354 2e-96
gi|25145932|ref|NP_741614.1| AKT kinase (62.7 kD) (akt-1) [Caeno... 344 1e-93
gi|22265756|emb|CAD44085.1| Hypothetical protein C12D8.10c [Caen... 297 2e-79
gi|37700244|ref|NP_937789.1| v-akt murine thymoma viral oncogene... 270 4e-71
gi|12539654|gb|AAG59601.1| Akt [Xenopus laevis] 269 5e-71
gi|13928778|ref|NP_113763.1| thymoma viral proto-oncogene 3; v-a... 269 7e-71
gi|7512664|pir||T17287 protein kinase (EC 2.7.1.37) akt3 short s... 269 7e-71
gi|32307163|ref|NP_859029.1| v-akt murine thymoma viral oncogene... 269 7e-71
gi|4885549|ref|NP_005456.1| v-akt murine thymoma viral oncogene ... 269 7e-71
gi|11131397|sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-prot... 269 7e-71
gi|50740731|ref|XP_419544.1| PREDICTED: similar to RAC-gamma ser... 269 7e-71
gi|45433564|ref|NP_035915.2| thymoma viral proto-oncogene 3; PKB... 269 7e-71
gi|33304021|gb|AAQ02518.1| v-akt murine thymoma viral oncogene-l... 269 7e-71
gi|400112|sp|P31748|KAKT_MLVAT AKT kinase transforming protein 266 3e-70
gi|538540|pir||A40831 gag-akt polyprotein - AKT8 murine leukemia... 266 3e-70
gi|26333955|dbj|BAC30695.1| unnamed protein product [Mus musculus] 266 3e-70
gi|400144|sp|P31750|KRAC_MOUSE RAC-alpha serine/threonine-protei... 266 3e-70
gi|6753034|ref|NP_033782.1| thymoma viral proto-oncogene 1 [Mus ... 266 3e-70
gi|15100164|ref|NP_150233.1| v-akt murine thymoma viral oncogene... 266 4e-70
gi|4502023|ref|NP_001617.1| v-akt murine thymoma viral oncogene ... 265 9e-70
gi|337491|gb|AAA36585.1| rac protein kinase-beta [Homo sapiens] 265 9e-70
gi|8392888|ref|NP_058789.1| murine thymoma viral (v-akt) oncogen... 265 1e-69
gi|6680674|ref|NP_031460.1| thymoma viral proto-oncogene 2; RAC-... 264 2e-69
gi|45384254|ref|NP_990386.1| serine/threonine protein kinase [Ga... 264 2e-69
gi|33303885|gb|AAQ02456.1| v-akt murine thymoma viral oncogene h... 264 2e-69
gi|12653417|gb|AAH00479.1| AKT1 protein [Homo sapiens] 264 2e-69
gi|4885061|ref|NP_005154.1| serine/threonine protein kinase; Mur... 264 2e-69
gi|30725240|gb|AAP37655.1| serine/threonine protein kinase Akt [... 262 8e-69
gi|27806747|ref|NP_776411.1| v-akt murine thymoma viral oncogene... 261 1e-68
gi|1079127|pir||A55888 protein kinase (EC 2.7.1.37) akt [similar... 259 7e-68
gi|45551909|ref|NP_732113.2| CG4006-PC [Drosophila melanogaster]... 259 7e-68
gi|48138240|ref|XP_396874.1| similar to serine/threonine protein... 259 7e-68
gi|24647358|ref|NP_732114.1| CG4006-PA [Drosophila melanogaster]... 259 7e-68
gi|47086403|ref|NP_997980.1| v-akt murine thymoma viral oncogene... 258 1e-67
gi|28279352|gb|AAH46261.1| Akt2-prov protein [Xenopus laevis] 258 2e-67
gi|398924|emb|CAA81204.1| Dakt1 serine-threonine protein kinase ... 256 4e-67
gi|47939913|gb|AAH72041.1| MGC78893 protein [Xenopus laevis] 256 6e-67
gi|31198165|ref|XP_308030.1| ENSANGP00000019348 [Anopheles gambi... 254 2e-66
gi|47223805|emb|CAF98575.1| unnamed protein product [Tetraodon n... 252 6e-66
gi|47230282|emb|CAG10696.1| unnamed protein product [Tetraodon n... 246 6e-64
gi|16266771|dbj|BAB69974.1| kinase Akt/PKB [Asterina pectinifera] 233 5e-60
gi|22087745|gb|AAM91027.1| protein kinase B [Hydra vulgaris] 227 2e-58
gi|47209740|emb|CAF93725.1| unnamed protein product [Tetraodon n... 223 3e-57
gi|47211725|emb|CAF92523.1| unnamed protein product [Tetraodon n... 219 5e-56
gi|35481|emb|CAA43372.1| human protein kinase B [Homo sapiens] 192 8e-48
gi|27066378|pdb|1O6K|A Chain A, Structure Of Activated Form Of P... 150 3e-35
gi|37926827|pdb|1MRV|A Chain A, Crystal Structure Of An Inactive... 150 3e-35
gi|31615318|pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain 150 3e-35
gi|31615317|pdb|1GZK|A Chain A, Molecular Mechanism For The Regu... 150 3e-35
gi|27066381|pdb|1O6L|A Chain A, Crystal Structure Of An Activate... 150 3e-35
gi|26324816|dbj|BAC26162.1| unnamed protein product [Mus musculus] 150 3e-35
gi|34303892|dbj|BAC82421.1| hypothetical protein [Entamoeba hist... 134 3e-30
gi|6650370|gb|AAF21806.1| rac serine/threonine kinase homolog [D... 133 6e-30
gi|49258425|pdb|1P6S|A Chain A, Solution Structure Of The Plecks... 128 1e-28
gi|33356980|pdb|1H10|A Chain A, High Resolution Structure Of The... 124 3e-27
gi|50731568|ref|XP_418280.1| PREDICTED: similar to Serine/threon... 121 2e-26
gi|33303813|gb|AAQ02420.1| serum/glucocorticoid regulated kinase... 120 5e-26
gi|31563382|ref|NP_037389.4| serum/glucocorticoid regulated kina... 120 5e-26
gi|31563383|ref|NP_733827.2| serum/glucocorticoid regulated kina... 120 5e-26
gi|6466010|gb|AAF12758.1| protein kinase [Homo sapiens] >gnl|BL_... 120 5e-26
gi|17402861|gb|AAF27051.2| SGK-like protein SGKL [Homo sapiens] 119 1e-25
gi|26327211|dbj|BAC27349.1| unnamed protein product [Mus musculus] 117 2e-25
gi|18959280|ref|NP_573483.1| serum/glucocorticoid regulated kina... 117 2e-25
gi|464395|sp|P28178|PK2_DICDI Protein kinase 2 >gnl|BL_ORD_ID|12... 117 2e-25
gi|29171296|ref|NP_808215.1| serum/glucocorticoid regulated kina... 117 2e-25
gi|17390848|gb|AAH18363.1| Sgk3 protein [Mus musculus] 117 2e-25
gi|39592150|emb|CAE75370.1| Hypothetical protein CBG23354 [Caeno... 117 3e-25
gi|49119294|gb|AAH73353.1| Unknown (protein for MGC:80770) [Xeno... 117 3e-25
gi|445069|prf||1908384A protein kinase 117 3e-25
gi|6322723|ref|NP_012796.1| 76.5 kDa Serine/threonine protein ki... 117 3e-25
gi|172181|gb|AAA34880.1| protein kinase 117 3e-25
gi|6016444|sp|Q16975|KPC2_APLCA Calcium-independent protein kina... 117 3e-25
gi|19550351|gb|AAL91350.1| serum- and glucocorticoid-inducible k... 117 4e-25
gi|15072452|gb|AAK40343.1| protein kinase 1 [Cryphonectria paras... 116 5e-25
gi|2760821|gb|AAB95270.1| serine/threonine protein kinase [Entam... 116 5e-25
gi|15808364|emb|CAC88367.1| cAMP-dependent protein kinase cataly... 116 7e-25
gi|28302248|gb|AAH46697.1| Kin-1-prov protein [Xenopus laevis] 116 7e-25
gi|50291879|ref|XP_448372.1| unnamed protein product [Candida gl... 116 7e-25
gi|7504545|pir||T22856 hypothetical protein F57F5.5 - Caenorhabd... 115 1e-24
gi|630707|pir||A53530 protein kinase C (EC 2.7.1.-) epsilon-rela... 115 1e-24
gi|17562588|ref|NP_506014.1| protein kinase C (80.2 kD) (pkc-1) ... 115 1e-24
gi|1730069|sp|P54644|KRAC_DICDI RAC-family serine/threonine-prot... 115 1e-24
gi|50304295|ref|XP_452097.1| unnamed protein product [Kluyveromy... 115 1e-24
gi|732542|gb|AAA64341.1| cAMP-dependent protein kinase 115 1e-24
gi|46433231|gb|EAK92679.1| hypothetical protein CaO19.399 [Candi... 115 2e-24
gi|45185202|ref|NP_982919.1| ABL028Wp [Eremothecium gossypii] >g... 115 2e-24
gi|665540|gb|AAC46513.1| cAMP-dependent protein kinase catalytic... 115 2e-24
gi|458284|gb|AAA57318.1| serine/threonine protein kinase 114 2e-24
gi|386012|gb|AAB26832.1| rac protein kinase/racPPK [Drosophila, ... 114 2e-24
gi|32414173|ref|XP_327566.1| hypothetical protein ( (AY029769) p... 114 3e-24
gi|40363533|ref|NP_954682.1| serum/glucocorticoid regulated kina... 114 3e-24
gi|49067618|ref|XP_398099.1| hypothetical protein UM00484.1 [Ust... 114 3e-24
gi|49097300|ref|XP_410110.1| hypothetical protein AN5973.2 [Aspe... 114 4e-24
gi|47213969|emb|CAG00660.1| unnamed protein product [Tetraodon n... 114 4e-24
gi|445070|prf||1908384B protein kinase 114 4e-24
gi|6323751|ref|NP_013822.1| protein kinase; Ypk2p [Saccharomyces... 114 4e-24
gi|50552438|ref|XP_503629.1| hypothetical protein [Yarrowia lipo... 113 5e-24
gi|25141294|ref|NP_740961.1| cyclic AMP-dependent catalytic subu... 113 5e-24
gi|25141308|ref|NP_740960.1| cyclic AMP-dependent catalytic subu... 113 5e-24
gi|46122935|ref|XP_386021.1| hypothetical protein FG05845.1 [Gib... 113 5e-24
gi|50417908|gb|AAH78343.1| Unknown (protein for MGC:91856) [Dani... 113 6e-24
gi|25141302|ref|NP_740957.1| cyclic AMP-dependent catalytic subu... 112 8e-24
gi|17508227|ref|NP_493605.1| cyclic AMP-dependent catalytic subu... 112 8e-24
gi|25141310|ref|NP_740962.1| cyclic AMP-dependent catalytic subu... 112 8e-24
gi|25141296|ref|NP_740958.1| cyclic AMP-dependent catalytic subu... 112 8e-24
gi|25141292|ref|NP_740963.1| cyclic AMP-dependent catalytic subu... 112 8e-24
gi|25141306|ref|NP_740959.1| cyclic AMP-dependent catalytic subu... 112 8e-24
gi|25141304|ref|NP_740955.1| cyclic AMP-dependent catalytic subu... 112 8e-24
gi|17508225|ref|NP_493606.1| cyclic AMP-dependent catalytic subu... 112 8e-24
gi|39584482|emb|CAE72620.1| Hypothetical protein CBG19814 [Caeno... 112 8e-24
gi|25141298|ref|NP_740956.1| cyclic AMP-dependent catalytic subu... 112 8e-24
gi|25141300|ref|NP_740954.1| cyclic AMP-dependent catalytic subu... 112 8e-24
gi|3114991|emb|CAA73557.1| Serine/Threonine protein kinase [Syco... 112 8e-24
gi|50255581|gb|EAL18314.1| hypothetical protein CNBJ2370 [Crypto... 112 1e-23
gi|31206439|ref|XP_312175.1| ENSANGP00000022036 [Anopheles gambi... 112 1e-23
gi|28557781|ref|NP_006246.2| protein kinase C, eta [Homo sapiens... 111 2e-23
gi|28971730|dbj|BAC65325.1| testis catalytic subunit of cyclic a... 111 2e-23
gi|7110693|ref|NP_032880.1| protein kinase, cAMP dependent, cata... 111 2e-23
gi|8568079|gb|AAF76425.1| sperm cAMP-dependent protein kinase ca... 111 2e-23
gi|50751398|ref|XP_422379.1| PREDICTED: similar to cAMP-dependen... 111 2e-23
gi|48425310|pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal... 111 2e-23
gi|2914581|pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistid... 111 2e-23
gi|2981777|pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic... 111 2e-23
gi|230462|pdb|2CPK|E Chain E, c-AMP-Dependent Protein Kinase (E.... 111 2e-23
gi|14719578|pdb|1JBP|E Chain E, Crystal Structure Of The Catalyt... 111 2e-23
gi|28948416|pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme C... 111 2e-23
gi|38110989|gb|EAA56628.1| hypothetical protein MG06599.4 [Magna... 111 2e-23
gi|4322298|gb|AAD16003.1| cAMP-dependent protein kinase catalyti... 110 3e-23
gi|4322300|gb|AAD16004.1| cAMP-dependent protein kinase catalyti... 110 3e-23
gi|23478593|gb|EAA15636.1| kinase Akt/PKB-related [Plasmodium yo... 110 3e-23
gi|476512|pir||OKKWC1 protein kinase (EC 2.7.1.37), cAMP-depende... 110 4e-23
gi|47220928|emb|CAG03461.1| unnamed protein product [Tetraodon n... 110 4e-23
gi|22085162|gb|AAM90321.1| putative protein kinase C epsilon [Li... 110 4e-23
gi|25168261|ref|NP_733794.1| serum/glucocorticoid regulated kina... 110 4e-23
gi|33878427|gb|AAH14037.2| SGK2 protein [Homo sapiens] 110 4e-23
gi|476513|pir||OKKWC2 protein kinase (EC 2.7.1.37), cAMP-depende... 110 4e-23
gi|20127541|ref|NP_057360.2| serum/glucocorticoid regulated kina... 110 4e-23
gi|33303995|gb|AAQ02505.1| serum/glucocorticoid regulated kinase... 110 4e-23
gi|1346393|sp|P24723|KPCL_HUMAN Protein kinase C, eta type (nPKC... 110 5e-23
gi|200367|gb|AAA39936.1| cAMP-dependent protein kinase catalytic... 110 5e-23
gi|50427081|ref|XP_462147.1| unnamed protein product [Debaryomyc... 110 5e-23
gi|47224245|emb|CAG09091.1| unnamed protein product [Tetraodon n... 110 5e-23
gi|13592027|ref|NP_112347.1| protein kinase C-eta [Rattus norveg... 110 5e-23
gi|125563|sp|P23298|KPCL_MOUSE Protein kinase C, eta type (nPKC-... 110 5e-23
gi|31543511|ref|NP_032882.2| protein kinase C, eta [Mus musculus... 110 5e-23
gi|349816|pdb|1APM|E Chain E, c-AMP-Dependent Protein Kinase (E.... 110 5e-23
gi|47220463|emb|CAG03243.1| unnamed protein product [Tetraodon n... 110 5e-23
gi|17570293|ref|NP_510647.1| serum and Glucocorticoid inducible ... 110 5e-23
gi|39596349|emb|CAE69987.1| Hypothetical protein CBG16386 [Caeno... 109 7e-23
gi|125207|sp|P27791|KAPA_RAT cAMP-dependent protein kinase, alph... 109 7e-23
gi|39645751|gb|AAH63421.1| Unknown (protein for MGC:70754) [Homo... 109 7e-23
gi|25141290|ref|NP_740964.1| cyclic AMP-dependent catalytic subu... 109 7e-23
gi|20151205|pdb|1L3R|E Chain E, Crystal Structure Of A Transitio... 109 7e-23
gi|34733343|gb|AAQ81631.1| protein kinase A [Rattus norvegicus] 109 7e-23
gi|15808362|emb|CAC88366.1| cAMP-dependent protein kinase cataly... 109 9e-23
gi|23509142|ref|NP_701810.1| rac-beta serine/threonine protein k... 109 9e-23
gi|3688803|gb|AAC62398.1| unknown [Xenopus laevis] 109 9e-23
gi|46909485|gb|AAT06260.1| protein kinase B-like protein [Plasmo... 109 9e-23
gi|26340738|dbj|BAC34031.1| unnamed protein product [Mus musculus] 108 1e-22
gi|28558156|sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase S... 108 1e-22
gi|34860642|ref|XP_342571.1| serum/glucocorticoid regulated kina... 108 1e-22
gi|7305483|ref|NP_038759.1| serum/glucocorticoid regulated kinas... 108 1e-22
gi|50417448|gb|AAH77281.1| Unknown (protein for MGC:80071) [Xeno... 108 1e-22
gi|125204|sp|P25321|KAPA_CRIGR cAMP-dependent protein kinase, al... 108 1e-22
gi|4322296|gb|AAD16002.1| cAMP-dependent protein kinase catalyti... 108 1e-22
gi|6755084|ref|NP_035234.1| protein kinase C, epsilon [Mus muscu... 108 1e-22
gi|47220382|emb|CAF98481.1| unnamed protein product [Tetraodon n... 108 1e-22
gi|31203461|ref|XP_310679.1| ENSANGP00000020017 [Anopheles gambi... 108 2e-22
gi|49116933|gb|AAH73077.1| Sgk protein [Xenopus laevis] 108 2e-22
gi|49359177|gb|AAT65503.1| protein kinase C epsilon [Rattus norv... 107 3e-22
gi|45383215|ref|NP_989807.1| serum- and glucocorticoid-induced k... 107 3e-22
gi|3116066|emb|CAA11528.1| s-sgk2 [Squalus acanthias] 107 3e-22
gi|33636738|ref|NP_891993.1| cAMP-dependent protein kinase catal... 107 3e-22
gi|50513587|pdb|1SMH|A Chain A, Protein Kinase A Variant Complex... 107 3e-22
gi|49257650|gb|AAH74305.1| Unknown (protein for MGC:84110) [Xeno... 107 3e-22
gi|8568081|gb|AAF76426.1| sperm cAMP-dependent protein kinase ca... 107 3e-22
gi|284054|pir||A38143 protein kinase (EC 2.7.1.37), cAMP-depende... 107 3e-22
gi|46909584|ref|NP_997401.1| cAMP-dependent protein kinase catal... 107 3e-22
gi|46909587|ref|NP_997461.1| cAMP-dependent protein kinase catal... 107 3e-22
gi|47224750|emb|CAG00344.1| unnamed protein product [Tetraodon n... 107 3e-22
gi|4506055|ref|NP_002721.1| cAMP-dependent protein kinase cataly... 107 3e-22
gi|23272313|gb|AAH35058.1| CAMP-dependent protein kinase catalyt... 107 3e-22
gi|4506057|ref|NP_002722.1| cAMP-dependent protein kinase cataly... 107 3e-22
gi|50740446|ref|XP_419464.1| PREDICTED: similar to Protein kinas... 107 3e-22
gi|11493951|gb|AAG35720.1| cAMP-dependent protein kinase catalyt... 107 3e-22
gi|35396780|gb|AAQ84896.1| protein kinase C 1 [Cryptococcus neof... 107 4e-22
gi|35396778|gb|AAQ84895.1| protein kinase C 1 [Cryptococcus neof... 107 4e-22
gi|50259580|gb|EAL22253.1| hypothetical protein CNBC3910 [Crypto... 107 4e-22
gi|13431833|sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase... 107 4e-22
gi|477098|pir||A48094 serum and glucocorticoid-regulated kinase ... 107 4e-22
gi|3116064|emb|CAA11527.1| s-sgk1 [Squalus acanthias] 107 4e-22
gi|493956|pdb|1CTP|E Chain E, Camp-Dependent Protein Kinase (E.C... 107 4e-22
gi|576052|pdb|1CMK|E Chain E, Camp-Dependent Protein Kinase Cata... 107 4e-22
gi|1890142|dbj|BAA18952.1| catalytic subunit of cAMP-dependent h... 107 4e-22
gi|9507093|ref|NP_062105.1| serum/glucocorticoid regulated kinas... 107 4e-22
gi|34978340|sp|P36887|KAPA_PIG cAMP-dependent protein kinase, al... 107 4e-22
gi|25168263|ref|NP_005618.2| serum/glucocorticoid regulated kina... 106 6e-22
gi|6755490|ref|NP_035491.1| serum/glucocorticoid regulated kinas... 106 6e-22
gi|3914977|sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase ... 106 6e-22
gi|47124333|gb|AAH70401.1| Sgk protein [Mus musculus] 106 6e-22
gi|33303865|gb|AAQ02446.1| serum/glucocorticoid regulated kinase... 106 6e-22
gi|125218|sp|P24256|KAPI_BOVIN cAMP-dependent protein kinase, be... 106 6e-22
gi|24641525|ref|NP_511171.2| CG10524-PA [Drosophila melanogaster... 106 6e-22
gi|27807059|ref|NP_777010.1| cAMP-dependent protein kinase catal... 106 6e-22
gi|50547917|ref|XP_501428.1| hypothetical protein [Yarrowia lipo... 106 7e-22
gi|37927861|pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb 106 7e-22
gi|34810567|pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb I... 106 7e-22
gi|4885563|ref|NP_005391.1| protein kinase C, epsilon [Homo sapi... 106 7e-22
gi|19075510|ref|NP_588010.1| putative proliferation-associated s... 106 7e-22
gi|66734|pir||KIRBCE protein kinase C (EC 2.7.1.-) epsilon - rabbit 106 7e-22
gi|125556|sp|P10830|KPCE_RABIT Protein kinase C, epsilon type (n... 106 7e-22
gi|89281|pir||S00085 protein kinase (EC 2.7.1.37), cAMP-dependen... 106 7e-22
gi|47215419|emb|CAG01116.1| unnamed protein product [Tetraodon n... 106 7e-22
gi|33860165|sp|P05383|KAPB_PIG cAMP-dependent protein kinase, be... 106 7e-22
gi|47230126|emb|CAG10540.1| unnamed protein product [Tetraodon n... 105 1e-21
gi|17136902|ref|NP_476977.1| CG4379-PA [Drosophila melanogaster]... 105 1e-21
gi|31242643|ref|XP_321752.1| ENSANGP00000016916 [Anopheles gambi... 105 1e-21
gi|44965824|gb|AAS49544.1| protein kinase C beta 1 [Protopterus ... 105 1e-21
gi|6755076|ref|NP_035230.1| protein kinase, cAMP dependent, cata... 105 1e-21
gi|34098572|sp|Q8MJ44|KAPA_CANFA cAMP-dependent protein kinase, ... 105 1e-21
gi|49067855|ref|XP_398217.1| hypothetical protein UM00602.1 [Ust... 105 2e-21
gi|20072336|gb|AAH26549.1| Serum/glucocorticoid regulated kinase... 105 2e-21
gi|39930373|ref|NP_058867.1| protein kinase C, epsilon [Rattus n... 105 2e-21
gi|285145|pir||A60543 protein kinase (EC 2.7.1.37), cAMP-depende... 105 2e-21
gi|102679|pir||S19028 protein kinase (EC 2.7.1.37) A, cAMP-depen... 105 2e-21
gi|15420611|gb|AAK97389.1| PKA catalytic subunit alpha [Oryctola... 105 2e-21
gi|50748818|ref|XP_421417.1| PREDICTED: similar to protein kinas... 105 2e-21
gi|24650924|ref|NP_524545.2| CG1954-PA [Drosophila melanogaster]... 104 2e-21
gi|49259182|pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylm... 104 2e-21
gi|2098410|pdb|1YDT|E Chain E, Structure Of Camp-Dependent Prote... 104 2e-21
gi|2982123|pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Al... 104 2e-21
gi|8568077|gb|AAF76424.1| sperm cAMP-dependent protein kinase ca... 104 2e-21
gi|50254457|gb|EAL17206.1| hypothetical protein CNBN0340 [Crypto... 104 2e-21
gi|41056189|ref|NP_957317.1| similar to protein kinase, cAMP dep... 104 2e-21
gi|125547|sp|P13678|KPC3_DROME Protein kinase C (PKC) (dPKC98F) ... 104 2e-21
gi|34098738|sp|Q9MZD9|KAPA_SHEEP cAMP-dependent protein kinase, ... 104 2e-21
gi|27807057|ref|NP_777009.1| cAMP-dependent protein kinase catal... 104 2e-21
gi|16648134|gb|AAL25332.1| GH13631p [Drosophila melanogaster] 104 2e-21
gi|34860159|ref|XP_215070.2| similar to protein kinase, cAMP dep... 104 3e-21
gi|15231959|ref|NP_187484.1| serine/threonine protein kinase (PK... 104 3e-21
gi|2129541|pir||S68463 protein kinase ATPK19 (EC 2.7.1.-) - Arab... 104 3e-21
gi|102678|pir||S19027 protein kinase A (EC 2.7.1.-) catalytic ch... 104 3e-21
gi|50292225|ref|XP_448545.1| unnamed protein product [Candida gl... 103 4e-21
gi|47225434|emb|CAG11917.1| unnamed protein product [Tetraodon n... 103 4e-21
gi|47227642|emb|CAG09639.1| unnamed protein product [Tetraodon n... 103 5e-21
gi|19114649|ref|NP_593737.1| protein kinase c-like 1 (EC 2.7.1.-... 103 5e-21
gi|1709606|sp|P36582|PCK1_SCHPO Protein kinase C-like 1 103 5e-21
gi|486786|pir||S35362 protein kinase C (EC 2.7.1.-) pck1 - fissi... 103 5e-21
gi|48096660|ref|XP_394743.1| similar to CG10524-PA [Apis mellifera] 103 6e-21
gi|40889426|pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-De... 103 6e-21
gi|46442847|gb|EAL02133.1| hypothetical protein CaO19.829 [Candi... 103 6e-21
gi|48126576|ref|XP_393285.1| similar to putative cAMP-dependent ... 103 6e-21
gi|6016421|sp|O62846|KAPG_MACMU cAMP-dependent protein kinase, g... 103 6e-21
gi|32813439|ref|NP_796236.2| protein kinase N1; serine/threonine... 102 1e-20
gi|1093486|prf||2104208A protein kinase C-related kinase:ISOTYPE... 101 2e-20
gi|7649389|emb|CAB89082.1| S6 ribosomal protein kinase [Asparagu... 101 2e-20
gi|25304069|gb|AAH40061.1| Protein kinase C-like 1, isoform 2 [H... 101 2e-20
gi|6174910|sp|Q16512|PKL1_HUMAN Protein kinase C-like 1 (Protein... 101 2e-20
gi|47132589|ref|NP_002732.3| protein kinase N1 isoform 2; serine... 101 2e-20
gi|1085381|pir||S48705 serine/threonine protein kinase - human >... 101 2e-20
gi|47132591|ref|NP_998725.1| protein kinase N1 isoform 1; serine... 101 2e-20
gi|47212671|emb|CAF94152.1| unnamed protein product [Tetraodon n... 100 3e-20
gi|9716257|emb|CAC01625.1| protein kinase C homologue [Tuber bor... 100 4e-20
gi|6981398|ref|NP_036845.1| protein kinase C, beta; protein kina... 100 4e-20
gi|48097317|ref|XP_391874.1| similar to ENSANGP00000009078 [Apis... 100 4e-20
gi|50550707|ref|XP_502826.1| hypothetical protein [Yarrowia lipo... 100 4e-20
gi|31239753|ref|XP_320290.1| ENSANGP00000009078 [Anopheles gambi... 100 4e-20
gi|66725|pir||KIRBC2 protein kinase C (EC 2.7.1.-) beta-II - rab... 100 5e-20
gi|21166148|gb|AAM43765.1| similar to Dictyostelium discoideum (... 100 5e-20
gi|476509|pir||OKHUCG protein kinase (EC 2.7.1.37), cAMP-depende... 100 5e-20
gi|125539|sp|P05772|KPCB_RABIT Protein kinase C, beta type (PKC-... 100 5e-20
gi|12005625|gb|AAG44542.1| protein kinase C [Blumeria graminis] 100 5e-20
gi|543444|pir||JC2130 protein kinase (EC 2.7.1.37) - rat 100 5e-20
gi|15619015|ref|NP_002723.2| protein kinase, cAMP-dependent, cat... 100 5e-20
gi|25058324|gb|AAH39888.1| Protein kinase, cAMP-dependent, catal... 100 5e-20
gi|15231960|ref|NP_187485.1| serine/threonine protein kinase (PK... 100 7e-20
gi|21537155|gb|AAM61496.1| putative ribosomal-protein S6 kinase ... 100 7e-20
gi|8394047|ref|NP_058871.1| protein kinase C-like 1; protein kin... 100 7e-20
gi|16905491|gb|AAL31374.1| cardiolipin/protease-activated protei... 100 7e-20
gi|47212674|emb|CAF94155.1| unnamed protein product [Tetraodon n... 100 7e-20
gi|27807061|ref|NP_777012.1| protein kinase C, beta 1 polypeptid... 99 9e-20
gi|206189|gb|AAA41875.1| protein kinase C type II 99 9e-20
gi|6679345|ref|NP_032881.1| protein kinase C, beta [Mus musculus... 99 9e-20
gi|46434008|gb|EAK93431.1| hypothetical protein CaO19.223 [Candi... 99 9e-20
gi|28630305|gb|AAM92834.1| protein kinase C [Myxine glutinosa] 99 9e-20
gi|125540|sp|P04410|KPCB_MOUSE Protein kinase C, beta type (PKC-... 99 9e-20
gi|38197376|gb|AAH61836.1| Protein kinase C-like 1 [Rattus norve... 99 9e-20
gi|22023043|emb|CAD30698.1| protein kinase C, alpha type [Takifu... 99 9e-20
gi|28630307|gb|AAM92835.1| protein kinase C [Petromyzon marinus] 99 9e-20
gi|20127450|ref|NP_002729.2| protein kinase C, beta isoform 2; p... 99 1e-19
gi|46433977|gb|EAK93401.1| hypothetical protein CaO19.7854 [Cand... 99 1e-19
gi|303529|dbj|BAA03556.1| TPA-1 [Caenorhabditis elegans] 99 1e-19
gi|47157322|ref|NP_997700.1| protein kinase C, beta isoform 1; p... 99 1e-19
gi|2499576|sp|Q00078|KPC1_ASPNG Protein kinase C-like >gnl|BL_OR... 99 1e-19
gi|17542632|ref|NP_499860.1| tetradecanoyl Phorbol Acetate resis... 99 1e-19
gi|15074866|emb|CAC48007.1| protein kinase C homologue [Tuber ma... 99 1e-19
gi|2822146|gb|AAB97933.1| Protein kinase C beta (5' partial) spl... 99 1e-19
gi|17542634|ref|NP_499861.1| tetradecanoyl Phorbol Acetate resis... 99 1e-19
gi|46107178|ref|XP_380648.1| hypothetical protein FG00472.1 [Gib... 99 1e-19
gi|2073444|emb|CAA73363.1| protein kinase C [Hydra vulgaris] 99 1e-19
gi|2822147|gb|AAB97934.1| Protein kinase C beta (5' partial) spl... 99 1e-19
gi|7511605|pir||T33399 protein kinase C homolog tpa-1, splice fo... 99 1e-19
gi|2073446|emb|CAA73362.1| protein kinase C [Hydra vulgaris] 99 1e-19
gi|50755717|ref|XP_414868.1| PREDICTED: similar to Protein kinas... 99 1e-19
gi|4558499|gb|AAD22633.1| protein kinase C; serine/threonine pro... 99 1e-19
gi|6016442|sp|Q25378|KPC1_LYTPI Protein kinase C >gnl|BL_ORD_ID|... 99 1e-19
gi|125550|sp|P20444|KPCA_MOUSE Protein kinase C, alpha type (PKC... 98 2e-19
gi|6755078|ref|NP_035231.1| protein kinase C, alpha [Mus musculu... 98 2e-19
gi|19115752|ref|NP_594840.1| serine/threonine protein kinase [Sc... 98 2e-19
gi|66724|pir||KIRTC2 protein kinase C (EC 2.7.1.-) beta-II - rat... 98 2e-19
gi|66721|pir||KIRTC1 protein kinase C (EC 2.7.1.-) beta-I - rat ... 98 2e-19
gi|9844082|emb|CAC03748.1| cAMP-dependent protein kinase catalyt... 98 2e-19
gi|50757861|ref|XP_415682.1| PREDICTED: similar to Protein kinas... 98 2e-19
gi|49084020|ref|XP_404243.1| KPC1_ASPNG Protein kinase C-like [A... 98 3e-19
gi|66717|pir||KIMSCA protein kinase C (EC 2.7.1.-) alpha - mouse... 98 3e-19
gi|125551|sp|P10102|KPCA_RABIT Protein kinase C, alpha type (PKC... 98 3e-19
gi|4506067|ref|NP_002728.1| protein kinase C, alpha; protein kin... 98 3e-19
gi|189979|gb|AAA60098.1| protein kinase C alpha-polypeptide 98 3e-19
gi|38109783|gb|EAA55600.1| hypothetical protein MG01251.4 [Magna... 98 3e-19
gi|45185877|ref|NP_983593.1| ACR191Cp [Eremothecium gossypii] >g... 98 3e-19
gi|38524427|dbj|BAD02338.1| protein kinase C [Emericella nidulans] 98 3e-19
gi|44965704|gb|AAS49542.1| protein kinase C alpha [Protopterus d... 98 3e-19
gi|3114989|emb|CAA73554.1| Serine/Threonine protein kinase [Syco... 98 3e-19
gi|34861056|ref|XP_227829.2| similar to cAMP-dependent protein k... 97 3e-19
gi|125552|sp|P05696|KPCA_RAT Protein kinase C, alpha type (PKC-a... 97 3e-19
gi|227491|prf||1704381B protein kinase C II 97 3e-19
gi|104168|pir||B37237 protein kinase C (EC 2.7.1.-) II - African... 97 3e-19
gi|44968943|gb|AAS49598.1| protein kinase C alpha [Scyliorhinus ... 97 3e-19
gi|34874121|ref|XP_343976.1| protein kinase C, alpha [Rattus nor... 97 3e-19
gi|50555624|ref|XP_505220.1| hypothetical protein [Yarrowia lipo... 97 3e-19
gi|303941|dbj|BAA03268.1| protein kinase [Schizosaccharomyces po... 97 3e-19
gi|19112742|ref|NP_595950.1| protein kinase c-like 2 [Schizosacc... 97 3e-19
gi|27806089|ref|NP_776860.1| protein kinase, C alpha [Bos taurus... 97 4e-19
gi|545623|gb|AAB30032.1| cAMP-dependent protein kinase C subunit... 97 4e-19
gi|631936|pir||S41099 protein kinase (EC 2.7.1.37), cAMP-depende... 97 4e-19
gi|46136289|ref|XP_389836.1| hypothetical protein FG09660.1 [Gib... 97 4e-19
gi|28630311|gb|AAM92837.1| protein kinase C [Danio rerio] 97 4e-19
gi|2996092|gb|AAC08427.1| rac serine-threonine kinase homolog [T... 97 4e-19
gi|3114958|emb|CAA73556.1| Serine/Threonine protein kinase [Sube... 97 4e-19
gi|41055807|ref|NP_957272.1| similar to protein kinase C, beta [... 97 4e-19
gi|507141|gb|AAA19440.1| cAMP-dependent protein kinase catalytic... 97 4e-19
gi|44965645|gb|AAS49541.1| protein kinase C alpha [Latimeria cha... 97 6e-19
gi|6102720|emb|CAB59301.1| protein kinase C [Botryotinia fuckeli... 97 6e-19
gi|28629057|gb|AAO49460.1| protein kinase C [Leptosphaeria macul... 97 6e-19
gi|19111951|ref|NP_595159.1| camp-dependent protein kinase catal... 97 6e-19
gi|104167|pir||A37237 protein kinase C (EC 2.7.1.-) I - African ... 97 6e-19
gi|28630309|gb|AAM92836.1| protein kinase C [Scyliorhinus canicula] 97 6e-19
gi|45187484|ref|NP_983707.1| ADL389Wp [Eremothecium gossypii] >g... 97 6e-19
gi|29247070|gb|EAA38644.1| GLP_59_15138_16382 [Giardia lamblia A... 97 6e-19
gi|33304197|gb|AAQ02606.1| protein kinase C, iota [synthetic con... 96 8e-19
gi|50604098|gb|AAH78065.1| Unknown (protein for MGC:82897) [Xeno... 96 8e-19
gi|18314569|gb|AAH22016.1| Protein kinase C, iota [Homo sapiens] 96 8e-19
gi|48255885|ref|NP_002731.3| protein kinase C, iota; atypical pr... 96 8e-19
gi|631750|pir||A53758 protein kinase C (EC 2.7.1.-) lambda - mouse 96 8e-19
gi|6679349|ref|NP_032883.1| protein kinase C, lambda [Mus muscul... 96 8e-19
gi|32411837|ref|XP_326399.1| PROTEIN KINASE C-LIKE [Neurospora c... 96 8e-19
gi|47221653|emb|CAF97918.1| unnamed protein product [Tetraodon n... 96 8e-19
gi|49093828|ref|XP_408375.1| hypothetical protein AN4238.2 [Aspe... 96 8e-19
gi|34856774|ref|XP_342224.1| protein kinase C, lambda [Rattus no... 96 8e-19
gi|6321999|ref|NP_012075.1| protein kinase involved in growth co... 96 1e-18
gi|4426|emb|CAA31073.1| unnamed protein product [Saccharomyces c... 96 1e-18
gi|227604|prf||1707301A protein kinase 96 1e-18
gi|50420447|ref|XP_458760.1| unnamed protein product [Debaryomyc... 96 1e-18
gi|6225593|sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase... 96 1e-18
gi|730723|sp|P11792|SCH9_YEAST Serine/threonine-protein kinase S... 96 1e-18
gi|228058|prf||1716374A protein kinase C I 96 1e-18
gi|50303505|ref|XP_451694.1| unnamed protein product [Kluyveromy... 96 1e-18
gi|46444978|gb|EAL04249.1| hypothetical protein CaO19.13322 [Can... 96 1e-18
gi|55132|emb|CAA36907.1| protein kinase C [Mus musculus] >gnl|BL... 96 1e-18
gi|1170687|sp|P43057|KPC1_CANAL Protein kinase C-like 1 (PKC 1) ... 96 1e-18
gi|20385903|gb|AAM21494.1| protein kinase Sch9 [Cryptococcus neo... 96 1e-18
gi|48094345|ref|XP_394147.1| similar to cyclic AMP-dependent cat... 96 1e-18
gi|4157977|emb|CAA76911.1| protein kinase C [Geodia cydonium] 96 1e-18
gi|47213332|emb|CAF93963.1| unnamed protein product [Tetraodon n... 96 1e-18
gi|6016441|sp|O42632|KPC1_COCHE Protein kinase C-like >gnl|BL_OR... 96 1e-18
gi|4996216|dbj|BAA78372.1| PKC lambda [Rattus norvegicus] 96 1e-18
gi|50287865|ref|XP_446362.1| unnamed protein product [Candida gl... 96 1e-18
gi|50754129|ref|XP_414256.1| PREDICTED: similar to protein kinas... 95 2e-18
gi|28573939|ref|NP_788290.1| CG2049-PB [Drosophila melanogaster]... 95 2e-18
gi|28573943|ref|NP_788292.1| CG2049-PF [Drosophila melanogaster]... 95 2e-18
gi|37575481|gb|AAQ93804.1| ribosomal protein S6 kinase [Zea mays] 95 2e-18
gi|28573947|ref|NP_788294.1| CG2049-PE [Drosophila melanogaster]... 95 2e-18
gi|33589302|gb|AAQ22418.1| RH55776p [Drosophila melanogaster] 95 2e-18
gi|172177|gb|AAA34878.1| protein kinase C-like protein (PKC1) 95 2e-18
gi|28573941|ref|NP_788291.1| CG2049-PC [Drosophila melanogaster]... 95 2e-18
gi|32420385|ref|XP_330636.1| hypothetical protein [Neurospora cr... 95 2e-18
gi|15292295|gb|AAK93416.1| LD45949p [Drosophila melanogaster] 95 2e-18
gi|28573945|ref|NP_788293.1| CG2049-PD [Drosophila melanogaster]... 95 2e-18
gi|15787861|dbj|BAB68538.1| protein kinase C thetaII [Mus musculus] 95 2e-18
gi|15221465|ref|NP_174352.1| protein kinase, putative [Arabidops... 95 2e-18
gi|1362152|pir||S56639 ribosomal protein S6 kinase homolog (clon... 95 2e-18
gi|26332226|dbj|BAC29843.1| unnamed protein product [Mus musculus] 95 2e-18
gi|50752484|ref|XP_422798.1| PREDICTED: similar to Protein kinas... 95 2e-18
gi|25287693|pir||G86431 protein kinase T5I8.9 protein - Arabidop... 95 2e-18
gi|4115530|dbj|BAA36408.1| PKC delta II [Mus musculus] 95 2e-18
gi|6679353|ref|NP_032885.1| protein kinase C, theta [Mus musculu... 95 2e-18
gi|2065190|emb|CAA72926.1| protein kinase C [Hydra vulgaris] 95 2e-18
gi|6755082|ref|NP_035233.1| protein kinase C, delta; protein kin... 94 3e-18
gi|66731|pir||KIMSCD protein kinase C (EC 2.7.1.-) delta - mouse... 94 3e-18
gi|30411018|gb|AAH51416.1| Prkcd protein [Mus musculus] 94 3e-18
gi|44965766|gb|AAS49543.1| protein kinase C beta 1 [Latimeria ch... 94 3e-18
gi|5281346|gb|AAD41488.1| protein kinase C-1 [Sporothrix schenckii] 94 3e-18
gi|32420379|ref|XP_330633.1| hypothetical protein [Neurospora cr... 94 3e-18
gi|6319363|ref|NP_009445.1| Protein Kinase C; Pkc1p [Saccharomyc... 94 3e-18
gi|629915|pir||S47220 protein kinase C (EC 2.7.1.-) PKC1 - yeast... 94 4e-18
gi|38109491|gb|EAA55355.1| hypothetical protein MG07012.4 [Magna... 94 4e-18
gi|50427075|ref|XP_462144.1| unnamed protein product [Debaryomyc... 94 4e-18
gi|25146870|ref|NP_741871.1| protein kinase C (77.6 kD) (pkc-2) ... 94 4e-18
gi|1778590|gb|AAB40868.1| protein kinase C2 A isoform [Caenorhab... 94 4e-18
gi|32566197|ref|NP_741872.2| protein kinase C (78.0 kD) (pkc-2) ... 94 4e-18
gi|1778592|gb|AAB40869.1| protein kinase C2 B isoform [Caenorhab... 94 4e-18
gi|7511603|pir||T15903 protein kinase C homolog - Caenorhabditis... 94 4e-18
gi|47218993|emb|CAG02031.1| unnamed protein product [Tetraodon n... 94 4e-18
gi|28630303|gb|AAM92833.1| protein kinase C [Branchiostoma lance... 94 4e-18
gi|21392563|gb|AAA68709.2| Protein kinase c protein 2, isoform c... 94 4e-18
gi|2499577|sp|Q99014|KPC1_TRIRE Protein kinase C-like >gnl|BL_OR... 94 4e-18
gi|6016443|sp|P87253|KPC1_NEUCR Protein kinase C-like >gnl|BL_OR... 94 4e-18
gi|2707262|gb|AAB92244.1| protein kinase C-related kinase [Pisas... 94 5e-18
gi|24654282|ref|NP_725626.1| CG6622-PB [Drosophila melanogaster]... 94 5e-18
gi|103330|pir||A32545 protein kinase C (EC 2.7.1.-) - fruit fly ... 94 5e-18
gi|4938231|emb|CAA28890.2| protein kinase C [Drosophila melanoga... 94 5e-18
gi|17136402|ref|NP_476682.1| CG6622-PA [Drosophila melanogaster]... 94 5e-18
gi|11968080|ref|NP_071952.1| protein kinase C, zeta; 14 - 3 - 3 ... 93 6e-18
gi|478322|pir||JN0877 protein kinase C (EC 2.7.1.-) zeta - human... 93 6e-18
gi|17136716|ref|NP_476863.1| CG6518-PA [Drosophila melanogaster]... 93 6e-18
gi|6679355|ref|NP_032886.1| protein kinase C, zeta [Mus musculus... 93 6e-18
gi|39587559|emb|CAE58497.1| Hypothetical protein CBG01645 [Caeno... 93 6e-18
gi|31158356|dbj|BAC76975.1| protein kinase C-zeta 2 [Mus musculus] 93 6e-18
gi|50294680|ref|XP_449751.1| unnamed protein product [Candida gl... 93 6e-18
gi|46445417|gb|EAL04686.1| hypothetical protein CaO19.12357 [Can... 93 6e-18
gi|18859259|ref|NP_571930.1| protein kinase C, iota [Danio rerio... 93 6e-18
gi|206195|gb|AAA41878.1| protein kinase C zeta subspecies 93 6e-18
gi|50755759|ref|XP_414888.1| PREDICTED: similar to 3-phosphoinos... 93 6e-18
gi|30172014|gb|AAP20604.1| protein kinase C [Pichia pastoris] 93 6e-18
gi|38104629|gb|EAA51167.1| hypothetical protein MG08689.4 [Magna... 93 6e-18
gi|4928705|gb|AAD33693.1| protein kinase C [Magnaporthe grisea] 93 6e-18
gi|28502762|gb|AAH47164.1| Prkci protein [Danio rerio] 93 6e-18
gi|49899150|gb|AAH75736.1| Prkci protein [Danio rerio] 93 6e-18
gi|21356509|ref|NP_648432.1| CG6297-PB [Drosophila melanogaster]... 93 8e-18
gi|3114956|emb|CAA73553.1| Serine/Threonine protein kinase [Sube... 93 8e-18
gi|22087742|gb|AAM91026.1| protein kinase C-related kinase [Hydr... 93 8e-18
gi|17980212|gb|AAL50556.1| serine-threonine protein kinase PK2 [... 93 8e-18
gi|47219649|emb|CAG02694.1| unnamed protein product [Tetraodon n... 93 8e-18
gi|39596192|emb|CAE69829.1| Hypothetical protein CBG16150 [Caeno... 93 8e-18
gi|38086255|ref|XP_124895.2| similar to protein kinase C zeta [M... 92 1e-17
gi|50759195|ref|XP_417561.1| PREDICTED: similar to protein kinas... 92 1e-17
gi|50415318|gb|AAH78019.1| PKC-delta1 protein [Xenopus laevis] 92 1e-17
gi|32480479|dbj|BAC79119.1| protein kinase-delta1 [Xenopus laevis] 92 1e-17
gi|47550719|ref|NP_999873.1| protein kinase C, delta; wu:fv43b11... 92 1e-17
gi|32480481|dbj|BAC79120.1| protein kinase-delta2 [Xenopus laevis] 92 1e-17
gi|14165515|gb|AAH08058.1| Protein kinase C, zeta [Homo sapiens]... 92 2e-17
gi|10864650|ref|NP_002735.2| protein kinase C, zeta [Homo sapien... 92 2e-17
gi|50308473|ref|XP_454238.1| unnamed protein product [Kluyveromy... 92 2e-17
gi|35501|emb|CAA78813.1| protein kinase C zeta [Homo sapiens] 92 2e-17
gi|10334453|emb|CAC10200.1| bA563J2.2 (protein kinase C theta ) ... 92 2e-17
gi|3393042|emb|CAA06507.1| eye-specific protein kinase C [Callip... 92 2e-17
gi|30585051|gb|AAP36798.1| Homo sapiens protein kinase C, zeta [... 92 2e-17
gi|7019312|emb|CAB75578.1| protein kinase C delta [Rattus norveg... 92 2e-17
gi|18959250|ref|NP_579841.1| protein kinase C, delta [Rattus nor... 92 2e-17
gi|558099|gb|AAA75571.1| protein kinase C-theta 92 2e-17
gi|5453976|ref|NP_006248.1| protein kinase C, theta [Homo sapien... 92 2e-17
gi|2911458|gb|AAC04355.1| cAMP-dependent protein kinase catalyti... 91 2e-17
gi|28839796|gb|AAH47896.1| RPS6KA4 protein [Homo sapiens] 91 2e-17
gi|4506735|ref|NP_003933.1| ribosomal protein S6 kinase, 90kDa, ... 91 2e-17
gi|50415747|ref|XP_457493.1| unnamed protein product [Debaryomyc... 91 2e-17
gi|18399030|ref|NP_565453.1| protein kinase, putative [Arabidops... 91 2e-17
gi|41053359|ref|NP_957323.1| similar to Protein C kinase 53E [Da... 91 2e-17
gi|46125747|ref|XP_387427.1| hypothetical protein FG07251.1 [Gib... 91 2e-17
gi|38707442|dbj|BAD04044.1| catalytic subunit of cAMP-dependent ... 91 2e-17
gi|50260171|gb|EAL22832.1| hypothetical protein CNBB0530 [Crypto... 91 2e-17
gi|7446410|pir||T01288 protein kinase F27F23.20 (EC 2.7.1.-) - A... 91 2e-17
gi|7522131|pir||T28666 protein kinase C-related kinase PRKSD - S... 91 3e-17
gi|50306871|ref|XP_453411.1| YL44_KLULA [Kluyveromyces lactis] >... 91 4e-17
gi|35497|emb|CAA78820.1| protein kinase C gamma [Homo sapiens] 91 4e-17
gi|125558|sp|P05128|KPCG_BOVIN Protein kinase C, gamma type (PKC... 91 4e-17
gi|125560|sp|P10829|KPCG_RABIT Protein kinase C, gamma type (PKC... 91 4e-17
gi|6755080|ref|NP_035232.1| protein kinase C, gamma [Mus musculu... 91 4e-17
gi|13384594|ref|NP_002730.1| protein kinase C, gamma; Protein ki... 91 4e-17
gi|1362234|pir||S55694 protein kinase (EC 2.7.1.37) sck1, cAMP-d... 90 5e-17
gi|19114666|ref|NP_593754.1| cAMP-dependent protein kinase, sck1... 90 5e-17
gi|31088226|dbj|BAC76895.1| protein kinase [Raphanus sativus] 90 5e-17
gi|31088228|dbj|BAC76896.1| protein kinase [Raphanus sativus] 90 5e-17
gi|125208|sp|P06244|KAPA_YEAST cAMP-dependent protein kinase typ... 90 5e-17
gi|2144416|pir||OKBYC1 protein kinase (EC 2.7.1.37), cAMP-depend... 90 5e-17
gi|17567857|ref|NP_508671.1| protein kinase and Protein kinase C... 90 7e-17
gi|13877631|gb|AAK43893.1| putative protein kinase [Arabidopsis ... 90 7e-17
gi|31224299|ref|XP_317423.1| ENSANGP00000011546 [Anopheles gambi... 90 7e-17
gi|31198671|ref|XP_308283.1| ENSANGP00000010728 [Anopheles gambi... 89 9e-17
gi|2586064|gb|AAC13357.1| protein kinase C-related kinase 2 [Xen... 89 9e-17
gi|21429726|gb|AAM50541.1| AT10577p [Drosophila melanogaster] 89 9e-17
gi|125318|sp|P16912|KDC2_DROME Protein kinase DC2 >gnl|BL_ORD_ID... 89 9e-17
gi|15022412|emb|CAC44729.1| possible rac-family serine/threonine... 89 9e-17
gi|42567339|ref|NP_195034.2| protein kinase, putative [Arabidops... 89 9e-17
gi|45188041|ref|NP_984264.1| ADR167Wp [Eremothecium gossypii] >g... 89 9e-17
gi|50751352|ref|XP_422357.1| PREDICTED: similar to protein kinas... 89 9e-17
gi|7446438|pir||T05188 protein kinase F4I10.10 (EC 2.7.1.-) - Ar... 89 9e-17
gi|31198669|ref|XP_308282.1| ENSANGP00000022695 [Anopheles gambi... 89 9e-17
>gi|25146791|ref|NP_510357.2| AKT kinase (55.8 kD) (akt-2)
[Caenorhabditis elegans]
gi|11260035|pir||T43234 protein kinase (EC 2.7.1.37) akt-2 short
splice form [similarity] - Caenorhabditis elegans
gi|3694833|gb|AAC62468.1| Akt/PKB serine/threonine kinase
[Caenorhabditis elegans]
gi|15718187|emb|CAC70087.1| Hypothetical protein F28H6.1b
[Caenorhabditis elegans]
gi|18376543|emb|CAD21654.1| C. elegans AKT-2 protein (corresponding
sequence F28H6.1b) [Caenorhabditis elegans]
Length = 483
Score = 585 bits (1507), Expect = e-166
Identities = 284/284 (100%), Positives = 284/284 (100%)
Frame = +1
Query: 1 MSTENAHLQKEDIVIESWLHKKGEHIRNWRPRYFILFRDGTLLGFRSKPKEDQPLPEPLN 180
MSTENAHLQKEDIVIESWLHKKGEHIRNWRPRYFILFRDGTLLGFRSKPKEDQPLPEPLN
Sbjct: 1 MSTENAHLQKEDIVIESWLHKKGEHIRNWRPRYFILFRDGTLLGFRSKPKEDQPLPEPLN 60
Query: 181 NFMIRDAATVCLDKPRPNMFIVRCLQWTTVIERTFYADSADFRQMWIEAIQAVSSHNRLK 360
NFMIRDAATVCLDKPRPNMFIVRCLQWTTVIERTFYADSADFRQMWIEAIQAVSSHNRLK
Sbjct: 61 NFMIRDAATVCLDKPRPNMFIVRCLQWTTVIERTFYADSADFRQMWIEAIQAVSSHNRLK 120
Query: 361 ENAGNTSMQEEDTNGNPSGESDVNMDATSTRSDNDFESTVMNIDEPEEVPRKNTVTMDDF 540
ENAGNTSMQEEDTNGNPSGESDVNMDATSTRSDNDFESTVMNIDEPEEVPRKNTVTMDDF
Sbjct: 121 ENAGNTSMQEEDTNGNPSGESDVNMDATSTRSDNDFESTVMNIDEPEEVPRKNTVTMDDF 180
Query: 541 DFLKVLGQGTFGKVILCREKSSDKLYAIKIIRKEMVVDRSEVAHTLTENRVLYACVHPFL 720
DFLKVLGQGTFGKVILCREKSSDKLYAIKIIRKEMVVDRSEVAHTLTENRVLYACVHPFL
Sbjct: 181 DFLKVLGQGTFGKVILCREKSSDKLYAIKIIRKEMVVDRSEVAHTLTENRVLYACVHPFL 240
Query: 721 TLLKYSFQAQYHICFVMEFANGGELFTHLQRCKTFSEARTRFYG 852
TLLKYSFQAQYHICFVMEFANGGELFTHLQRCKTFSEARTRFYG
Sbjct: 241 TLLKYSFQAQYHICFVMEFANGGELFTHLQRCKTFSEARTRFYG 284
>gi|7500109|pir||T21523 protein kinase (EC 2.7.1.37) akt-2 long
splice form [similarity] - Caenorhabditis elegans
gi|3876529|emb|CAA20936.1| Hypothetical protein F28H6.1a
[Caenorhabditis elegans]
gi|3878871|emb|CAB07403.1| C. elegans AKT-2 protein (corresponding
sequence F28H6.1a) [Caenorhabditis elegans]
Length = 528
Score = 585 bits (1507), Expect = e-166
Identities = 284/284 (100%), Positives = 284/284 (100%)
Frame = +1
Query: 1 MSTENAHLQKEDIVIESWLHKKGEHIRNWRPRYFILFRDGTLLGFRSKPKEDQPLPEPLN 180
MSTENAHLQKEDIVIESWLHKKGEHIRNWRPRYFILFRDGTLLGFRSKPKEDQPLPEPLN
Sbjct: 1 MSTENAHLQKEDIVIESWLHKKGEHIRNWRPRYFILFRDGTLLGFRSKPKEDQPLPEPLN 60
Query: 181 NFMIRDAATVCLDKPRPNMFIVRCLQWTTVIERTFYADSADFRQMWIEAIQAVSSHNRLK 360
NFMIRDAATVCLDKPRPNMFIVRCLQWTTVIERTFYADSADFRQMWIEAIQAVSSHNRLK
Sbjct: 61 NFMIRDAATVCLDKPRPNMFIVRCLQWTTVIERTFYADSADFRQMWIEAIQAVSSHNRLK 120
Query: 361 ENAGNTSMQEEDTNGNPSGESDVNMDATSTRSDNDFESTVMNIDEPEEVPRKNTVTMDDF 540
ENAGNTSMQEEDTNGNPSGESDVNMDATSTRSDNDFESTVMNIDEPEEVPRKNTVTMDDF
Sbjct: 121 ENAGNTSMQEEDTNGNPSGESDVNMDATSTRSDNDFESTVMNIDEPEEVPRKNTVTMDDF 180
Query: 541 DFLKVLGQGTFGKVILCREKSSDKLYAIKIIRKEMVVDRSEVAHTLTENRVLYACVHPFL 720
DFLKVLGQGTFGKVILCREKSSDKLYAIKIIRKEMVVDRSEVAHTLTENRVLYACVHPFL
Sbjct: 181 DFLKVLGQGTFGKVILCREKSSDKLYAIKIIRKEMVVDRSEVAHTLTENRVLYACVHPFL 240
Query: 721 TLLKYSFQAQYHICFVMEFANGGELFTHLQRCKTFSEARTRFYG 852
TLLKYSFQAQYHICFVMEFANGGELFTHLQRCKTFSEARTRFYG
Sbjct: 241 TLLKYSFQAQYHICFVMEFANGGELFTHLQRCKTFSEARTRFYG 284