Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F19B2_3
(435 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17559866|ref|NP_507886.1| putative protein family member of a... 291 1e-78
gi|17558242|ref|NP_507777.1| SNF2 related domain containing prot... 80 7e-15
gi|17562670|ref|NP_507782.1| SNF2 related domain containing prot... 78 3e-14
gi|32566893|ref|NP_872172.1| SNF2 related domain containing prot... 78 3e-14
gi|7505994|pir||T23701 hypothetical protein M04C3.2 - Caenorhabd... 73 1e-12
gi|32566824|ref|NP_507784.2| putative nuclear protein family mem... 73 1e-12
gi|7496498|pir||T19463 hypothetical protein C25F9.4 - Caenorhabd... 73 1e-12
gi|31043673|emb|CAB03922.3| Hypothetical protein C25F9.4 [Caenor... 73 1e-12
gi|32566826|ref|NP_507778.2| putative nuclear protein family mem... 73 1e-12
gi|17565672|ref|NP_507785.1| putative protein family member, wit... 64 8e-10
gi|50427483|ref|XP_462354.1| unnamed protein product [Debaryomyc... 58 5e-08
gi|34855513|ref|XP_215728.2| similar to transcription factor [Ra... 57 1e-07
gi|38086734|ref|XP_125439.2| similar to SWI/SNF related, matrix ... 55 3e-07
gi|34785644|gb|AAH57116.1| SWI/SNF related, matrix associated, a... 55 4e-07
gi|42409514|ref|NP_659208.1| SWI/SNF related, matrix associated,... 55 4e-07
gi|7106417|ref|NP_033236.1| SWI/SNF related, matrix associated, ... 55 4e-07
gi|1655930|gb|AAC18656.1| RUSH-1alpha [Oryctolagus cuniculus] 54 5e-07
gi|1655932|gb|AAC48693.1| RUSH-1beta [Oryctolagus cuniculus] 54 5e-07
gi|38106692|gb|EAA52966.1| hypothetical protein MG06094.4 [Magna... 53 1e-06
gi|50552109|ref|XP_503529.1| hypothetical protein [Yarrowia lipo... 52 2e-06
gi|49109447|ref|XP_411675.1| hypothetical protein AN7538.2 [Aspe... 52 3e-06
gi|1658307|emb|CAA86572.1| helicase-like transcription factor [H... 51 4e-06
gi|531196|gb|AAA67436.1| ATPase 51 4e-06
gi|16943790|emb|CAD10805.1| SWI/SNF related, matrix associated, ... 51 4e-06
gi|21071052|ref|NP_003062.2| SWI/SNF-related matrix-associated a... 51 4e-06
gi|1082438|pir||S49618 helicase-like transcription factor - huma... 51 4e-06
gi|27882409|gb|AAH44659.1| SMARCA3 protein [Homo sapiens] 51 4e-06
gi|10178052|dbj|BAB11535.1| helicase-like transcription factor-l... 51 6e-06
gi|22326612|ref|NP_196132.2| SNF2 domain-containing protein / he... 51 6e-06
gi|18310607|ref|NP_562541.1| SWI/SNF family helicase [Clostridiu... 50 1e-05
gi|32408243|ref|XP_324603.1| hypothetical protein [Neurospora cr... 50 1e-05
gi|19552388|ref|NP_600390.1| putative helicase [Corynebacterium ... 50 1e-05
gi|50557268|ref|XP_506042.1| hypothetical protein [Yarrowia lipo... 50 1e-05
gi|32407090|ref|XP_324143.1| hypothetical protein [Neurospora cr... 49 2e-05
gi|25465825|pir||T51892 hypothetical protein B23I11.40 [imported... 49 2e-05
gi|9632111|ref|NP_048904.1| similar to Caenorhabditis transcript... 49 2e-05
gi|38346175|emb|CAE04093.2| OSJNBa0096F01.2 [Oryza sativa (japon... 49 2e-05
gi|34904734|ref|NP_913714.1| helicase-like transcription factor-... 49 2e-05
gi|46128325|ref|XP_388716.1| hypothetical protein FG08540.1 [Gib... 49 2e-05
gi|46127169|ref|XP_388138.1| hypothetical protein FG07962.1 [Gib... 49 3e-05
gi|42561912|ref|NP_172577.2| SNF2 domain-containing protein / he... 49 3e-05
gi|25402644|pir||A86245 hypothetical protein [imported] - Arabid... 49 3e-05
gi|45509693|ref|ZP_00162026.1| COG0553: Superfamily II DNA/RNA h... 48 4e-05
gi|45184972|ref|NP_982690.1| AAR147Wp [Eremothecium gossypii] >g... 48 4e-05
gi|50304963|ref|XP_452439.1| unnamed protein product [Kluyveromy... 48 4e-05
gi|23124140|ref|ZP_00106150.1| COG0553: Superfamily II DNA/RNA h... 48 5e-05
gi|17540630|ref|NP_502137.1| SNF2 related domain and helicase, C... 48 5e-05
gi|25027819|ref|NP_737873.1| putative chromodomain helicase [Cor... 48 5e-05
gi|48097325|ref|XP_393754.1| similar to CG2684-PA [Apis mellifera] 48 5e-05
gi|15239896|ref|NP_199166.1| SNF2 domain-containing protein / he... 48 5e-05
gi|46443171|gb|EAL02455.1| hypothetical protein CaO19.10553 [Can... 47 6e-05
gi|32408661|ref|XP_324811.1| hypothetical protein [Neurospora cr... 47 6e-05
gi|32564642|ref|NP_871873.1| RNA polymerase II termination facto... 47 6e-05
gi|25141376|ref|NP_491854.2| SNF2 related domain and helicase, C... 47 6e-05
gi|7508346|pir||T28968 hypothetical protein T23H2.3 - Caenorhabd... 47 6e-05
gi|17231890|ref|NP_488438.1| SNF2 helicase homolog [Nostoc sp. P... 47 6e-05
gi|46123559|ref|XP_386333.1| hypothetical protein FG06157.1 [Gib... 47 8e-05
gi|46437717|gb|EAK97058.1| hypothetical protein CaO19.7401 [Cand... 47 8e-05
gi|19115158|ref|NP_594246.1| helicase; putative DNA repair prote... 47 1e-04
gi|39595329|emb|CAE60366.1| Hypothetical protein CBG03965 [Caeno... 46 1e-04
gi|33944265|ref|XP_340280.1| transcription activator, putative [... 46 1e-04
gi|38111185|gb|EAA56800.1| hypothetical protein MG07155.4 [Magna... 46 1e-04
gi|9627784|ref|NP_054071.1| global transactivator-like protein [... 46 1e-04
gi|50557192|ref|XP_506004.1| hypothetical protein [Yarrowia lipo... 46 1e-04
gi|38101894|gb|EAA48795.1| hypothetical protein MG00453.4 [Magna... 46 2e-04
gi|9630851|ref|NP_047448.1| GTA=Global Transactivator=AcMNPV orf... 46 2e-04
gi|47221989|emb|CAG08244.1| unnamed protein product [Tetraodon n... 45 2e-04
gi|41725682|ref|ZP_00152440.1| COG0553: Superfamily II DNA/RNA h... 45 2e-04
gi|23577840|ref|NP_703032.1| global transactivator [Rachiplusia ... 45 2e-04
gi|39596097|emb|CAE69733.1| Hypothetical protein CBG16004 [Caeno... 45 3e-04
gi|46137507|ref|XP_390445.1| conserved hypothetical protein [Gib... 45 3e-04
gi|31240303|ref|XP_320565.1| ENSANGP00000008692 [Anopheles gambi... 45 3e-04
gi|50419689|ref|XP_458372.1| unnamed protein product [Debaryomyc... 45 3e-04
gi|23490775|gb|EAA22469.1| DNA repair protein-like-related [Plas... 45 3e-04
gi|19704721|ref|NP_604283.1| SWF/SNF family helicase [Fusobacter... 45 4e-04
gi|46127691|ref|XP_388399.1| hypothetical protein FG08223.1 [Gib... 45 4e-04
gi|15217826|ref|NP_171767.1| DNA repair protein, putative [Arabi... 45 4e-04
gi|38109494|gb|EAA55357.1| hypothetical protein MG07014.4 [Magna... 45 4e-04
gi|48111472|ref|XP_396302.1| similar to ENSANGP00000014757 [Apis... 44 5e-04
gi|15242960|ref|NP_197667.1| SNF2 domain-containing protein / he... 44 5e-04
gi|25517999|pir||G86156 T14P4.5 protein - Arabidopsis thaliana >... 44 5e-04
gi|32412838|ref|XP_326899.1| hypothetical protein [Neurospora cr... 44 5e-04
gi|38566825|emb|CAE76132.1| related to helicase-DNA-binding prot... 44 5e-04
gi|49083872|ref|XP_404181.1| hypothetical protein AN0044.2 [Aspe... 44 0.001
gi|50751542|ref|XP_422446.1| PREDICTED: similar to putative reco... 44 0.001
gi|46434839|gb|EAK94239.1| hypothetical protein CaO19.5675 [Cand... 44 0.001
gi|1905887|gb|AAB54115.1| putative recombination factor GdRad54 ... 44 0.001
gi|39584767|emb|CAE67662.1| Hypothetical protein CBG13225 [Caeno... 44 0.001
gi|19111970|ref|NP_595178.1| rad16 nucleotide excision repair pr... 44 0.001
gi|46441365|gb|EAL00663.1| hypothetical protein CaO19.2097 [Cand... 43 0.001
gi|46138107|ref|XP_390744.1| hypothetical protein FG10568.1 [Gib... 43 0.001
gi|46446009|ref|YP_007374.1| putative rapA, a bacterial member o... 43 0.001
gi|32419258|ref|XP_330101.1| hypothetical protein [Neurospora cr... 43 0.001
gi|50288685|ref|XP_446772.1| unnamed protein product [Candida gl... 43 0.001
gi|46227356|gb|EAK88291.1| CHD3 ortholog with 2x chromodomains p... 43 0.001
gi|38105978|gb|EAA52340.1| hypothetical protein MG05032.4 [Magna... 43 0.002
gi|38104231|gb|EAA50830.1| hypothetical protein MG04589.4 [Magna... 43 0.002
gi|49086734|ref|XP_405392.1| hypothetical protein AN1255.2 [Aspe... 43 0.002
gi|50256686|gb|EAL19409.1| hypothetical protein CNBH1020 [Crypto... 42 0.002
gi|15898471|ref|NP_343076.1| Helicase of the snf2/rad54 family (... 42 0.002
gi|46121269|ref|XP_385189.1| hypothetical protein FG05013.1 [Gib... 42 0.003
gi|45187527|ref|NP_983750.1| ADL345Cp [Eremothecium gossypii] >g... 42 0.003
gi|32418794|ref|XP_329875.1| hypothetical protein [Neurospora cr... 42 0.003
gi|31234796|ref|XP_319118.1| ENSANGP00000022335 [Anopheles gambi... 42 0.003
gi|40807471|ref|NP_003585.3| transcription termination factor, R... 42 0.003
gi|5733122|gb|AAD49435.1| lodestar protein [Homo sapiens] 42 0.003
gi|3702846|gb|AAC64044.1| RNA polymerase II termination factor [... 42 0.003
gi|49077756|ref|XP_402701.1| hypothetical protein UM05086.1 [Ust... 42 0.003
gi|46123053|ref|XP_386080.1| hypothetical protein FG05904.1 [Gib... 42 0.003
gi|40215423|gb|AAR82736.1| SD21488p [Drosophila melanogaster] 42 0.003
gi|47122916|gb|AAH70581.1| MGC81081 protein [Xenopus laevis] 42 0.003
gi|20152037|gb|AAM11378.1| LD39323p [Drosophila melanogaster] 42 0.003
gi|17137266|ref|NP_477197.1| CG3733-PA [Drosophila melanogaster]... 42 0.003
gi|7511822|pir||T13944 chromodomain-helicase-DNA-binding protein... 42 0.003
gi|22299156|ref|NP_682403.1| ORF_ID:tlr1613~putative helicase [T... 42 0.003
gi|46443104|gb|EAL02388.1| hypothetical protein CaO19.10486 [Can... 42 0.003
gi|50729638|ref|XP_416595.1| PREDICTED: similar to transcription... 41 0.006
gi|24644932|ref|NP_524850.2| CG2684-PA [Drosophila melanogaster]... 41 0.006
gi|31211661|ref|XP_314800.1| ENSANGP00000011045 [Anopheles gambi... 41 0.006
gi|85049|pir||A40580 lodestar maternal-effect protein - fruit fl... 41 0.006
gi|50254945|gb|EAL17685.1| hypothetical protein CNBL2000 [Crypto... 41 0.006
gi|21392184|gb|AAM48446.1| RE70645p [Drosophila melanogaster] 41 0.006
gi|45198738|ref|NP_985767.1| AFR220Wp [Eremothecium gossypii] >g... 41 0.006
gi|50284977|ref|XP_444917.1| unnamed protein product [Candida gl... 41 0.006
gi|34859664|ref|XP_215670.2| similar to RNA polymerase II termin... 40 0.008
gi|15836368|ref|NP_300892.1| SWI/SNF family helicase_1 [Chlamydo... 40 0.008
gi|15618744|ref|NP_225030.1| SWI/SNF family helicase_1 [Chlamydo... 40 0.008
gi|17566484|ref|NP_507903.1| SNF2 related domain containing prot... 40 0.008
gi|25020799|ref|XP_207781.1| similar to RNA polymerase II termin... 40 0.008
gi|20875035|ref|XP_131118.1| transcription termination factor, R... 40 0.008
gi|30686918|ref|NP_850847.1| DNA-dependent ATPase, putative [Ara... 40 0.008
gi|46111685|ref|XP_382900.1| hypothetical protein FG02724.1 [Gib... 40 0.008
gi|30686915|ref|NP_568365.2| DNA-dependent ATPase, putative [Ara... 40 0.008
gi|38102523|gb|EAA49354.1| hypothetical protein MG01012.4 [Magna... 40 0.008
gi|46125449|ref|XP_387278.1| hypothetical protein FG07102.1 [Gib... 40 0.008
gi|49071866|ref|XP_400222.1| hypothetical protein UM02607.1 [Ust... 40 0.010
gi|19075231|ref|NP_587731.1| helicase with SNF2 domain [Schizosa... 40 0.010
gi|49097798|ref|XP_410359.1| hypothetical protein AN6222.2 [Aspe... 40 0.010
gi|49096640|ref|XP_409780.1| hypothetical protein AN5643.2 [Aspe... 40 0.010
gi|32405162|ref|XP_323194.1| hypothetical protein [Neurospora cr... 40 0.010
gi|34914698|ref|NP_918696.1| putative DNA-dependent ATPase [Oryz... 40 0.010
gi|6319722|ref|NP_009804.1| has strong homology to Drosophila IS... 40 0.013
gi|34907414|ref|NP_915054.1| putative chromodomain-helicase-DNA-... 40 0.013
gi|626929|pir||S46122 SNF2 protein homolog YBR245c - yeast (Sacc... 40 0.013
gi|50749410|ref|XP_421626.1| PREDICTED: similar to helicase, lym... 40 0.013
gi|49068248|ref|XP_398413.1| hypothetical protein UM00798.1 [Ust... 40 0.013
gi|19115879|ref|NP_594967.1| putative transcriptional regulator;... 40 0.013
gi|32473602|ref|NP_866596.1| helicase, Snf2 family [Pirellula sp... 40 0.013
gi|16805045|ref|NP_473074.1| DNA helicase, putative [Plasmodium ... 39 0.017
gi|50303981|ref|XP_451940.1| unnamed protein product [Kluyveromy... 39 0.017
gi|46435400|gb|EAK94782.1| hypothetical protein CaO19.4437 [Cand... 39 0.022
gi|12083522|gb|AAG48831.1| similar to Arabidopsis thaliana putat... 39 0.022
gi|47225441|emb|CAG11924.1| unnamed protein product [Tetraodon n... 39 0.022
gi|50509490|dbj|BAD31171.1| putative DNA repair protein rhp16 [O... 39 0.022
gi|7507133|pir||T28886 hypothetical protein T05A12.4 - Caenorhab... 39 0.022
gi|50257983|gb|EAL20677.1| hypothetical protein CNBE0430 [Crypto... 39 0.022
gi|50257984|gb|EAL20678.1| hypothetical protein CNBE0430 [Crypto... 39 0.022
gi|17542200|ref|NP_501060.1| SNF2 domain helicase RING finger do... 39 0.022
gi|47271158|gb|AAF98590.2| Hypothetical protein T05A12.4 [Caenor... 39 0.022
gi|46119555|ref|ZP_00176801.2| COG0553: Superfamily II DNA/RNA h... 39 0.029
gi|46397086|sp|O13682|YDY1_SCHPO Hypothetical helicase C11E3.01c... 39 0.029
gi|23619365|ref|NP_705327.1| DNA helicase, putative [Plasmodium ... 39 0.029
gi|31043816|emb|CAA88960.2| Hypothetical protein M03C11.8 [Caeno... 39 0.029
gi|50311677|ref|XP_455865.1| unnamed protein product [Kluyveromy... 39 0.029
gi|15320696|ref|NP_203208.1| GTA [Epiphyas postvittana nucleopol... 39 0.029
gi|29840686|ref|NP_829792.1| helicase, Snf2/Rad54 family [Chlamy... 39 0.029
gi|29348762|ref|NP_812265.1| Snf2 family helicase [Bacteroides t... 39 0.029
gi|32475836|ref|NP_868830.1| probable swi/snf family helicase 2 ... 39 0.029
gi|39591892|emb|CAE71470.1| Hypothetical protein CBG18388 [Caeno... 39 0.029
gi|17554270|ref|NP_499301.1| SNF2 related domain and helicase, C... 39 0.029
gi|48894083|ref|ZP_00327281.1| COG0553: Superfamily II DNA/RNA h... 38 0.038
gi|2388586|gb|AAB71467.1| Similar to Saccharomyces RAD16 (gb|X78... 38 0.038
gi|46136625|ref|XP_390004.1| hypothetical protein FG09828.1 [Gib... 38 0.038
gi|23485366|gb|EAA20388.1| Arabidopsis thaliana BRAHMA ortholog-... 38 0.038
gi|49096320|ref|XP_409620.1| hypothetical protein AN5483.2 [Aspe... 38 0.038
gi|48763750|ref|ZP_00268304.1| COG0553: Superfamily II DNA/RNA h... 38 0.038
gi|15220993|ref|NP_172004.1| SNF2 domain-containing protein / he... 38 0.038
gi|6437558|gb|AAF08585.1| putative ATPase (ISW2-like) [Arabidops... 38 0.038
gi|49134234|ref|XP_413214.1| hypothetical protein AN9077.2 [Aspe... 38 0.038
gi|20259462|gb|AAM13851.1| putative ATPase (ISW2) [Arabidopsis t... 38 0.038
gi|22330875|ref|NP_187291.2| DNA-dependent ATPase, putative [Ara... 38 0.038
gi|37651342|ref|NP_932651.1| global transactivator-like protein ... 38 0.038
gi|47777671|gb|AAT38113.1| RAD54-like (S. cerevisiae) [Homo sapi... 38 0.038
gi|4506397|ref|NP_003570.1| RAD54-like protein; RAD54 homolog; R... 38 0.038
gi|32404678|ref|XP_322952.1| hypothetical protein ( (AL451013) p... 38 0.038
gi|45935136|gb|AAS79594.1| putative DNA repair protein [Ipomoea ... 38 0.050
gi|50746413|ref|XP_420485.1| PREDICTED: similar to hypothetical ... 38 0.050
gi|15835457|ref|NP_297216.1| helicase, Snf2 family [Chlamydia mu... 38 0.050
gi|47217489|emb|CAG10869.1| unnamed protein product [Tetraodon n... 38 0.050
gi|257212|gb|AAB23590.1| nucleotide-binding protein with zinc-fi... 38 0.050
gi|6323060|ref|NP_013132.1| Single-stranded DNA-dependent ATPase... 38 0.050
gi|25404310|pir||C96637 hypothetical protein F11P17.13 [imported... 37 0.065
gi|46137317|ref|XP_390350.1| hypothetical protein FG10174.1 [Gib... 37 0.065
gi|15605284|ref|NP_220070.1| SWI/SNF family helicase [Chlamydia ... 37 0.065
gi|32398963|emb|CAD98428.1| SNF2 helicase, possible [Cryptospori... 37 0.065
gi|46126713|ref|XP_387910.1| hypothetical protein FG07734.1 [Gib... 37 0.065
gi|15219872|ref|NP_176309.1| SNF2 domain-containing protein / he... 37 0.065
gi|45524679|ref|ZP_00175949.1| COG0553: Superfamily II DNA/RNA h... 37 0.065
gi|19113394|ref|NP_596602.1| SNF2 family dna repair protein by s... 37 0.085
gi|32411361|ref|XP_326161.1| hypothetical protein [Neurospora cr... 37 0.085
gi|25406739|pir||H86167 hypothetical protein [imported] - Arabid... 37 0.085
gi|19114237|ref|NP_593325.1| putative helicase [Schizosaccharomy... 37 0.085
gi|39594011|emb|CAE70121.1| Hypothetical protein CBG16574 [Caeno... 37 0.085
gi|42561667|ref|NP_171871.2| helicase, putative [Arabidopsis tha... 37 0.085
gi|47225443|emb|CAG11926.1| unnamed protein product [Tetraodon n... 37 0.085
gi|6319590|ref|NP_009672.1| Protein that recognizes and binds da... 37 0.085
gi|50420537|ref|XP_458805.1| unnamed protein product [Debaryomyc... 37 0.085
gi|40882196|emb|CAF06022.1| related to regulator of chromatin [N... 37 0.085
gi|6474545|dbj|BAA87269.1| Hypothetical nuclear protein [Schizos... 37 0.085
gi|16767854|gb|AAL28145.1| GH01406p [Drosophila melanogaster] 37 0.11
gi|24583161|ref|NP_609320.2| CG5899-PA [Drosophila melanogaster]... 37 0.11
gi|16332119|ref|NP_442847.1| helicase of the snf2/rad54 family [... 37 0.11
gi|32416406|ref|XP_328681.1| hypothetical protein [Neurospora cr... 37 0.11
gi|19173311|ref|NP_597114.1| GLOBAL TRANSCRIPTIONAL ACTIVATOR (S... 37 0.11
gi|50555271|ref|XP_505044.1| hypothetical protein [Yarrowia lipo... 37 0.11
gi|46432408|gb|EAK91891.1| hypothetical protein CaO19.13670 [Can... 37 0.11
gi|30683833|ref|NP_850117.1| chromatin remodeling protein, putat... 36 0.14
gi|20197603|gb|AAD29835.2| putative SNF2 subfamily transcription... 36 0.14
gi|50259922|gb|EAL22590.1| hypothetical protein CNBB4670 [Crypto... 36 0.14
gi|49388292|dbj|BAD25407.1| putative DNA repair protein rad8 [Or... 36 0.14
gi|25407972|pir||A84683 probable SNF2 subfamily transcription re... 36 0.14
gi|50308703|ref|XP_454355.1| unnamed protein product [Kluyveromy... 36 0.14
gi|6321289|ref|NP_011365.1| ATPase that forms a large complex, c... 36 0.14
gi|23106552|ref|ZP_00092993.1| COG0553: Superfamily II DNA/RNA h... 36 0.14
gi|46137411|ref|XP_390397.1| hypothetical protein FG10221.1 [Gib... 36 0.14
gi|38102212|gb|EAA49078.1| hypothetical protein MG00736.4 [Magna... 36 0.14
gi|49089418|ref|XP_406422.1| hypothetical protein AN2285.2 [Aspe... 36 0.14
gi|13603721|gb|AAK31908.1| putative chromatin remodeling protein... 36 0.14
gi|30683830|ref|NP_850116.1| chromatin remodeling protein, putat... 36 0.14
gi|30840950|gb|AAL29689.1| Snf2-related chromatin remodeling fac... 36 0.14
gi|32420105|ref|XP_330496.1| hypothetical protein [Neurospora cr... 36 0.14
gi|23101871|ref|ZP_00088417.1| COG0553: Superfamily II DNA/RNA h... 36 0.14
gi|1078857|pir||S44645 hypothetical protein F37A4.8 - Caenorhabd... 36 0.19
gi|48137452|ref|XP_393364.1| similar to SD21488p [Apis mellifera] 36 0.19
gi|29248597|gb|EAA40127.1| GLP_80_35531_39634 [Giardia lamblia A... 36 0.19
gi|49073508|ref|XP_400967.1| hypothetical protein UM03352.1 [Ust... 36 0.19
gi|25144179|ref|NP_498468.2| yeast Imitation SWI homolog (116.7 ... 36 0.19
gi|50426663|ref|XP_461929.1| unnamed protein product [Debaryomyc... 36 0.19
gi|24644930|ref|NP_649751.1| CG10445-PA [Drosophila melanogaster... 35 0.25
gi|39585279|emb|CAE57522.1| Hypothetical protein CBG00497 [Caeno... 35 0.25
gi|49067793|ref|XP_398186.1| hypothetical protein UM00571.1 [Ust... 35 0.25
gi|50424047|ref|XP_460608.1| unnamed protein product [Debaryomyc... 35 0.32
gi|19114529|ref|NP_593617.1| SNF2 family helicase [Schizosacchar... 35 0.42
gi|46228591|gb|EAK89461.1| SNF2L ortholog with a SWI/SNF2 like A... 35 0.42
gi|32406370|ref|XP_323798.1| hypothetical protein [Neurospora cr... 35 0.42
gi|23509180|ref|NP_701848.1| DNA repair protein rhp16, putative ... 35 0.42
gi|50255283|gb|EAL18018.1| hypothetical protein CNBK0390 [Crypto... 35 0.42
gi|40882176|emb|CAF06002.1| related to protein RIS1 [Neurospora ... 35 0.42
gi|28278128|gb|AAH45534.1| Hypothetical protein DKFZp762K2015 [H... 34 0.55
gi|38181513|gb|AAH61495.1| Unknown (protein for MGC:70257) [Mus ... 34 0.55
gi|42742173|ref|NP_116696.2| Hypothetical ORF; Yfr038wp [Sacchar... 34 0.55
gi|49077958|ref|XP_402781.1| hypothetical protein UM05166.1 [Ust... 34 0.55
gi|50748161|ref|XP_421134.1| PREDICTED: similar to hypothetical ... 34 0.55
gi|37590263|gb|AAH59235.1| 4632409L19Rik protein [Mus musculus] 34 0.55
gi|26333853|dbj|BAC30644.1| unnamed protein product [Mus musculus] 34 0.55
gi|33469139|ref|NP_115572.2| yeast INO80-like protein [Homo sapi... 34 0.55
gi|6329728|dbj|BAA86436.1| KIAA1122 protein [Homo sapiens] 34 0.55
gi|39593464|emb|CAE61756.1| Hypothetical protein CBG05712 [Caeno... 34 0.55
gi|728695|emb|CAA88537.1| DNA helicase type protein [Saccharomyc... 34 0.55
gi|6330933|dbj|BAA86573.1| KIAA1259 protein [Homo sapiens] 34 0.55
gi|14149730|ref|NP_064544.1| hypothetical protein DKFZp762K2015 ... 34 0.55
gi|8977885|emb|CAB95769.1| hypothetical protein [Homo sapiens] 34 0.55
gi|47219154|emb|CAG01817.1| unnamed protein product [Tetraodon n... 34 0.55
gi|1176015|sp|P43610|YFK8_YEAST Hypothetical 88.7 kDa helicase i... 34 0.55
gi|37360298|dbj|BAC98127.1| mKIAA1259 protein [Mus musculus] 34 0.55
gi|38075621|ref|XP_355376.1| RIKEN cDNA 4632409L19 [Mus musculus] 34 0.55
gi|50286955|ref|XP_445907.1| unnamed protein product [Candida gl... 34 0.72
gi|17556709|ref|NP_499653.1| prion-like Q/N-rich domain protein ... 34 0.72
gi|29427670|sp|Q04692|SRD1_MOUSE SWI/SNF-related, matrix associa... 34 0.72
gi|24373219|ref|NP_717262.1| Snf2 family protein [Shewanella one... 34 0.72
gi|14042204|dbj|BAB55150.1| unnamed protein product [Homo sapiens] 34 0.72
gi|50470843|emb|CAC35851.2| Hypothetical protein Y111B2A.22 [Cae... 34 0.72
gi|30019888|ref|NP_831519.1| SWF/SNF family helicase [Bacillus c... 34 0.72
gi|45451721|gb|AAS65429.1| Swi/Snf family ATPase [Caenorhabditis... 34 0.72
gi|38084222|ref|XP_132597.2| SWI/SNF-related, matrix-associated ... 34 0.72
gi|34855956|ref|XP_231860.2| similar to mKIAA1122 protein [Rattu... 34 0.72
gi|27502706|gb|AAH42442.1| Smarcad1 protein [Mus musculus] 34 0.72
gi|1083308|pir||A56559 enhancer-trap-locus-1 protein - mouse (fr... 34 0.72
gi|46110288|ref|XP_382202.1| hypothetical protein FG02026.1 [Gib... 34 0.72
gi|28972640|dbj|BAC65736.1| mKIAA1122 protein [Mus musculus] 34 0.72
gi|19115891|ref|NP_594979.1| putative helicase [Schizosaccharomy... 34 0.72
gi|23481513|gb|EAA17769.1| Arabidopsis thaliana BRAHMA ortholog ... 34 0.72
gi|38109213|gb|EAA55119.1| hypothetical protein MG06776.4 [Magna... 33 0.94
gi|46122747|ref|XP_385927.1| hypothetical protein FG05751.1 [Gib... 33 0.94
gi|9964581|ref|NP_064770.1| internalin [Amsacta moorei entomopox... 33 0.94
gi|28631398|gb|AAO49696.1| similar to Plasmodium falciparum (iso... 33 0.94
gi|32404476|ref|XP_322851.1| hypothetical protein [Neurospora cr... 33 0.94
gi|50787965|ref|XP_423518.1| PREDICTED: similar to Smarcad1 prot... 33 0.94
gi|47213833|emb|CAG00637.1| unnamed protein product [Tetraodon n... 33 0.94
gi|32404682|ref|XP_322954.1| hypothetical protein ( (AL451013) c... 33 0.94
gi|32563629|ref|NP_491994.2| chromo domain and SNF2 related doma... 33 1.2
gi|31216396|ref|XP_316223.1| ENSANGP00000017802 [Anopheles gambi... 33 1.2
gi|38099998|gb|EAA47222.1| hypothetical protein MG11047.4 [Magna... 33 1.2
gi|15289872|dbj|BAB63568.1| putative helicase-like transcription... 33 1.2
gi|50427841|ref|XP_462533.1| unnamed protein product [Debaryomyc... 33 1.2
gi|46431413|gb|EAK90982.1| hypothetical protein CaO19.9302 [Cand... 33 1.2
gi|30387275|ref|NP_848354.1| global transactivator [Choristoneur... 33 1.2
gi|7504867|pir||T23056 hypothetical protein H06O01.2 - Caenorhab... 33 1.2
gi|38567839|emb|CAE05788.2| OSJNBb0020J19.17 [Oryza sativa (japo... 33 1.2
gi|47211681|emb|CAF92845.1| unnamed protein product [Tetraodon n... 33 1.2
gi|45187775|ref|NP_983998.1| ADL098Cp [Eremothecium gossypii] >g... 33 1.2
gi|47206405|emb|CAG01534.1| unnamed protein product [Tetraodon n... 33 1.6
gi|4557449|ref|NP_001262.1| chromodomain helicase DNA binding pr... 33 1.6
gi|38110738|gb|EAA56417.1| hypothetical protein MG06388.4 [Magna... 33 1.6
gi|32411725|ref|XP_326343.1| hypothetical protein [Neurospora cr... 33 1.6
gi|50742491|ref|XP_419651.1| PREDICTED: similar to SNF2 histone ... 33 1.6
gi|34857217|ref|XP_218790.2| similar to Chromodomain-helicase-DN... 33 1.6
gi|34859306|ref|XP_341933.1| similar to Snf2-related CBP activat... 33 1.6
gi|34327954|dbj|BAA20768.2| KIAA0309 [Homo sapiens] 33 1.6
gi|38108120|gb|EAA54198.1| hypothetical protein MG02183.4 [Magna... 33 1.6
gi|34535199|dbj|BAC87237.1| unnamed protein product [Homo sapiens] 33 1.6
gi|5730067|ref|NP_006653.1| Snf2-related CBP activator protein [... 33 1.6
gi|49089344|ref|XP_406393.1| hypothetical protein AN2256.2 [Aspe... 33 1.6
gi|38088971|ref|XP_356054.1| similar to Chromodomain-helicase-DN... 33 1.6
gi|48731334|ref|ZP_00265079.1| COG0187: Type IIA topoisomerase (... 32 2.1
gi|46121223|ref|XP_385166.1| hypothetical protein FG04990.1 [Gib... 32 2.1
gi|47209419|emb|CAF93109.1| unnamed protein product [Tetraodon n... 32 2.1
gi|48137091|ref|XP_396786.1| similar to ENSANGP00000017802 [Apis... 32 2.1
gi|46126071|ref|XP_387589.1| hypothetical protein FG07413.1 [Gib... 32 2.1
gi|50549907|ref|XP_502425.1| hypothetical protein [Yarrowia lipo... 32 2.7
gi|50312039|ref|XP_456051.1| unnamed protein product [Kluyveromy... 32 2.7
gi|1008986|emb|CAA91094.1| rad8 [Schizosaccharomyces pombe] 32 2.7
gi|11357327|pir||T45808 helicase-like protein - Arabidopsis thal... 32 2.7
gi|5917757|gb|AAD56025.1| chromodomain helicase DNA binding prot... 32 2.7
gi|5917754|gb|AAD56022.1| chromodomain helicase DNA binding prot... 32 2.7
gi|50761329|ref|XP_429117.1| PREDICTED: similar to chromodomain ... 32 2.7
gi|30694618|ref|NP_191289.2| transcriptional activator, putative... 32 2.7
gi|45201475|ref|NP_987045.1| AGR379Wp [Eremothecium gossypii] >g... 32 2.7
gi|47565536|ref|ZP_00236577.1| Snf2 family protein [Bacillus cer... 32 2.7
gi|42780946|ref|NP_978193.1| helicase, putative [Bacillus cereus... 32 2.7
gi|30261851|ref|NP_844228.1| helicase, putative [Bacillus anthra... 32 2.7
gi|49481102|ref|YP_035985.1| helicase, SWF/SNF family [Bacillus ... 32 2.7
gi|49073298|ref|XP_400878.1| hypothetical protein UM03263.1 [Ust... 32 2.7
gi|38093967|ref|XP_356271.1| similar to RIKEN cDNA 1700001F09 [M... 32 2.7
gi|548669|sp|P36607|RAD8_SCHPO DNA repair protein rad8 >gnl|BL_O... 32 2.7
gi|28975395|gb|AAO61783.1| chromo-helicase DNA-binding protein [... 32 2.7
gi|3320448|gb|AAC41378.1| chromo-helicase-DNA-binding protein [S... 32 2.7
gi|34854132|ref|XP_238731.2| similar to Chromodomain-helicase-DN... 32 3.6
gi|47211143|emb|CAF96563.1| unnamed protein product [Tetraodon n... 32 3.6
gi|28975391|gb|AAO61781.1| chromo-helicase DNA-binding protein [... 32 3.6
gi|50258657|gb|EAL21342.1| hypothetical protein CNBD0390 [Crypto... 32 3.6
gi|26340418|dbj|BAC33872.1| unnamed protein product [Mus musculus] 32 3.6
gi|38567914|emb|CAD41578.3| OSJNBa0088I22.10 [Oryza sativa (japo... 32 3.6
gi|15231009|ref|NP_188635.1| SNF2 domain-containing protein / he... 32 3.6
gi|5917753|gb|AAD56021.1| chromodomain helicase DNA binding prot... 32 3.6
gi|5917756|gb|AAD56024.1| chromodomain helicase DNA binding prot... 32 3.6
gi|4557447|ref|NP_001261.1| chromodomain helicase DNA binding pr... 32 3.6
gi|1769947|emb|CAA67095.1| SNF [Bacillus cereus] 32 3.6
gi|39583607|emb|CAE65711.1| Hypothetical protein CBG10790 [Caeno... 32 3.6
gi|6680928|ref|NP_031716.1| chromodomain helicase DNA binding pr... 32 3.6
gi|476961|pir||A47392 chromodomain-helicase-DNA-binding protein,... 32 3.6
gi|45188182|ref|NP_984405.1| ADR309Wp [Eremothecium gossypii] >g... 32 3.6
gi|50552610|ref|XP_503715.1| hypothetical protein [Yarrowia lipo... 31 4.6
gi|11994423|dbj|BAB02425.1| helicase-like protein [Arabidopsis t... 31 4.6
gi|23469355|ref|ZP_00124689.1| COG0187: Type IIA topoisomerase (... 31 4.6
gi|41052809|dbj|BAD07677.1| putative photoperiod independent ear... 31 4.6
gi|23612323|ref|NP_703903.1| iswi protein homologue [Plasmodium ... 31 4.6
gi|50287847|ref|XP_446353.1| unnamed protein product [Candida gl... 31 4.6
gi|42564102|ref|NP_187887.3| SNF2 domain-containing protein / he... 31 4.6
gi|47209153|emb|CAF89893.1| unnamed protein product [Tetraodon n... 31 4.6
gi|23481408|gb|EAA17695.1| SNF2 family N-terminal domain, putati... 31 6.1
gi|478992|pir||S32349 probable SNF2-type helicase - Bacillus cer... 31 6.1
gi|23481248|gb|EAA17582.1| similar nucleotide excision repair pr... 31 6.1
gi|28867247|ref|NP_789866.1| DNA gyrase, subunit B [Pseudomonas ... 31 6.1
gi|6320541|ref|NP_010621.1| Swi2/Snf2-related ATPase, component ... 31 6.1
gi|19032404|gb|AAL83420.1| cytochrome b [Trichosurus vulpecula] 31 6.1
gi|15079200|ref|NP_149943.1| cytochrome b [Trichosurus vulpecula... 31 6.1
gi|30912849|sp|Q8SEJ1|CYB_TRICS Cytochrome b >gnl|BL_ORD_ID|1626... 31 6.1
gi|11270953|pir||T46555 DNA topoisomerase (ATP-hydrolyzing) (EC ... 31 6.1
gi|3287808|sp|O03503|CYB_TRIVU Cytochrome b >gnl|BL_ORD_ID|13648... 31 6.1
gi|15893304|ref|NP_346653.1| DNA gyrase (topoisomerase II) B sub... 31 6.1
gi|19032410|gb|AAL83423.1| cytochrome b [Trichosurus caninus] 31 6.1
gi|19032412|gb|AAL83424.1| cytochrome b [Trichosurus caninus] 31 6.1
gi|38087117|ref|XP_141851.2| similar to Ott protein [Mus musculus] 31 6.1
gi|33146658|dbj|BAC80004.1| SNF2/SWI2 family transcription facto... 31 6.1
gi|15615476|ref|NP_243779.1| SNF2 helicase [Bacillus halodurans ... 31 6.1
gi|1041862|gb|AAA99760.1| cytochrome b light strand 31 6.1
gi|1041864|gb|AAA99761.1| cytochrome b light strand 31 6.1
gi|33414079|gb|AAQ17634.1| TraY [Escherichia coli] 31 6.1
gi|26986758|ref|NP_742183.1| DNA gyrase, subunit B [Pseudomonas ... 31 6.1
gi|121893|sp|P13364|GYRB_PSEPU DNA gyrase subunit B >gnl|BL_ORD_... 31 6.1
gi|27819922|gb|AAL39744.2| LD35220p [Drosophila melanogaster] 30 7.9
gi|31198947|ref|XP_308421.1| ENSANGP00000019059 [Anopheles gambi... 30 7.9
gi|23104602|ref|ZP_00091064.1| COG0187: Type IIA topoisomerase (... 30 7.9
gi|3329473|gb|AAC26857.1| RAD54 DNA repair protein [Drosophila m... 30 7.9
gi|34857610|ref|XP_230473.2| similar to KIAA1259 protein [Rattus... 30 7.9
gi|13812265|ref|NP_113336.1| DNA gyrase subunit B [Guillardia th... 30 7.9
gi|42519128|ref|NP_965058.1| hypothetical protein LJ1203 [Lactob... 30 7.9
gi|47214961|emb|CAG10783.1| unnamed protein product [Tetraodon n... 30 7.9
gi|42659960|ref|XP_374983.1| KIAA0748 gene product [Homo sapiens] 30 7.9
gi|34896816|ref|NP_909752.1| putative NBS-LRR type resistance pr... 30 7.9
gi|33152113|ref|NP_873466.1| possible chromosome partitioning re... 30 7.9
gi|42565176|ref|NP_189149.2| expressed protein [Arabidopsis thal... 30 7.9
gi|5835050|ref|NP_007107.1|CYTB_10470 cytochrome b [Didelphis vi... 30 7.9
gi|49087560|ref|XP_405702.1| hypothetical protein AN1565.2 [Aspe... 30 7.9
gi|46140603|ref|ZP_00152192.2| COG0187: Type IIA topoisomerase (... 30 7.9
gi|13236187|gb|AAK16082.1| NgrC [Photorhabdus luminescens] 30 7.9
gi|50260975|gb|EAL23625.1| hypothetical protein CNBA2720 [Crypto... 30 7.9
gi|40788349|dbj|BAA34468.2| KIAA0748 protein [Homo sapiens] 30 7.9
gi|5917755|gb|AAD56023.1| chromodomain helicase DNA binding prot... 30 7.9
gi|17136368|ref|NP_476661.1| CG3736-PA [Drosophila melanogaster]... 30 7.9
gi|1765914|emb|CAA71278.1| RAD54 [Drosophila melanogaster] 30 7.9
>gi|17559866|ref|NP_507886.1| putative protein family member of
ancient origin (16.7 kD) (5U632) [Caenorhabditis
elegans]
gi|7499401|pir||T21100 hypothetical protein F19B2.5 -
Caenorhabditis elegans
gi|4008349|emb|CAA16269.1| Hypothetical protein F19B2.5
[Caenorhabditis elegans]
Length = 144
Score = 291 bits (746), Expect = 1e-78
Identities = 144/144 (100%), Positives = 144/144 (100%)
Frame = -1
Query: 435 MQKINDAGELAKHSVVVTTFDTIKTLMNFQTLQKISFERIIIYDAYPIDNTDTQRYKALR 256
MQKINDAGELAKHSVVVTTFDTIKTLMNFQTLQKISFERIIIYDAYPIDNTDTQRYKALR
Sbjct: 1 MQKINDAGELAKHSVVVTTFDTIKTLMNFQTLQKISFERIIIYDAYPIDNTDTQRYKALR 60
Query: 255 QLDATYRWVLTGNLLQQNLANFLKLGEYGDDQLWDTQICPILEGKQCDEKTELSKKIENL 76
QLDATYRWVLTGNLLQQNLANFLKLGEYGDDQLWDTQICPILEGKQCDEKTELSKKIENL
Sbjct: 61 QLDATYRWVLTGNLLQQNLANFLKLGEYGDDQLWDTQICPILEGKQCDEKTELSKKIENL 120
Query: 75 LKSVELKFPLENYREMEVGADDSQ 4
LKSVELKFPLENYREMEVGADDSQ
Sbjct: 121 LKSVELKFPLENYREMEVGADDSQ 144