Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F25H2_10
(747 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508493|ref|NP_492765.1| proteasome Alpha Subunit (27.2 kD) ... 478 e-134
gi|39580819|emb|CAE58988.1| Hypothetical protein CBG02261 [Caeno... 467 e-130
gi|88168|pir||S17521 C 3.4.25.1 proteasome endopeptidase complex... 307 2e-82
gi|7106387|ref|NP_036097.1| proteasome (prosome, macropain) subu... 307 2e-82
gi|47227266|emb|CAF96815.1| unnamed protein product [Tetraodon n... 305 7e-82
gi|21465646|pdb|1IRU|E Chain E, Crystal Structure Of The Mammali... 305 9e-82
gi|45387823|ref|NP_991271.1| proteasome subunit, alpha type, 5 [... 304 1e-81
gi|8394072|ref|NP_058978.1| proteasome (prosome, macropain) subu... 302 6e-81
gi|49118346|gb|AAH73346.1| Unknown (protein for MGC:80760) [Xeno... 298 8e-80
gi|50807165|ref|XP_424548.1| PREDICTED: similar to zeta proteaso... 293 3e-78
gi|27525440|emb|CAD47833.1| 20S proteasome alpha 5 subunit [Cera... 291 1e-77
gi|29841012|gb|AAP06025.1| similar to NM_011967 proteasome (pros... 290 2e-77
gi|31211921|ref|XP_314945.1| ENSANGP00000019329 [Anopheles gambi... 282 5e-75
gi|41352543|gb|AAS01024.1| proteasome alpha subunit [Ornithodoro... 279 4e-74
gi|49080054|ref|XP_403601.1| hypothetical protein UM05986.1 [Ust... 276 3e-73
gi|1498589|gb|AAB93421.1| 20S proteasome alpha subunit PSMA5 [Dr... 276 3e-73
gi|24654389|ref|NP_725669.1| CG10938-PA [Drosophila melanogaster... 276 4e-73
gi|12229920|sp|Q9LSU1|PSA5_ORYSA Proteasome subunit alpha type 5... 266 3e-70
gi|12229923|sp|Q9M4T8|PSA5_SOYBN Proteasome subunit alpha type 5... 265 1e-69
gi|15231824|ref|NP_188046.1| 20S proteasome alpha subunit E2 (PA... 260 2e-68
gi|15220961|ref|NP_175788.1| 20S proteasome alpha subunit E1 (PA... 259 3e-68
gi|16943777|emb|CAD10778.1| 20S proteasome subunit alpha V [Phys... 257 2e-67
gi|49097098|ref|XP_410009.1| conserved hypothetical protein [Asp... 254 2e-66
gi|32408341|ref|XP_324652.1| hypothetical protein [Neurospora cr... 252 7e-66
gi|38111157|gb|EAA56775.1| hypothetical protein MG07130.4 [Magna... 248 7e-65
gi|50255130|gb|EAL17869.1| hypothetical protein CNBL1310 [Crypto... 246 3e-64
gi|46433106|gb|EAK92560.1| hypothetical protein CaO19.709 [Candi... 245 6e-64
gi|19115284|ref|NP_594372.1| proteasome component PUP2 homolog [... 244 1e-63
gi|12229916|sp|Q94561|PSA5_ENTHI Proteasome subunit alpha type 5... 244 2e-63
gi|50289853|ref|XP_447358.1| unnamed protein product [Candida gl... 241 2e-62
gi|50427903|ref|XP_462564.1| unnamed protein product [Debaryomyc... 241 2e-62
gi|50551999|ref|XP_503474.1| hypothetical protein [Yarrowia lipo... 240 3e-62
gi|38048537|gb|AAR10171.1| similar to Drosophila melanogaster Pr... 239 3e-62
gi|50302577|ref|XP_451224.1| unnamed protein product [Kluyveromy... 239 4e-62
gi|45190899|ref|NP_985153.1| AER296Wp [Eremothecium gossypii] >g... 236 4e-61
gi|46123563|ref|XP_386335.1| conserved hypothetical protein [Gib... 236 4e-61
gi|6321692|ref|NP_011769.1| Proteasome subunit; Pup2p [Saccharom... 235 6e-61
gi|7530130|emb|CAB86711.1| 20S proteasome alpha 5 subunit [Leish... 235 8e-61
gi|1041976|gb|AAB34631.1| Doa5, PUP2=alpha-type proteasome subun... 234 1e-60
gi|312258|emb|CAA46111.1| PUP2 [Saccharomyces cerevisiae] 234 2e-60
gi|11513995|pdb|1G0U|D Chain D, A Gated Channel Into The Proteas... 229 3e-59
gi|23489205|gb|EAA21516.1| proteasome subunit alpha type 5 [Plas... 226 3e-58
gi|18152451|emb|CAC82813.1| proteasome subunit alpha5 [Trypanoso... 225 9e-58
gi|23612640|ref|NP_704201.1| proteasome subunit alpha type 5, pu... 224 1e-57
gi|12229950|sp|Q9XZG5|PSA5_TRYBB Proteasome subunit alpha type 5... 223 3e-57
gi|3114273|pdb|1RYP|E Chain E, Crystal Structure Of The 20s Prot... 219 4e-56
gi|20093823|ref|NP_613670.1| Protease subunit of the proteasome ... 186 6e-46
gi|15678713|ref|NP_275829.1| proteasome, alpha subunit [Methanot... 183 4e-45
gi|15668771|ref|NP_247571.1| proteasome, subunit alpha (psmA) [M... 177 3e-43
gi|45357814|ref|NP_987371.1| proteasome, subunit alpha [Methanoc... 177 3e-43
gi|11498101|ref|NP_069326.1| proteasome, subunit alpha (psmA) [A... 175 8e-43
gi|12229946|sp|Q9V2V6|PSM1_HALVO Proteasome alpha-1 subunit (Mul... 175 1e-42
gi|29726314|pdb|1J2P|A Chain A, Alpha-Ring From The Proteasome F... 171 1e-41
gi|29726321|pdb|1J2Q|A Chain A, 20s Proteasome In Complex With C... 168 1e-40
gi|14591336|ref|NP_143414.1| proteasome, alpha subunit [Pyrococc... 167 3e-40
gi|46142155|ref|ZP_00147872.2| COG0638: 20S proteasome, alpha an... 167 3e-40
gi|14324522|dbj|BAB59449.1| proteasome alpha subunit [Thermoplas... 167 3e-40
gi|13541135|ref|NP_110823.1| Proteasome protease subunit alpha [... 167 3e-40
gi|18977943|ref|NP_579300.1| proteasome, subunit alpha (multicat... 166 4e-40
gi|21228722|ref|NP_634644.1| Proteasome, subunit-alpha [Methanos... 165 1e-39
gi|20090630|ref|NP_616705.1| multicatalytic endopeptidase comple... 165 1e-39
gi|48852939|ref|ZP_00307121.1| COG0638: 20S proteasome, alpha an... 165 1e-39
gi|14520823|ref|NP_126298.1| proteasome, subunit alpha [Pyrococc... 164 1e-39
gi|6093782|sp|Q59565|PSMA_METTE Proteasome alpha subunit (Multic... 164 2e-39
gi|16082284|ref|NP_394744.1| proteasome alpha subunit [Thermopla... 162 5e-39
gi|48837583|ref|ZP_00294556.1| COG0638: 20S proteasome, alpha an... 162 9e-39
gi|18313186|ref|NP_559853.1| proteasome alpha subunit [Pyrobacul... 161 1e-38
gi|15789479|ref|NP_279303.1| proteasome, subunit beta; PsmB [Hal... 161 2e-38
gi|19075820|ref|NP_588320.1| 20s proteasome component C3 [Schizo... 159 4e-38
gi|48477876|ref|YP_023582.1| proteasome alpha subunit [Picrophil... 159 6e-38
gi|12229894|sp|O24733|PSMA_THEK1 Proteasome alpha subunit (Multi... 159 8e-38
gi|14601414|ref|NP_147951.1| proteasome , alpha subunit [Aeropyr... 158 1e-37
gi|29248522|gb|EAA40054.1| GLP_387_56144_56881 [Giardia lamblia ... 156 4e-37
gi|19173680|ref|NP_597483.1| 26S PROTEASOME ZETA CHAIN [Encephal... 156 4e-37
gi|46254536|gb|AAS86241.1| testes-specific alpha4-t1 proteasome ... 151 1e-35
gi|46254538|gb|AAS86242.1| testes-specific alpha4-t1 proteasome ... 151 1e-35
gi|17508491|ref|NP_492360.1| proteasome Alpha Subunit (28.2 kD) ... 150 2e-35
gi|38083795|ref|XP_357002.1| RIKEN cDNA 2410072D24 [Mus musculus... 150 2e-35
gi|464459|sp|P34120|PSA7_DICDI Proteasome subunit alpha type 7 (... 150 3e-35
gi|27503801|gb|AAH42820.1| MGC26605 protein [Homo sapiens] 150 3e-35
gi|11513994|pdb|1G0U|C Chain C, A Gated Channel Into The Proteas... 150 4e-35
gi|6324535|ref|NP_014604.1| 20S proteasome alpha-type subunit; P... 150 4e-35
gi|47228214|emb|CAG07609.1| unnamed protein product [Tetraodon n... 149 5e-35
gi|46254562|gb|AAS86254.1| testes-specific alpha4-t1 proteasome ... 149 5e-35
gi|46254570|gb|AAS86258.1| testes-specific alpha4-t1 proteasome ... 149 5e-35
gi|46254566|gb|AAS86256.1| testes-specific alpha4-t1 proteasome ... 149 5e-35
gi|3114272|pdb|1RYP|D Chain D, Crystal Structure Of The 20s Prot... 149 6e-35
gi|15897639|ref|NP_342244.1| Proteasome subunit [Sulfolobus solf... 149 6e-35
gi|12229939|sp|Q9U793|PSA2_TRYBB Proteasome subunit alpha type 2... 149 6e-35
gi|28828056|gb|AAO50739.1| similar to Dictyostelium discoideum (... 149 6e-35
gi|46254564|gb|AAS86255.1| testes-specific alpha4-t1 proteasome ... 149 6e-35
gi|39589722|emb|CAE66957.1| Hypothetical protein CBG12349 [Caeno... 148 1e-34
gi|47085943|ref|NP_998331.1| zgc:77139 [Danio rerio] >gnl|BL_ORD... 148 1e-34
gi|12229904|sp|O82530|PSA4_PETHY Proteasome subunit alpha type 4... 148 1e-34
gi|12229928|sp|Q9PTW9|PSA7_CARAU Proteasome subunit alpha type 7... 147 2e-34
gi|23394356|gb|AAN31468.1| proteasome subunit [Phytophthora infe... 147 2e-34
gi|6984140|gb|AAF34770.1| proteasome 27 kDa subunit [Euphorbia e... 147 3e-34
gi|1709761|sp|P52427|PSA4_SPIOL Proteasome subunit alpha type 4 ... 147 3e-34
gi|34898416|ref|NP_910554.1| ESTs AU058081(E30812),AU058365(E506... 146 4e-34
gi|7435885|pir||T04300 probable C 3.4.25.1 proteasome endopeptid... 145 7e-34
gi|21356137|ref|NP_650910.1| CG17268-PA [Drosophila melanogaster... 145 7e-34
gi|12054744|emb|CAC20614.1| promastigote alpha-2 subunit [Leishm... 145 7e-34
gi|34898458|ref|NP_910575.1| ESTs AU058081(E3082),AU075427(E3038... 145 7e-34
gi|15233268|ref|NP_188850.1| 20S proteasome alpha subunit C (PAC... 145 7e-34
gi|50726607|dbj|BAD34241.1| Proteasome subunit alpha type 7 [Ory... 145 9e-34
gi|49079186|ref|XP_403267.1| hypothetical protein UM05652.1 [Ust... 145 1e-33
gi|18447104|gb|AAL68143.1| AT30052p [Drosophila melanogaster] 144 1e-33
gi|12229945|sp|Q9V2V5|PSM2_HALVO Proteasome alpha-2 subunit (Mul... 144 1e-33
gi|30580480|sp|Q8X077|PSA2_NEUCR Probable proteasome subunit alp... 144 1e-33
gi|46254558|gb|AAS86252.1| testes-specific alpha4-t1 proteasome ... 144 1e-33
gi|2511584|emb|CAA73624.1| multicatalytic endopeptidase [Arabido... 144 2e-33
gi|26006840|sp|Q8TAA3|PS7L_HUMAN Proteasome subunit alpha type 7... 144 3e-33
gi|46254510|gb|AAS86228.1| testes-specific alpha4-t2 proteasome ... 144 3e-33
gi|12229929|sp|Q9PVQ1|PS72_XENLA Proteasome subunit alpha type 7... 144 3e-33
gi|45360795|ref|NP_989071.1| hypothetical protein MGC75728 [Xeno... 144 3e-33
gi|6562661|emb|CAB62817.1| 20S proteasome alpha 2 subunit [Leish... 144 3e-33
gi|21389549|ref|NP_653263.1| hypothetical protein MGC26605 [Homo... 144 3e-33
gi|15230435|ref|NP_190694.1| 20S proteasome alpha subunit D (PAD... 143 3e-33
gi|7435880|pir||S72226 C 3.4.25.1 proteasome endopeptidase compl... 143 4e-33
gi|46254534|gb|AAS86240.1| testes-specific alpha4-t2 proteasome ... 142 6e-33
gi|46254528|gb|AAS86237.1| testes-specific alpha4-t2 proteasome ... 142 6e-33
gi|4092058|gb|AAC99402.1| proteasome subunit HSPC [Homo sapiens] 142 6e-33
gi|50304213|ref|XP_452056.1| unnamed protein product [Kluyveromy... 142 6e-33
gi|21593040|gb|AAM64989.1| multicatalytic endopeptidase complex ... 142 7e-33
gi|49387541|dbj|BAD25097.1| alpha 2 subunit of 20S proteasome [O... 142 1e-32
gi|19922898|ref|NP_611920.1| CG4569-PA [Drosophila melanogaster]... 142 1e-32
gi|46226753|gb|EAK87732.1| proteasome subunit alpha type 4, NTN ... 142 1e-32
gi|12229921|sp|Q9LSU2|PSA2_ORYSA Proteasome subunit alpha type 2... 141 1e-32
gi|30583771|gb|AAP36134.1| Homo sapiens proteasome (prosome, mac... 141 1e-32
gi|45382931|ref|NP_989944.1| proteasome 28 kDa subunit homolog [... 141 1e-32
gi|4506189|ref|NP_002783.1| proteasome alpha 7 subunit isoform 1... 141 1e-32
gi|7106389|ref|NP_036099.1| proteasome (prosome, macropain) subu... 141 1e-32
gi|6093780|sp|O73672|PSA2_CARAU Proteasome subunit alpha type 2 ... 141 1e-32
gi|2511580|emb|CAA73622.1| multicatalytic endopeptidase [Arabido... 141 2e-32
gi|50308239|ref|XP_454120.1| unnamed protein product [Kluyveromy... 141 2e-32
gi|46254462|gb|AAS86204.1| alpha4 proteasome subunit [Drosophila... 141 2e-32
gi|34860906|ref|XP_342599.1| proteasome (prosome, macropain) sub... 141 2e-32
gi|15239271|ref|NP_201415.1| 20S proteasome alpha subunit D2 (PA... 141 2e-32
gi|23612167|ref|NP_703747.1| proteasome subunit alpha type 2, pu... 140 2e-32
gi|46254502|gb|AAS86224.1| testes-specific alpha4-t2 proteasome ... 140 2e-32
gi|12229936|sp|Q9SXU1|PSA7_CICAR Proteasome subunit alpha type 7... 140 2e-32
gi|3334299|sp|O24030|PSA7_LYCES Proteasome subunit alpha type 7 ... 140 2e-32
gi|48142173|ref|XP_393583.1| similar to ENSANGP00000007022 [Apis... 140 3e-32
gi|15920658|ref|NP_376327.1| 235aa long hypothetical proteasome ... 140 4e-32
gi|50290521|ref|XP_447692.1| unnamed protein product [Candida gl... 140 4e-32
gi|19528159|gb|AAL90194.1| AT26889p [Drosophila melanogaster] 140 4e-32
gi|46254496|gb|AAS86221.1| alpha4 proteasome subunit [Drosophila... 140 4e-32
gi|21362819|sp|Q975G5|PSMA_SULTO Proteasome alpha subunit (Multi... 140 4e-32
gi|23490901|gb|EAA22562.1| proteasome subunit alpha type 2 [Plas... 139 5e-32
gi|15219257|ref|NP_173096.1| 20S proteasome alpha subunit B (PAB... 139 5e-32
gi|7435879|pir||S72225 C 3.4.25.1 proteasome endopeptidase compl... 139 5e-32
gi|12644044|sp|O04861|PSA7_ORYSA Proteasome subunit alpha type 7... 139 5e-32
gi|45198836|ref|NP_985865.1| AFR318Wp [Eremothecium gossypii] >g... 139 5e-32
gi|37747972|gb|AAH59539.1| Psma2 protein [Danio rerio] 139 5e-32
gi|85119|pir||JQ0681 proteasome chain 1 - fruit fly (Drosophila ... 139 6e-32
gi|17933602|ref|NP_525092.1| CG3422-PA [Drosophila melanogaster]... 138 1e-31
gi|46229819|gb|EAK90637.1| proteasome subunit alpha2, protease o... 138 1e-31
gi|50555329|ref|XP_505073.1| hypothetical protein [Yarrowia lipo... 138 1e-31
gi|15219317|ref|NP_178042.1| 20S proteasome alpha subunit B, put... 138 1e-31
gi|46227998|gb|EAK88918.1| putative proteasome regulatory subuni... 138 1e-31
gi|31241267|ref|XP_321064.1| ENSANGP00000011336 [Anopheles gambi... 138 1e-31
gi|19168518|emb|CAC94781.1| PROSAg25 protein [Anopheles gambiae] 137 2e-31
gi|50258402|gb|EAL21091.1| hypothetical protein CNBD4670 [Crypto... 137 2e-31
gi|3114271|pdb|1RYP|C Chain C, Crystal Structure Of The 20s Prot... 137 2e-31
gi|11513993|pdb|1G0U|B Chain B, A Gated Channel Into The Proteas... 137 2e-31
gi|6321574|ref|NP_011651.1| 20S proteasome beta-type subunit; th... 137 2e-31
gi|38111874|gb|EAA57374.1| hypothetical protein MG08343.4 [Magna... 137 2e-31
gi|19111957|ref|NP_595165.1| proteasome component; PROS28 family... 137 3e-31
gi|45184835|ref|NP_982553.1| AAR012Cp [Eremothecium gossypii] >g... 137 3e-31
gi|1709758|sp|P52428|PSA1_ORYSA Proteasome subunit alpha type 1 ... 136 4e-31
gi|49070744|ref|XP_399661.1| hypothetical protein UM02046.1 [Ust... 136 4e-31
gi|46438138|gb|EAK97474.1| hypothetical protein CaO19.7335 [Cand... 136 4e-31
gi|31212975|ref|XP_315431.1| ENSANGP00000007022 [Anopheles gambi... 136 4e-31
gi|23489885|gb|EAA21790.1| proteasome subunit alpha type 4 [Plas... 136 5e-31
gi|50546813|ref|XP_500876.1| hypothetical protein [Yarrowia lipo... 136 5e-31
gi|464458|sp|P34119|PSA4_DICDI Proteasome subunit alpha type 4 (... 136 5e-31
gi|46441895|gb|EAL01189.1| hypothetical protein CaO19.350 [Candi... 136 5e-31
gi|130852|sp|P24495|PSA2_XENLA Proteasome subunit alpha type 2 (... 136 5e-31
gi|50416403|ref|XP_457549.1| unnamed protein product [Debaryomyc... 135 7e-31
gi|50289341|ref|XP_447101.1| unnamed protein product [Candida gl... 135 7e-31
gi|46121975|ref|XP_385541.1| conserved hypothetical protein [Gib... 135 7e-31
gi|32410633|ref|XP_325797.1| hypothetical protein [Neurospora cr... 135 7e-31
gi|3114275|pdb|1RYP|G Chain G, Crystal Structure Of The 20s Prot... 135 9e-31
gi|12229948|sp|Q9XG77|PSA6_TOBAC Proteasome subunit alpha type 6... 135 9e-31
gi|11513997|pdb|1G0U|F Chain F, A Gated Channel Into The Proteas... 135 9e-31
gi|6324938|ref|NP_015007.1| 20S proteasome alpha-type subunit; P... 135 9e-31
gi|14488811|pdb|1FNT|G Chain G, Crystal Structure Of The 20s Pro... 135 9e-31
gi|45187518|ref|NP_983741.1| ADL354Wp [Eremothecium gossypii] >g... 135 9e-31
gi|49088052|ref|XP_405894.1| conserved hypothetical protein [Asp... 135 1e-30
gi|22947842|gb|AAN07899.1| 20S proteasome alpha 6 subunit [Nicot... 135 1e-30
gi|1346784|sp|P48004|PSA7_RAT Proteasome subunit alpha type 7 (P... 134 2e-30
gi|50260142|gb|EAL22803.1| hypothetical protein CNBB0240 [Crypto... 134 2e-30
gi|3914440|sp|Q27563|PSA3_DICDI Proteasome subunit alpha type 3 ... 134 3e-30
gi|41615303|ref|NP_963801.1| NEQ521 [Nanoarchaeum equitans Kin4-... 134 3e-30
gi|50307089|ref|XP_453523.1| unnamed protein product [Kluyveromy... 134 3e-30
gi|50289259|ref|XP_447060.1| unnamed protein product [Candida gl... 134 3e-30
gi|38110838|gb|EAA56501.1| hypothetical protein MG06472.4 [Magna... 133 3e-30
gi|6323547|ref|NP_013618.1| 20S proteasome beta-type subunit; Pr... 133 3e-30
gi|12850076|dbj|BAB28582.1| unnamed protein product [Mus musculus] 133 3e-30
gi|50256001|gb|EAL18730.1| hypothetical protein CNBI3160 [Crypto... 133 4e-30
gi|23619460|ref|NP_705422.1| proteasome subunit, putative [Plasm... 133 4e-30
gi|32411629|ref|XP_326295.1| hypothetical protein [Neurospora cr... 133 4e-30
gi|39583626|emb|CAE65730.1| Hypothetical protein CBG10813 [Caeno... 133 4e-30
gi|50733010|ref|XP_418868.1| PREDICTED: similar to Proteasome su... 133 4e-30
gi|49100393|ref|XP_410863.1| PSA2_NEUCR Probable proteasome subu... 132 6e-30
gi|50549081|ref|XP_502011.1| hypothetical protein [Yarrowia lipo... 132 6e-30
gi|6679497|ref|NP_032970.1| proteasome (prosome, macropain) subu... 132 6e-30
gi|50260035|gb|EAL22698.1| hypothetical protein CNBB1470 [Crypto... 132 8e-30
gi|38051991|gb|AAH60576.1| Unknown (protein for MGC:72879) [Ratt... 132 8e-30
gi|4506181|ref|NP_002778.1| proteasome alpha 2 subunit; proteaso... 132 8e-30
gi|8394063|ref|NP_058975.1| proteasome (prosome, macropain) subu... 132 8e-30
gi|21465643|pdb|1IRU|B Chain B, Crystal Structure Of The Mammali... 132 8e-30
gi|12229889|sp|O16811|PS71_DROVI Proteasome subunit alpha type 7... 132 1e-29
gi|12229911|sp|Q27562|PSA1_DICDI Proteasome subunit alpha type 1... 132 1e-29
gi|3421070|gb|AAC32054.1| 20S proteasome subunit PAA1 [Arabidops... 131 1e-29
gi|12229925|sp|Q9NDA2|PSA7_TRYBB Proteasome subunit alpha type 7... 131 1e-29
gi|7435868|pir||T02089 proteasome chain - rice >gnl|BL_ORD_ID|19... 131 1e-29
gi|50287193|ref|XP_446026.1| unnamed protein product [Candida gl... 131 1e-29
gi|17737927|ref|NP_524328.1| CG5266-PA [Drosophila melanogaster]... 131 1e-29
gi|50555423|ref|XP_505120.1| hypothetical protein [Yarrowia lipo... 131 2e-29
gi|11066269|gb|AAG28528.1| 20S proteasome alpha 3 subunit [Trypa... 131 2e-29
gi|12229897|sp|O48551|PSA6_SOYBN Proteasome subunit alpha type 6... 131 2e-29
gi|49117267|ref|XP_412191.1| conserved hypothetical protein [Asp... 131 2e-29
gi|39644890|gb|AAH02900.2| PSMA2 protein [Homo sapiens] 130 2e-29
gi|2511588|emb|CAA74025.1| multicatalytic endopeptidase complex,... 130 3e-29
gi|15238554|ref|NP_198409.1| 20S proteasome alpha subunit A1 (PA... 130 3e-29
gi|37778980|gb|AAP20150.1| alpha 4 subunit of 20S proteasome [Pa... 130 3e-29
gi|34878218|ref|XP_344650.1| similar to Proteasome subunit alpha... 130 3e-29
gi|12229890|sp|O16812|PS73_DROVI Proteasome subunit alpha type 7... 130 4e-29
gi|20260140|gb|AAM12968.1| multicatalytic endopeptidase complex ... 129 5e-29
gi|29248189|gb|EAA39729.1| GLP_14_13086_13730 [Giardia lamblia A... 129 6e-29
gi|25143215|ref|NP_491520.2| proteasome Alpha Subunit (28.2 kD) ... 129 8e-29
gi|11967891|emb|CAC19494.1| maize 20S proteasome alpha subunit [... 128 1e-28
gi|17737405|ref|NP_523532.1| CG4904-PA [Drosophila melanogaster]... 128 1e-28
gi|23619461|ref|NP_705423.1| proteasome subunit, putative [Plasm... 128 1e-28
gi|30038118|gb|AAP12722.1| pros28.1B [Drosophila americana] 128 1e-28
gi|30266133|gb|AAP21576.1| pros28.1B [Drosophila novamexicana] 128 1e-28
gi|50295084|ref|XP_449953.1| unnamed protein product [Candida gl... 128 1e-28
gi|8744995|emb|CAB95217.1| proteasome subunit [Leishmania major] 128 1e-28
gi|23489884|gb|EAA21789.1| Y13180 multicatalytic endopeptidase [... 127 2e-28
gi|12229922|sp|Q9LSU3|PSA6_ORYSA Proteasome subunit alpha type 6... 127 2e-28
gi|15224993|ref|NP_178641.1| 20S proteasome alpha subunit A2 (PA... 127 2e-28
gi|15220151|ref|NP_175158.1| 20S proteasome alpha subunit F2 (PA... 127 2e-28
gi|38074730|ref|XP_135563.2| similar to Proteasome subunit alpha... 127 2e-28
gi|17945494|gb|AAL48800.1| RE23081p [Drosophila melanogaster] 127 2e-28
gi|21537234|gb|AAM61575.1| 20S proteasome subunit PAF1 [Arabidop... 127 3e-28
gi|15239061|ref|NP_199093.1| 20S proteasome alpha subunit F1 (PA... 127 3e-28
gi|25290066|pir||T51974 C 3.4.25.1 proteasome endopeptidase comp... 127 3e-28
gi|38047901|gb|AAR09853.1| similar to Drosophila melanogaster Pr... 126 4e-28
gi|50257248|gb|EAL19957.1| hypothetical protein CNBF2840 [Crypto... 126 4e-28
gi|46117136|ref|XP_384586.1| PSA2_NEUCR Probable proteasome subu... 126 5e-28
gi|34783332|gb|AAH22817.2| PSMA4 protein [Homo sapiens] 125 7e-28
gi|4506185|ref|NP_002780.1| proteasome alpha 4 subunit; proteaso... 125 7e-28
gi|23110935|ref|NP_683877.1| proteasome alpha 1 subunit isoform ... 125 7e-28
gi|48128110|ref|XP_393294.1| similar to PROSAg25 protein [Apis m... 125 7e-28
gi|19921232|ref|NP_609623.1| CG5648-PA [Drosophila melanogaster]... 125 7e-28
gi|4506179|ref|NP_002777.1| proteasome alpha 1 subunit isoform 2... 125 7e-28
gi|8394069|ref|NP_058977.1| proteasome (prosome, macropain) subu... 125 9e-28
gi|50752781|ref|XP_413742.1| PREDICTED: similar to Proteasome su... 125 9e-28
gi|6755196|ref|NP_036096.1| proteasome (prosome, macropain) subu... 125 9e-28
gi|33563282|ref|NP_036095.1| proteasome (prosome, macropain) sub... 125 9e-28
gi|31236614|ref|XP_319444.1| ENSANGP00000014428 [Anopheles gambi... 125 1e-27
gi|39722370|emb|CAE84406.1| Pre5 protein [Kluyveromyces delphensis] 125 1e-27
gi|8394060|ref|NP_058974.1| proteasome (prosome, macropain) subu... 125 1e-27
gi|542656|pir||S38530 C 3.4.25.1 proteasome endopeptidase comple... 124 2e-27
gi|46436840|gb|EAK96196.1| hypothetical protein CaO19.7178 [Cand... 124 2e-27
gi|38649313|gb|AAH63170.1| Proteasome (prosome, macropain) subun... 124 3e-27
gi|3228662|gb|AAC23597.1| proteasome A type subunit [Cryptospori... 123 4e-27
gi|46227993|gb|EAK88913.1| proteasome subunit alpha type 1, NTN ... 123 4e-27
gi|50369319|gb|AAH76206.1| Unknown (protein for MGC:92726) [Dani... 123 4e-27
gi|14594915|emb|CAC43318.1| putative alpha3 proteasome subunit [... 123 4e-27
gi|47550827|ref|NP_999862.1| proteasome (prosome, macropain) sub... 123 5e-27
gi|47230708|emb|CAF99901.1| unnamed protein product [Tetraodon n... 122 6e-27
gi|17562792|ref|NP_504472.1| proteasome Alpha Subunit (28.3 kD) ... 122 6e-27
gi|50427307|ref|XP_462266.1| unnamed protein product [Debaryomyc... 122 6e-27
gi|1172601|sp|Q09682|PSA4_SCHPO Probable proteasome subunit alph... 122 6e-27
gi|45200761|ref|NP_986331.1| AGL336Wp [Eremothecium gossypii] >g... 122 6e-27
gi|30584967|gb|AAP36756.1| Homo sapiens proteasome (prosome, mac... 122 8e-27
gi|47220588|emb|CAG05614.1| unnamed protein product [Tetraodon n... 122 8e-27
gi|45188273|ref|NP_984496.1| ADR401Cp [Eremothecium gossypii] >g... 122 8e-27
gi|13543551|gb|AAH05932.1| Proteasome alpha 1 subunit, isoform 2... 122 8e-27
gi|37654720|gb|AAQ96654.1| proteasome alpha 4 subunit [Branchios... 122 1e-26
gi|190447|gb|AAA92734.1| prosomal protein P30-33K 121 1e-26
gi|17562790|ref|NP_505750.1| proteasome Alpha Subunit (25.3 kD) ... 121 1e-26
gi|46125809|ref|XP_387458.1| conserved hypothetical protein [Gib... 121 2e-26
gi|34909168|ref|NP_915931.1| proteasome subunit alpha type 3 [Or... 121 2e-26
gi|3914431|sp|O24362|PSA3_SPIOL Proteasome subunit alpha type 3 ... 121 2e-26
gi|31212145|ref|XP_315057.1| ENSANGP00000011441 [Anopheles gambi... 121 2e-26
gi|50424757|ref|XP_460968.1| unnamed protein product [Debaryomyc... 120 2e-26
gi|39593417|emb|CAE64887.1| Hypothetical protein CBG09700 [Caeno... 120 2e-26
gi|50303013|ref|XP_451444.1| unnamed protein product [Kluyveromy... 120 2e-26
gi|39593140|emb|CAE64609.1| Hypothetical protein CBG09365 [Caeno... 120 3e-26
gi|7435867|pir||T01036 hypothetical protein YUP8H12R.19 - Arabid... 120 4e-26
gi|50405657|ref|XP_456467.1| unnamed protein product [Debaryomyc... 120 4e-26
gi|50748866|ref|XP_421435.1| PREDICTED: similar to Proteasome su... 119 5e-26
gi|11513996|pdb|1G0U|E Chain E, A Gated Channel Into The Proteas... 119 5e-26
gi|15225839|ref|NP_180270.1| 20S proteasome alpha subunit G (PAG... 119 7e-26
gi|2511586|emb|CAA73625.1| multicatalytic endopeptidase [Arabido... 119 9e-26
gi|3914413|sp|P90513|PSA3_ACACA Proteasome subunit alpha type 3 ... 119 9e-26
gi|48141210|ref|XP_397196.1| similar to Proteasome subunit alpha... 118 1e-25
gi|6323974|ref|NP_014045.1| 20S proteasome alpha-type subunit; P... 118 1e-25
gi|3114274|pdb|1RYP|F Chain F, Crystal Structure Of The 20s Prot... 118 1e-25
gi|17136420|ref|NP_476691.1| CG9327-PA [Drosophila melanogaster]... 118 1e-25
gi|45384316|ref|NP_990351.1| 20S proteasome subunit C2 [Gallus g... 118 1e-25
gi|14594925|emb|CAC43323.1| putative alpha7 proteasome subunit [... 118 1e-25
gi|542655|pir||S38529 C 3.4.25.1 proteasome endopeptidase comple... 118 1e-25
gi|49076942|ref|XP_402391.1| hypothetical protein UM04776.1 [Ust... 118 1e-25
gi|32413036|ref|XP_326998.1| hypothetical protein [Neurospora cr... 117 2e-25
gi|49079278|ref|XP_403302.1| hypothetical protein UM05687.1 [Ust... 117 3e-25
gi|103322|pir||S10318 C 3.4.25.1 proteasome endopeptidase comple... 116 4e-25
gi|2511592|emb|CAA74027.1| multicatalytic endopeptidase complex,... 116 4e-25
gi|49098619|ref|XP_410684.1| hypothetical protein AN6547.2 [Aspe... 116 4e-25
gi|20810439|gb|AAH29402.1| Proteasome alpha 3 subunit, isoform 1... 116 4e-25
gi|46121687|ref|XP_385398.1| conserved hypothetical protein [Gib... 116 4e-25
gi|50080306|gb|AAT69640.1| putative proteasome subunit alpha typ... 116 6e-25
gi|1857239|gb|AAB48403.1| 29 kDa proteasome subunit TCPR29A [Try... 116 6e-25
gi|12643703|sp|P92188|PSA1_TRYCR Proteasome subunit alpha type 1... 116 6e-25
gi|3914438|sp|O70435|PSA3_MOUSE Proteasome subunit alpha type 3 ... 116 6e-25
gi|8394066|ref|NP_058976.1| proteasome (prosome, macropain) subu... 116 6e-25
gi|19075540|ref|NP_588040.1| proteasome component c1 [Schizosacc... 116 6e-25
gi|12229908|sp|O96788|PSA1_TRYBR Proteasome subunit alpha type 1... 115 7e-25
gi|50260207|gb|EAL22868.1| hypothetical protein CNBB0890 [Crypto... 115 7e-25
gi|24586400|ref|NP_724614.1| CG18495-PA [Drosophila melanogaster... 115 7e-25
gi|34849610|gb|AAH58201.1| MGC68557 protein [Xenopus laevis] 115 7e-25
gi|4506183|ref|NP_002779.1| proteasome alpha 3 subunit isoform 1... 115 7e-25
gi|48145983|emb|CAG33214.1| PSMA3 [Homo sapiens] 115 7e-25
gi|21465648|pdb|1IRU|G Chain G, Crystal Structure Of The Mammali... 115 7e-25
gi|26353732|dbj|BAC40496.1| unnamed protein product [Mus musculus] 115 7e-25
gi|4929308|gb|AAD33944.1| 20S proteasome subunit alpha1 [Drosoph... 115 1e-24
gi|14594923|emb|CAC43322.1| putative alpha6 proteasome subunit [... 115 1e-24
gi|31981534|ref|NP_035314.2| proteasome (prosome, macropain) sub... 114 2e-24
gi|30584117|gb|AAP36307.1| Homo sapiens proteasome (prosome, mac... 114 3e-24
gi|23110939|ref|NP_687033.1| proteasome alpha 3 subunit isoform ... 114 3e-24
gi|13812154|ref|NP_113281.1| 26S proteasome SU A5 [Guillardia th... 114 3e-24
gi|47607474|gb|AAT36639.1| light organ C8 alpha proteasome subun... 114 3e-24
gi|7576250|emb|CAB87991.1| 20S proteasome alpha-subunit 3 (C9) [... 113 4e-24
gi|50603942|gb|AAH77442.1| Unknown (protein for MGC:82289) [Xeno... 113 4e-24
gi|14594919|emb|CAC43320.1| putative alpha5 proteasome subunit [... 113 4e-24
gi|38103615|gb|EAA50294.1| hypothetical protein MG04053.4 [Magna... 112 6e-24
gi|48096769|ref|XP_392518.1| similar to C 3.4.25.1 proteasome en... 112 6e-24
gi|45360875|ref|NP_989113.1| proteasome (prosome, macropain) sub... 112 8e-24
gi|50540244|ref|NP_001002589.1| zgc:92716 [Danio rerio] >gnl|BL_... 112 8e-24
gi|48717106|ref|NP_001001347.1| proteasome subunit alpha type 3-... 112 8e-24
gi|47222687|emb|CAG00121.1| unnamed protein product [Tetraodon n... 112 1e-23
gi|49080726|ref|XP_403849.1| hypothetical protein UM06234.1 [Ust... 111 1e-23
gi|46439482|gb|EAK98799.1| hypothetical protein CaO19.5378 [Cand... 111 1e-23
gi|23509938|ref|NP_702605.1| Proteosome subunit alpha type 1, pu... 111 1e-23
gi|8394076|ref|NP_058979.1| proteasome (prosome, macropain) subu... 111 2e-23
gi|46439381|gb|EAK98699.1| hypothetical protein CaO19.12833 [Can... 111 2e-23
gi|15679213|ref|NP_276330.1| proteasome, beta subunit [Methanoth... 111 2e-23
gi|32405630|ref|XP_323428.1| hypothetical protein [Neurospora cr... 110 2e-23
gi|50548937|ref|XP_501939.1| hypothetical protein [Yarrowia lipo... 110 2e-23
gi|6755198|ref|NP_036098.1| proteasome (prosome, macropain) subu... 110 3e-23
gi|50407398|ref|XP_456708.1| unnamed protein product [Debaryomyc... 110 3e-23
gi|50424395|ref|XP_460784.1| unnamed protein product [Debaryomyc... 110 3e-23
gi|33416349|gb|AAH55520.1| Unknown (protein for MGC:66161) [Dani... 110 4e-23
gi|50748430|ref|XP_421242.1| PREDICTED: similar to Proteasome su... 109 5e-23
gi|32422497|ref|XP_331692.1| hypothetical protein [Neurospora cr... 109 7e-23
gi|19263493|gb|AAH25393.1| MGC26605 protein [Homo sapiens] 108 2e-22
gi|20306890|gb|AAH28371.1| MGC26605 protein [Homo sapiens] >gnl|... 108 2e-22
gi|46228188|gb|EAK89087.1| proteasome subunit alpha type 3, NTN ... 108 2e-22
gi|9651787|gb|AAF91273.1| 20S proteasome alpha 5 subunit [Leishm... 107 2e-22
gi|19115013|ref|NP_594101.1| proteasome subunit C2 [Schizosaccha... 107 3e-22
gi|31241317|ref|XP_321089.1| ENSANGP00000018478 [Anopheles gambi... 107 3e-22
gi|38079802|ref|XP_147971.2| similar to proteasome alpha7/C8 sub... 107 3e-22
gi|38102685|gb|EAA49495.1| hypothetical protein MG01153.4 [Magna... 107 3e-22
gi|38076740|ref|XP_110067.2| similar to proteasome alpha7/C8 sub... 106 4e-22
gi|24119230|ref|NP_705941.1| proteasome (prosome, macropain) sub... 106 4e-22
gi|31230444|ref|XP_318387.1| ENSANGP00000015960 [Anopheles gambi... 106 6e-22
gi|38107252|gb|EAA53450.1| hypothetical protein MG07727.4 [Magna... 105 8e-22
gi|49078688|ref|XP_403072.1| hypothetical protein UM05457.1 [Ust... 105 8e-22
gi|47224863|emb|CAG06433.1| unnamed protein product [Tetraodon n... 105 1e-21
gi|38080867|ref|XP_358993.1| similar to proteasome alpha7/C8 sub... 105 1e-21
gi|46137479|ref|XP_390431.1| conserved hypothetical protein [Gib... 105 1e-21
gi|50548061|ref|XP_501500.1| hypothetical protein [Yarrowia lipo... 105 1e-21
gi|49096940|ref|XP_409930.1| hypothetical protein AN5793.2 [Aspe... 104 2e-21
gi|32413140|ref|XP_327050.1| hypothetical protein [Neurospora cr... 104 2e-21
gi|41052611|dbj|BAD08003.1| putative Proteasome subunit alpha ty... 103 3e-21
gi|9623022|gb|AAF90008.1| 20S proteasome alpha 5 subunit [Tricho... 103 4e-21
gi|17562788|ref|NP_506571.1| proteasome Alpha Subunit (27.0 kD) ... 103 5e-21
gi|29247155|gb|EAA38727.1| GLP_436_20835_20083 [Giardia lamblia ... 102 6e-21
gi|38047741|gb|AAR09773.1| similar to Drosophila melanogaster Pr... 102 6e-21
gi|23110948|ref|NP_689468.1| proteasome alpha 7 subunit isoform ... 102 8e-21
gi|18859267|ref|NP_571870.1| proteasome (prosome, macropain) sub... 102 8e-21
gi|24652204|ref|NP_724834.1| CG1519-PA [Drosophila melanogaster]... 102 1e-20
gi|39594670|emb|CAE72249.1| Hypothetical protein CBG19367 [Caeno... 102 1e-20
gi|39587803|emb|CAE67821.1| Hypothetical protein CBG13401 [Caeno... 101 1e-20
gi|34870100|ref|XP_212707.2| similar to Proteasome subunit alpha... 101 2e-20
gi|42734293|emb|CAA88436.2| Hypothetical protein ZK945.2 [Caenor... 100 3e-20
gi|17535355|ref|NP_496177.1| proteasome Alpha Subunit (28.9 kD) ... 100 3e-20
gi|49117797|gb|AAH72719.1| Unknown (protein for MGC:91778) [Dani... 100 3e-20
gi|24651571|ref|NP_651843.1| CG1736-PA [Drosophila melanogaster]... 100 4e-20
gi|24850286|gb|AAN63094.1| testis-specific 20S proteasome subuni... 100 4e-20
gi|38111195|gb|EAA56810.1| hypothetical protein MG07165.4 [Magna... 100 4e-20
gi|34978952|gb|AAQ83685.1| proteasome subunit alpha-3 [Allium sa... 99 7e-20
gi|49095090|ref|XP_409006.1| conserved hypothetical protein [Asp... 99 7e-20
gi|9651785|gb|AAF91272.1| 20S proteasome alpha 5 subunit [Trypan... 99 7e-20
gi|39589905|emb|CAE60903.1| Hypothetical protein CBG04619 [Caeno... 99 9e-20
gi|38076158|ref|XP_122711.2| similar to proteasome alpha7/C8 sub... 98 2e-19
gi|14039743|gb|AAK53380.1| 20S proteasome subunit alpha 3 [Loliu... 98 2e-19
gi|5814087|gb|AAD52094.1| 20S proteasome alpha subunit [Leishman... 98 2e-19
gi|46107362|ref|XP_380740.1| hypothetical protein FG00564.1 [Gib... 98 2e-19
gi|19112166|ref|NP_595374.1| 20S proteasome component (alpha 1) ... 98 2e-19
gi|33604016|gb|AAH56249.1| PSMA4 protein [Homo sapiens] 97 3e-19
gi|12584835|gb|AAG59850.1| 20S proteasome alpha subunit 4 [Giard... 97 4e-19
gi|37778998|gb|AAP20159.1| proteasome subunit alpha type 1 [Pagr... 96 8e-19
gi|14594917|emb|CAC43319.1| putative alpha4 proteasome subunit [... 94 2e-18
gi|21226796|ref|NP_632718.1| Proteasome, beta subunit [Methanosa... 93 5e-18
gi|46228400|gb|EAK89299.1| proteasome subunit alpha1 [Cryptospor... 93 5e-18
gi|9622228|gb|AAF89683.1| 20S proteasome alpha 7 subunit [Trypan... 92 9e-18
gi|29247195|gb|EAA38766.1| GLP_47_22543_21776 [Giardia lamblia A... 92 9e-18
gi|45201007|ref|NP_986577.1| AGL089Wp [Eremothecium gossypii] >g... 92 1e-17
gi|1907268|emb|CAA62960.1| proteasome subunit C9-like protein [S... 92 1e-17
gi|15022420|dbj|BAB62241.1| alpha 1-2 subunit of 20S proteasome ... 92 1e-17
gi|3114269|pdb|1RYP|A Chain A, Crystal Structure Of The 20s Prot... 91 3e-17
gi|6321427|ref|NP_011504.1| Proteasome subunit YC7alpha/Y8 (prot... 91 3e-17
gi|20092669|ref|NP_618744.1| multicatalytic endopeptidase comple... 91 3e-17
gi|50302571|ref|XP_451221.1| unnamed protein product [Kluyveromy... 91 3e-17
gi|48838589|ref|ZP_00295531.1| COG0638: 20S proteasome, alpha an... 91 3e-17
gi|50284725|ref|XP_444790.1| unnamed protein product [Candida gl... 90 4e-17
gi|20094664|ref|NP_614511.1| Protease subunit of the proteasome ... 90 4e-17
gi|30140329|emb|CAD89602.1| putative proteasome subunit [Candida... 90 4e-17
gi|2582508|gb|AAB82572.1| 20S proteasome alpha7 subunit [Drosoph... 90 4e-17
gi|29247707|gb|EAA39261.1| GLP_457_25625_26368 [Giardia lamblia ... 90 4e-17
gi|23490442|gb|EAA22218.1| proteasome subunit alpha type 1 [Plas... 90 4e-17
gi|17380265|sp|Q9P992|PSMB_METTE Proteasome beta subunit precurs... 90 6e-17
gi|46442797|gb|EAL02084.1| hypothetical protein CaO19.13935 [Can... 88 2e-16
gi|3641499|gb|AAC36462.1| proteosome component [Theileria parva] 88 2e-16
gi|46397024|sp|Q9GU37|PSA1_TRYBB Proteasome subunit alpha type 1... 87 3e-16
gi|15920523|ref|NP_376192.1| 197aa long hypothetical proteasome ... 87 4e-16
gi|18314179|ref|NP_560846.1| proteasome, beta subunit [Pyrobacul... 87 4e-16
gi|28573936|ref|NP_523668.3| CG1519-PB [Drosophila melanogaster]... 86 6e-16
gi|26343477|dbj|BAC35395.1| unnamed protein product [Mus musculus] 85 2e-15
gi|296736|emb|CAA43964.1| macropain subunit iota [Homo sapiens] 84 3e-15
gi|29246315|gb|EAA37916.1| GLP_105_6759_5881 [Giardia lamblia AT... 81 2e-14
gi|15669422|ref|NP_248232.1| proteasome, subunit beta (psmB) [Me... 78 2e-13
gi|14600776|ref|NP_147297.1| proteasome, beta subunit [Aeropyrum... 78 2e-13
gi|11498092|ref|NP_069317.1| proteasome, subunit beta (psmB) [Ar... 78 2e-13
gi|23479087|gb|EAA16012.1| proteasome subunit alpha Type 6-B [Pl... 78 2e-13
gi|12314029|emb|CAC04018.1| dJ1005F21.4.2 (proteasome (prosome, ... 77 3e-13
gi|19173483|ref|NP_597286.1| 20S PROTEASOME COMPONENT C3 [Enceph... 77 4e-13
gi|13812150|ref|NP_113277.1| similar to proteasome A-type submit... 77 4e-13
gi|23612939|ref|NP_704478.1| proteasome subunit alpha, putative ... 77 4e-13
gi|14591201|ref|NP_143277.1| proteasome beta subunit precursor [... 77 4e-13
gi|19173674|ref|NP_597477.1| 26S PROTEASOME ALPHA-TYPE SUBUNIT C... 77 5e-13
gi|11357104|pir||T48677 proteasome beta-1 chain [validated] - Ha... 76 6e-13
gi|14520958|ref|NP_126433.1| proteasome, subunit beta [Pyrococcu... 76 8e-13
gi|45358258|ref|NP_987815.1| proteasome, subunit beta [Methanoco... 75 2e-12
gi|23486739|gb|EAA20882.1| Proteasome A-type and B-type, putativ... 75 2e-12
gi|29726328|pdb|1J2Q|H Chain H, 20s Proteasome In Complex With C... 74 2e-12
gi|9651781|gb|AAF91270.1| 20S proteasome alpha 5 subunit [Vairim... 73 5e-12
gi|18976531|ref|NP_577888.1| multicatalytic endopeptidase comple... 73 5e-12
gi|16805254|ref|NP_473282.1| proteasome component C8, putative [... 73 7e-12
gi|13812023|ref|NP_113154.1| 26S proteasome SU [Guillardia theta... 72 2e-11
gi|28195693|gb|AAO27765.1| proteasome subunit alpha 3 [Gasterost... 71 2e-11
gi|172546|gb|AAA35020.1| scll+ suppressor protein 71 2e-11
gi|18312192|ref|NP_558859.1| proteasome beta subunit [Pyrobaculu... 70 4e-11
gi|13541494|ref|NP_111182.1| Proteasome protease subunit beta [T... 69 8e-11
gi|46142175|ref|ZP_00147899.2| COG0638: 20S proteasome, alpha an... 69 1e-10
gi|16081708|ref|NP_394085.1| proteasome, beta chain [Thermoplasm... 69 1e-10
gi|19074664|ref|NP_586170.1| PROTEASOME ALPHA SUBUNIT C6 [Enceph... 68 2e-10
gi|2134191|pir||S64739 C 3.4.25.1 proteasome endopeptidase compl... 68 2e-10
gi|18977776|ref|NP_579133.1| proteasome, subunit beta (multicata... 68 2e-10
gi|15897221|ref|NP_341826.1| Proteasome subunit [Sulfolobus solf... 68 2e-10
gi|48852543|ref|ZP_00306728.1| COG0638: 20S proteasome, alpha an... 67 3e-10
gi|14590176|ref|NP_142241.1| proteasome beta subunit [Pyrococcus... 67 3e-10
gi|14600766|ref|NP_147287.1| proteasome, beta subunit [Aeropyrum... 67 4e-10
gi|19173194|ref|NP_596997.1| PROTEASOME BETA-TYPE SUBUNIT (MACRO... 67 5e-10
gi|15790018|ref|NP_279842.1| proteasome, subunit alpha; PsmA [Ha... 66 7e-10
gi|9651779|gb|AAF91269.1| 20S proteasome alpha 5 subunit [Nosema... 66 9e-10
gi|13812281|ref|NP_113399.1| 26S proteasome IOTA SU [Guillardia ... 66 9e-10
gi|50405049|ref|YP_054141.1| Proteosome subunit, putative [Param... 65 1e-09
gi|13812047|ref|NP_113181.1| 26S proteasome SU [Guillardia theta... 65 1e-09
gi|15920692|ref|NP_376361.1| 207aa long hypothetical proteasome ... 65 1e-09
gi|19173153|ref|NP_596956.1| PROTEASOME REGULATORY SUBUNIT 8 [En... 65 2e-09
gi|6942055|gb|AAF32305.1| 20S proteasome alpha subunit 5 [Giardi... 64 3e-09
gi|14520445|ref|NP_125920.1| proteasome, subunit beta [Pyrococcu... 64 3e-09
gi|9910839|sp|Q9UXF3|PSMB_SULSO Proteasome beta subunit precurso... 64 3e-09
gi|15897668|ref|NP_342273.1| Proteasome subunit [Sulfolobus solf... 64 3e-09
gi|46441180|gb|EAL00479.1| hypothetical protein CaO19.7605 [Cand... 62 1e-08
gi|9623020|gb|AAF90007.1| 20S proteasome alpha 3 subunit [Acanth... 61 2e-08
gi|4050075|gb|AAC97957.1| proteasome beta 5 subunit [Trypanosoma... 61 2e-08
gi|48477758|ref|YP_023464.1| proteasome beta subunit [Picrophilu... 61 3e-08
gi|50302329|ref|XP_451099.1| unnamed protein product [Kluyveromy... 60 4e-08
gi|50293069|ref|XP_448962.1| unnamed protein product [Candida gl... 60 4e-08
gi|46228168|gb|EAK89067.1| PUP1/proteasome subunit beta type 7, ... 60 5e-08
gi|10185394|emb|CAC08538.1| proteasome PRCE (beta-5) subunit pre... 60 5e-08
gi|13812088|ref|NP_113179.1| 26S proteasome SU alpha7 [Guillardi... 60 5e-08
gi|7141312|gb|AAF37285.1| 20S proteasome beta 5 subunit [Trypano... 60 5e-08
gi|50302437|ref|XP_451153.1| unnamed protein product [Kluyveromy... 59 8e-08
gi|27659052|ref|XP_214687.1| similar to proteasome (prosome, mac... 59 1e-07
gi|17380243|sp|O35955|PSBA_MOUSE Proteasome subunit beta type 10... 59 1e-07
gi|13435741|gb|AAH04730.1| Proteasome (prosome, macropain) subun... 59 1e-07
gi|6324731|ref|NP_014800.1| putative proteasome subunit; Pup1p [... 59 1e-07
gi|6942053|gb|AAF32304.1| 20S proteasome alpha subunit 3 [Giardi... 58 2e-07
gi|45184943|ref|NP_982661.1| AAR119Wp [Eremothecium gossypii] >g... 58 2e-07
gi|48146081|emb|CAG33263.1| PSMB10 [Homo sapiens] 58 2e-07
gi|4506191|ref|NP_002792.1| proteasome beta 10 subunit proprotei... 58 2e-07
gi|7305417|ref|NP_038668.1| proteasome (prosome, macropain) subu... 58 2e-07
gi|31204967|ref|XP_311432.1| ENSANGP00000018548 [Anopheles gambi... 57 3e-07
>gi|17508493|ref|NP_492765.1| proteasome Alpha Subunit (27.2 kD)
(pas-5) [Caenorhabditis elegans]
gi|12229918|sp|Q95008|PSA5_CAEEL Proteasome subunit alpha type 5
(Proteasome subunit alpha 5)
gi|7499835|pir||T21350 hypothetical protein F25H2.9 -
Caenorhabditis elegans
gi|3876333|emb|CAB02097.1| C. elegans PAS-5 protein (corresponding
sequence F25H2.9) [Caenorhabditis elegans]
Length = 248
Score = 478 bits (1229), Expect = e-134
Identities = 248/248 (100%), Positives = 248/248 (100%)
Frame = +1
Query: 1 MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAVKLGSTSIGIKTSEGVLLAAEKRSTSKLMV 180
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAVKLGSTSIGIKTSEGVLLAAEKRSTSKLMV
Sbjct: 1 MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAVKLGSTSIGIKTSEGVLLAAEKRSTSKLMV 60
Query: 181 NDAIEKISKVDQHIGVTFAGLIADSRTLVERAQIEAQNFWFTYNRKIRVEDVTQSVANLA 360
NDAIEKISKVDQHIGVTFAGLIADSRTLVERAQIEAQNFWFTYNRKIRVEDVTQSVANLA
Sbjct: 61 NDAIEKISKVDQHIGVTFAGLIADSRTLVERAQIEAQNFWFTYNRKIRVEDVTQSVANLA 120
Query: 361 LQFGDDDVKASMSRPFGVAMLFAGVDQEGAKLFHLDPSGTFIDCKAKSIGAASDGAEQNL 540
LQFGDDDVKASMSRPFGVAMLFAGVDQEGAKLFHLDPSGTFIDCKAKSIGAASDGAEQNL
Sbjct: 121 LQFGDDDVKASMSRPFGVAMLFAGVDQEGAKLFHLDPSGTFIDCKAKSIGAASDGAEQNL 180
Query: 541 KEQYHDALTIKEGLKMALAILKQVMEEKLNSANVEVVVIKPTVDAKGRPIGEFTRVSNEE 720
KEQYHDALTIKEGLKMALAILKQVMEEKLNSANVEVVVIKPTVDAKGRPIGEFTRVSNEE
Sbjct: 181 KEQYHDALTIKEGLKMALAILKQVMEEKLNSANVEVVVIKPTVDAKGRPIGEFTRVSNEE 240
Query: 721 LDQVITSL 744
LDQVITSL
Sbjct: 241 LDQVITSL 248