Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F23H12_4
(906 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT... 215 1e-54
gi|39592242|emb|CAE75463.1| Hypothetical protein CBG23461 [Caeno... 212 1e-53
gi|115397|sp|P08124|CC01_CAEEL Cuticle collagen 1 precursor (Squ... 199 5e-50
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ... 166 7e-40
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno... 166 7e-40
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 114 2e-24
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 114 3e-24
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 114 3e-24
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 114 3e-24
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno... 113 7e-24
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl... 113 7e-24
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >... 113 7e-24
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 112 1e-23
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 110 3e-23
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno... 110 3e-23
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ... 106 8e-22
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e... 105 1e-21
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 104 3e-21
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 103 7e-21
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 103 7e-21
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 103 7e-21
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 102 1e-20
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 101 2e-20
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 100 3e-20
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 100 3e-20
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno... 100 8e-20
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 99 1e-19
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 99 1e-19
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 99 2e-19
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 98 2e-19
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 97 4e-19
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 97 6e-19
gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33) [... 96 8e-19
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 96 8e-19
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 96 1e-18
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-... 96 1e-18
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno... 96 1e-18
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 94 5e-18
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 94 5e-18
gi|17539418|ref|NP_501561.1| COLlagen structural gene (col-119) ... 94 5e-18
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ... 92 1e-17
gi|1589837|gb|AAC48358.1| cuticle preprocollagen [Meloidogyne in... 92 2e-17
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ... 92 2e-17
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno... 90 6e-17
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 90 6e-17
gi|39588940|emb|CAE69570.1| Hypothetical protein CBG15782 [Caeno... 89 1e-16
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [... 89 1e-16
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 88 2e-16
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 88 2e-16
gi|39596498|emb|CAE63117.1| Hypothetical protein CBG07414 [Caeno... 87 4e-16
gi|1184072|gb|AAC47437.1| COL-1 87 5e-16
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [... 85 3e-15
gi|17542184|ref|NP_501700.1| COLlagen structural gene (29.4 kD) ... 84 6e-15
gi|39588428|emb|CAE72779.1| Hypothetical protein CBG20034 [Caeno... 83 7e-15
gi|32698037|emb|CAE11316.1| Hypothetical protein H06A10.2 [Caeno... 82 1e-14
gi|17568109|ref|NP_510274.1| COLlagen structural gene (col-44) [... 82 2e-14
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 77 4e-13
gi|39596517|emb|CAE63136.1| Hypothetical protein CBG07436 [Caeno... 77 7e-13
gi|17557099|ref|NP_499700.1| COLlagen structural gene (30.3 kD) ... 75 2e-12
gi|39588941|emb|CAE69571.1| Hypothetical protein CBG15783 [Caeno... 75 2e-12
gi|39583745|emb|CAE63849.1| Hypothetical protein CBG08408 [Caeno... 74 4e-12
gi|39580392|emb|CAE70951.1| Hypothetical protein CBG17762 [Caeno... 74 4e-12
gi|17543166|ref|NP_500138.1| COLlagen structural gene (29.0 kD) ... 74 6e-12
gi|4809258|gb|AAD30169.1| collagen [Haemonchus contortus] 72 2e-11
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 71 3e-11
gi|39596527|emb|CAE63146.1| Hypothetical protein CBG07448 [Caeno... 71 3e-11
gi|17551424|ref|NP_510247.1| COLlagen structural gene (col-183) ... 70 5e-11
gi|17537301|ref|NP_494562.1| COLlagen structural gene (37.0 kD) ... 70 8e-11
gi|39582210|emb|CAE64161.1| Hypothetical protein CBG08781 [Caeno... 69 1e-10
gi|39580360|emb|CAE61465.1| Hypothetical protein CBG05357 [Caeno... 68 3e-10
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno... 64 5e-09
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno... 56 9e-09
gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114) ... 63 1e-08
gi|39593552|emb|CAE61844.1| Hypothetical protein CBG05818 [Caeno... 62 1e-08
gi|17535685|ref|NP_496589.1| ROLler: helically twisted, animals ... 62 2e-08
gi|39596499|emb|CAE63118.1| Hypothetical protein CBG07415 [Caeno... 61 3e-08
gi|17561476|ref|NP_505888.1| COLlagen structural gene (col-155) ... 60 5e-08
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 60 7e-08
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 59 1e-07
gi|7498195|pir||T34203 hypothetical protein D2024.8 - Caenorhabd... 56 1e-06
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 55 2e-06
gi|39591412|emb|CAE73466.1| Hypothetical protein CBG20917 [Caeno... 54 5e-06
gi|159171|gb|AAA29174.1| collagen 8E 52 2e-05
gi|115399|sp|P16252|CAC2_HAECO Cuticle collagen 2C >gnl|BL_ORD_I... 52 2e-05
gi|321007|pir||B44984 collagen - nematode (Haemonchus contortus)... 52 2e-05
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 47 3e-05
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 51 3e-05
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 51 3e-05
gi|39591507|emb|CAE73561.1| Hypothetical protein CBG21031 [Caeno... 51 3e-05
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 51 3e-05
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 51 3e-05
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 51 4e-05
gi|17568107|ref|NP_510273.1| COLlagen structural gene (col-9) [C... 51 4e-05
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 50 5e-05
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 50 5e-05
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 50 9e-05
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 50 9e-05
gi|17568327|ref|NP_509766.1| cuticle collagen 1 like (XL161) [Ca... 50 9e-05
gi|543968|sp|P35800|CCDA_CAEEL Cuticle collagen dpy-10 precursor... 50 9e-05
gi|687634|gb|AAA62504.1| collagen 50 9e-05
gi|7494559|pir||T28887 collagen dpy-10 - Caenorhabditis elegans 49 1e-04
gi|32565701|ref|NP_495366.2| collagen triple helix repeat family... 49 1e-04
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 49 2e-04
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 49 2e-04
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 48 3e-04
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 48 3e-04
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 48 3e-04
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 48 3e-04
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 48 3e-04
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 48 3e-04
gi|17539916|ref|NP_500598.1| COLlagen structural gene (col-110) ... 48 3e-04
gi|17532741|ref|NP_495367.1| DumPY : shorter than wild-type DPY-... 47 4e-04
gi|39590294|emb|CAE66032.1| Hypothetical protein CBG11227 [Caeno... 47 4e-04
gi|543967|sp|P35799|CCD2_CAEEL Cuticle collagen dpy-2 precursor 47 4e-04
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 47 4e-04
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 47 8e-04
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 47 8e-04
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd... 46 0.001
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno... 46 0.001
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 46 0.001
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 46 0.001
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [... 46 0.001
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 46 0.001
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 46 0.001
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 45 0.002
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 45 0.002
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 45 0.002
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 45 0.002
gi|39587615|emb|CAE58553.1| Hypothetical protein CBG01712 [Caeno... 45 0.002
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 45 0.003
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 45 0.003
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 45 0.003
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 44 0.004
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 44 0.004
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 44 0.004
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 44 0.004
gi|39591241|emb|CAE73294.1| Hypothetical protein CBG20714 [Caeno... 44 0.004
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 44 0.005
gi|7332272|gb|AAA17398.2| collagen [Caenorhabditis elegans] 44 0.005
gi|7494560|pir||T37285 collagen dpy-2 - Caenorhabditis elegans 44 0.005
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 44 0.005
gi|32567349|ref|NP_872207.1| COLlagen structural gene (col-42) [... 44 0.005
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 44 0.006
gi|39597872|emb|CAE68564.1| Hypothetical protein CBG14399 [Caeno... 44 0.006
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 43 0.011
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 43 0.011
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 43 0.011
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 42 0.014
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 42 0.019
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 42 0.019
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 42 0.019
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno... 42 0.019
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 42 0.019
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 42 0.019
gi|42733645|gb|AAS38609.1| hypothetical protein [Dictyostelium d... 42 0.025
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 42 0.025
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 41 0.032
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 41 0.032
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 41 0.032
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 41 0.032
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 41 0.042
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 41 0.042
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 40 0.055
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 40 0.055
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 40 0.055
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 40 0.055
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno... 40 0.072
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 40 0.072
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno... 40 0.094
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 40 0.094
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 40 0.094
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 39 0.12
gi|29570382|gb|AAO38600.2| Dumpy : shorter than wild-type protei... 39 0.12
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 39 0.12
gi|17507951|ref|NP_491958.1| COLlagen structural gene (col-59) [... 39 0.16
gi|12082166|dbj|BAB20792.1| master of thick veins [Drosophila me... 39 0.16
gi|7839385|gb|AAF70256.1| Scribbler long isoform [Drosophila mel... 39 0.16
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna... 39 0.16
gi|17862874|gb|AAL39914.1| SD01229p [Drosophila melanogaster] 39 0.16
gi|24654891|ref|NP_524678.2| CG5580-PA [Drosophila melanogaster]... 39 0.16
gi|32565703|ref|NP_872048.1| dumpy shorter than wild-type protei... 39 0.16
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus] 39 0.21
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd... 39 0.21
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 39 0.21
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 39 0.21
gi|34874497|ref|XP_224295.2| similar to KIAA0853 protein [Rattus... 38 0.36
gi|39581447|emb|CAE74729.1| Hypothetical protein CBG22547 [Caeno... 38 0.36
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 38 0.36
gi|23486190|gb|EAA20743.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [... 38 0.36
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 38 0.36
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 38 0.36
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 38 0.36
gi|6323816|ref|NP_013887.1| Multicopy Suppressor of STA10 - 11; ... 37 0.61
gi|46439039|gb|EAK98361.1| hypothetical protein CaO19.467 [Candi... 37 0.61
gi|45551490|ref|NP_728415.3| CG1693-PB [Drosophila melanogaster]... 37 0.61
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli... 37 0.61
gi|17551704|ref|NP_508747.1| COLlagen structural gene (33.9 kD) ... 37 0.61
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p... 37 0.61
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 37 0.61
gi|50309619|ref|XP_454821.1| unnamed protein product [Kluyveromy... 37 0.61
gi|45549291|ref|NP_542443.4| CG1693-PA [Drosophila melanogaster]... 37 0.61
gi|28828927|gb|AAO51513.1| similar to Plasmodium falciparum (iso... 37 0.79
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 37 0.79
gi|28829605|gb|AAO52122.1| similar to Plasmodium falciparum. Hyp... 37 0.79
gi|28829619|gb|AAO52136.1| similar to Dictyostelium. Serine/thre... 37 0.79
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 37 0.79
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno... 37 0.79
gi|50424343|ref|XP_460758.1| unnamed protein product [Debaryomyc... 37 0.79
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 36 1.0
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 36 1.0
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [... 36 1.0
gi|30038111|gb|AAP12719.1| mastermind [Drosophila americana] 36 1.0
gi|2623355|gb|AAC53435.1| sex determining protein [Mus musculus ... 36 1.0
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 36 1.0
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA... 36 1.0
gi|22788805|ref|NP_690517.1| hypothetical protein K06A9.1a [Heli... 36 1.4
gi|47224217|emb|CAG09063.1| unnamed protein product [Tetraodon n... 36 1.4
gi|1729824|sp|P54683|TAGB_DICDI Prestalk-specific protein tagB p... 36 1.4
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 36 1.4
gi|24648119|ref|NP_650778.1| CG6026-PA [Drosophila melanogaster]... 36 1.4
gi|28829810|gb|AAO52312.1| similar to Dictyostelium discoideum (... 36 1.4
gi|24661837|ref|NP_648347.1| CG16711-PA [Drosophila melanogaster... 36 1.4
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col... 36 1.4
gi|24664668|ref|NP_730054.1| CG7439-PC [Drosophila melanogaster]... 35 1.8
gi|28571881|ref|NP_651342.2| CG11848-PA [Drosophila melanogaster... 35 1.8
gi|20151461|gb|AAM11090.1| GH28553p [Drosophila melanogaster] 35 1.8
gi|12053007|emb|CAB66679.1| hypothetical protein [Homo sapiens] 35 1.8
gi|24664664|ref|NP_648775.1| CG7439-PB [Drosophila melanogaster]... 35 1.8
gi|28317062|gb|AAO39550.1| RE04347p [Drosophila melanogaster] 35 1.8
gi|50421413|ref|XP_459257.1| unnamed protein product [Debaryomyc... 35 1.8
gi|32415041|ref|XP_328000.1| hypothetical protein [Neurospora cr... 35 1.8
gi|30266126|gb|AAP21573.1| mastermind [Drosophila novamexicana] 35 1.8
gi|28830194|gb|AAO52645.1| similar to Homo sapiens (Human). HIWI... 35 1.8
gi|31201985|ref|XP_309940.1| ENSANGP00000025270 [Anopheles gambi... 35 1.8
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD... 35 1.8
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens] 35 1.8
gi|21224806|ref|NP_630585.1| hypothetical protein SC1E6.12 [Stre... 35 1.8
gi|49078064|ref|XP_402822.1| hypothetical protein UM05207.1 [Ust... 35 1.8
gi|45201188|ref|NP_986758.1| AGR093Wp [Eremothecium gossypii] >g... 35 1.8
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 35 1.8
gi|24642197|ref|NP_573033.1| CG6324-PA [Drosophila melanogaster]... 35 1.8
gi|39585885|emb|CAE61299.1| Hypothetical protein CBG05125 [Caeno... 35 2.3
gi|47221067|emb|CAG12761.1| unnamed protein product [Tetraodon n... 35 2.3
gi|31204169|ref|XP_311033.1| ENSANGP00000019942 [Anopheles gambi... 35 2.3
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 35 2.3
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 35 2.3
gi|46227721|gb|EAK88641.1| eIF4G eukaryotic initiation factor 4,... 35 2.3
gi|1813688|gb|AAC47626.1| unknown [Brugia malayi] >gnl|BL_ORD_ID... 35 2.3
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (... 35 2.3
gi|46228478|gb|EAK89348.1| hypothetical protein with glutamine r... 35 2.3
gi|31201295|ref|XP_309595.1| ENSANGP00000010937 [Anopheles gambi... 35 2.3
gi|50551841|ref|XP_503395.1| hypothetical protein [Yarrowia lipo... 35 2.3
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm... 35 2.3
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 35 2.3
gi|42627815|tpe|CAE00399.1| TPA: putative ISG12(b2) protein [Mus... 35 3.0
gi|22750435|gb|AAN05465.1| polygalacturonase [Phytophthora cinna... 35 3.0
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ... 35 3.0
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g... 35 3.0
gi|24643303|ref|NP_608321.1| CG14204-PA [Drosophila melanogaster... 35 3.0
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster... 35 3.0
gi|27526238|emb|CAC82378.1| Lasp protein [Drosophila melanogaster] 35 3.0
gi|30424814|ref|NP_780402.1| golgi phosphoprotein 4 [Mus musculu... 35 3.0
gi|49069194|ref|XP_398886.1| hypothetical protein UM01271.1 [Ust... 35 3.0
gi|2623347|gb|AAC53431.1| sex determining protein [Mus musculus ... 35 3.0
gi|50547723|ref|XP_501331.1| hypothetical protein [Yarrowia lipo... 35 3.0
gi|45198327|ref|NP_985356.1| AFL194Wp [Eremothecium gossypii] >g... 35 3.0
gi|24640804|ref|NP_572555.1| CG17440-PA [Drosophila melanogaster... 35 3.0
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno... 35 3.0
gi|7503942|pir||T32448 hypothetical protein F52D1.3 - Caenorhabd... 34 3.9
gi|21703896|ref|NP_663424.1| ISG12 [Mus musculus] >gnl|BL_ORD_ID... 34 3.9
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc... 34 3.9
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 34 3.9
gi|39595798|emb|CAE67301.1| Hypothetical protein CBG12754 [Caeno... 34 3.9
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 34 3.9
gi|50308049|ref|XP_454025.1| unnamed protein product [Kluyveromy... 34 3.9
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [... 34 3.9
gi|47212911|emb|CAF93289.1| unnamed protein product [Tetraodon n... 34 3.9
gi|33865506|ref|NP_897065.1| conserved hypothetical protein [Syn... 34 3.9
gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ... 34 3.9
gi|50306605|ref|XP_453276.1| unnamed protein product [Kluyveromy... 34 3.9
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 34 3.9
gi|17567981|ref|NP_508104.1| prion-like Q/N-rich domain protein ... 34 3.9
gi|49523567|emb|CAF18245.1| STYLOSA protein [Antirrhinum majus] 34 3.9
gi|29376109|ref|NP_815263.1| LysM domain protein [Enterococcus f... 34 3.9
gi|24584891|ref|NP_724079.1| CG5674-PC [Drosophila melanogaster]... 34 5.1
gi|46229643|gb|EAK90461.1| large uncharacterized low complexity ... 34 5.1
gi|50420129|ref|XP_458597.1| unnamed protein product [Debaryomyc... 34 5.1
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 34 5.1
gi|39579838|emb|CAE56847.1| Hypothetical protein CBG24674 [Caeno... 34 5.1
gi|21428884|gb|AAM50161.1| GH12467p [Drosophila melanogaster] 34 5.1
gi|50423235|ref|XP_460198.1| unnamed protein product [Debaryomyc... 34 5.1
gi|21430672|gb|AAM51014.1| RE65163p [Drosophila melanogaster] 34 5.1
gi|24653358|ref|NP_610871.1| CG4744-PA [Drosophila melanogaster]... 34 5.1
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [... 34 5.1
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr... 34 5.1
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo... 34 5.1
gi|28574249|ref|NP_609856.4| CG5674-PA [Drosophila melanogaster]... 34 5.1
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno... 34 5.1
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 34 5.1
gi|50312523|ref|XP_456297.1| unnamed protein product [Kluyveromy... 34 5.1
gi|33332347|gb|AAQ11380.1| hepatocyte nuclear factor 1 [Branchio... 33 6.7
gi|1705860|sp|P51804|CICL_RABIT Chloride channel protein CLC-K2 ... 33 6.7
gi|50255862|gb|EAL18593.1| hypothetical protein CNBJ0190 [Crypto... 33 6.7
gi|37544663|gb|AAN10184.1| hepatocyte nuclear factor 1 [Branchio... 33 6.7
gi|6322796|ref|NP_012869.1| RNAPII degradation factor, forms a c... 33 6.7
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo... 33 6.7
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 33 6.7
gi|29290086|gb|AAO67558.1| Gag protein [Drosophila virilis] >gnl... 33 6.7
gi|24461867|gb|AAN62354.1| CTV.22 [Poncirus trifoliata] 33 6.7
gi|1705858|sp|P51803|CICK_RABIT Chloride channel protein CLC-K1 ... 33 6.7
gi|31210231|ref|XP_314082.1| ENSANGP00000010404 [Anopheles gambi... 33 6.7
gi|24653867|ref|NP_611040.1| CG12964-PA [Drosophila melanogaster... 33 6.7
gi|37720825|gb|AAN52160.1| hairy and enhancer of split [Helobdel... 33 6.7
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40 33 6.7
gi|23613090|ref|NP_703412.1| hypothetical protein [Plasmodium fa... 33 6.7
gi|32413653|ref|XP_327306.1| hypothetical protein [Neurospora cr... 33 6.7
gi|28828091|gb|AAO50774.1| similar to Homo sapiens (Human). Simi... 33 6.7
gi|12842799|dbj|BAB25736.1| unnamed protein product [Mus musculus] 33 6.7
gi|39597300|emb|CAE59528.1| Hypothetical protein CBG02923 [Caeno... 33 6.7
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab... 33 6.7
gi|32403194|ref|XP_322210.1| predicted protein [Neurospora crass... 33 6.7
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ... 33 6.7
gi|416785|sp|Q01522|CF23_DROME Chorion transcription factor Cf2,... 33 8.8
gi|542553|pir||C36901 chorion transcription factor CF2-III (alte... 33 8.8
gi|542552|pir||B36901 chorion transcription factor CF2-II (alter... 33 8.8
gi|24660935|ref|NP_648226.2| CG7015-PA [Drosophila melanogaster]... 33 8.8
gi|38086517|ref|XP_141978.4| similar to gene_id:K5K13.11~unknown... 33 8.8
gi|37531244|ref|NP_919924.1| unknown protein [Oryza sativa (japo... 33 8.8
gi|6677817|ref|NP_033126.1| repetin [Mus musculus] >gnl|BL_ORD_I... 33 8.8
gi|542551|pir||A36901 chorion transcription factor CF2-I (altern... 33 8.8
gi|416786|sp|P20385|CF2_DROME Chorion transcription factor Cf2, ... 33 8.8
gi|38100119|gb|EAA47294.1| hypothetical protein MG02537.4 [Magna... 33 8.8
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi... 33 8.8
gi|290214|gb|AAA28395.1| DNA-binding protein isoform II 33 8.8
gi|32417498|ref|XP_329227.1| hypothetical protein ( (AL442164) h... 33 8.8
gi|38109765|gb|EAA55584.1| hypothetical protein MG01235.4 [Magna... 33 8.8
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid... 33 8.8
gi|19921116|ref|NP_609448.1| CG12299-PA [Drosophila melanogaster... 33 8.8
gi|23510183|ref|NP_702849.1| hypothetical protein [Plasmodium fa... 33 8.8
gi|25465920|pir||T52522 hypothetical protein B2J23.180 [imported... 33 8.8
gi|46432316|gb|EAK91804.1| hypothetical protein CaO19.3704 [Cand... 33 8.8
gi|47026413|gb|AAT08469.1| RE66582p [Drosophila melanogaster] 33 8.8
gi|50555840|ref|XP_505328.1| hypothetical protein [Yarrowia lipo... 33 8.8
gi|3334151|sp|O14427|CLA4_CANAL Serine/threonine-protein kinase ... 33 8.8
gi|50552996|ref|XP_503908.1| hypothetical protein [Yarrowia lipo... 33 8.8
gi|13878207|ref|NP_113559.1| testis expressed gene 16 [Mus muscu... 33 8.8
>gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT-3,
DumPY : shorter than wild-type DPY-15 (29.2 kD) (sqt-3)
[Caenorhabditis elegans]
gi|7499772|pir||T21314 hypothetical protein F23H12.4 -
Caenorhabditis elegans
gi|3876307|emb|CAA98942.1| Hypothetical protein F23H12.4
[Caenorhabditis elegans]
Length = 301
Score = 215 bits (548), Expect = 1e-54
Identities = 103/103 (100%), Positives = 103/103 (100%)
Frame = +1
Query: 1 METDGRLKAYKFVAYAAVGFSIAAVASVLLTLPMVYSYVSHVRQQMHHEINFCKGSAKDI 180
METDGRLKAYKFVAYAAVGFSIAAVASVLLTLPMVYSYVSHVRQQMHHEINFCKGSAKDI
Sbjct: 1 METDGRLKAYKFVAYAAVGFSIAAVASVLLTLPMVYSYVSHVRQQMHHEINFCKGSAKDI 60
Query: 181 FAEVNYMKANAGPVPPRNRTTRQAYGGPEVNPAPNLQCEGCCL 309
FAEVNYMKANAGPVPPRNRTTRQAYGGPEVNPAPNLQCEGCCL
Sbjct: 61 FAEVNYMKANAGPVPPRNRTTRQAYGGPEVNPAPNLQCEGCCL 103
Score = 55.1 bits (131), Expect = 2e-06
Identities = 23/23 (100%), Positives = 23/23 (100%)
Frame = +1
Query: 835 EKGICPKYCALDGGVFFEDGTRR 903
EKGICPKYCALDGGVFFEDGTRR
Sbjct: 279 EKGICPKYCALDGGVFFEDGTRR 301