Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F16B4_6
(276 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|23508831|ref|NP_701499.1| Bi-functional aminoacyl-tRNA synthe... 37 0.11
gi|50543322|ref|XP_499827.1| hypothetical protein [Yarrowia lipo... 37 0.14
gi|23619035|ref|NP_704997.1| hypothetical protein [Plasmodium fa... 37 0.14
gi|23613609|ref|NP_704630.1| hypothetical protein [Plasmodium fa... 36 0.23
gi|23485871|gb|EAA20614.1| hypothetical protein [Plasmodium yoel... 35 0.40
gi|16080533|ref|NP_391360.1| yvcE [Bacillus subtilis subsp. subt... 35 0.40
gi|22788742|ref|NP_690453.1| hypothetical protein HZV_34 [Heliot... 35 0.52
gi|34855225|ref|XP_342451.1| similar to lunapark [Rattus norvegi... 35 0.52
gi|37531426|ref|NP_920015.1| hypothetical protein [Oryza sativa ... 35 0.52
gi|29245093|gb|EAA36753.1| GLP_30_1646_4933 [Giardia lamblia ATC... 35 0.52
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her... 35 0.52
gi|7158835|gb|AAF37556.1| p101/acidic basic repeat antigen [Plas... 34 0.68
gi|113005|sp|P22620|ABRA_PLAFC 101 kDa malaria antigen (P101) (A... 34 0.68
gi|23508971|ref|NP_701639.1| 101 kd malaria antigen [Plasmodium ... 34 0.68
gi|23489943|gb|EAA21832.1| hypothetical protein [Plasmodium yoel... 34 0.68
gi|27372919|gb|AAO06833.1| putative 19.1 kDa salivary protein SG... 34 0.68
gi|113007|sp|P23745|ABRA_PLAFG 101 kDa malaria antigen (P101) (A... 34 0.68
gi|42733967|gb|AAS38867.1| similar to K08H10.2a.p [Caenorhabditi... 34 0.89
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 34 0.89
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p... 34 0.89
gi|31197257|ref|XP_307576.1| ENSANGP00000023198 [Anopheles gambi... 33 1.2
gi|23484582|gb|EAA19867.1| hypothetical protein [Plasmodium yoel... 33 1.2
gi|7512674|pir||T17236 hypothetical protein DKFZp434N126.1 - hum... 33 1.2
gi|23957728|ref|NP_473185.2| hypothetical protein, conserved [Pl... 33 1.2
gi|17158415|ref|NP_477835.1| wsv313 [shrimp white spot syndrome ... 33 1.5
gi|50736248|ref|XP_419094.1| PREDICTED: similar to Zinc finger p... 33 1.5
gi|42655682|ref|XP_375761.1| similar to Matrin 3 [Homo sapiens] 33 1.5
gi|28829873|gb|AAO52370.1| similar to Plasmodium falciparum (iso... 33 1.5
gi|15021546|gb|AAK77823.1| ORF154 [shrimp white spot syndrome vi... 33 1.5
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 33 1.5
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can... 33 1.5
gi|23507900|ref|NP_700570.1| hypothetical protein [Plasmodium fa... 33 1.5
gi|15234171|ref|NP_195065.1| hypothetical protein [Arabidopsis t... 33 1.5
gi|32416926|ref|XP_328941.1| predicted protein [Neurospora crass... 33 1.5
gi|19481961|gb|AAL89237.1| WSSV369 [shrimp white spot syndrome v... 33 1.5
gi|17510905|ref|NP_491538.1| putative protein, with 2 coiled coi... 33 2.0
gi|7494310|pir||B71609 hypothetical protein PFB0680w - malaria p... 33 2.0
gi|23593313|ref|NP_473064.2| hypothetical protein [Plasmodium fa... 33 2.0
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 33 2.0
gi|48892377|ref|ZP_00325764.1| COG2931: RTX toxins and related C... 33 2.0
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand... 33 2.0
gi|15235717|ref|NP_195495.1| expressed protein [Arabidopsis thal... 33 2.0
gi|17510907|ref|NP_491537.1| putative protein, with 2 coiled coi... 33 2.0
gi|50470843|emb|CAC35851.2| Hypothetical protein Y111B2A.22 [Cae... 32 2.6
gi|23479428|gb|EAA16261.1| Ser/Thr protein phosphatase, putative... 32 2.6
gi|17556707|ref|NP_499654.1| prion-like Q/N-rich domain protein ... 32 2.6
gi|23508752|ref|NP_701420.1| hypothetical protein [Plasmodium fa... 32 2.6
gi|19923619|ref|NP_079467.2| chromosome 1 open reading frame 22 ... 32 2.6
gi|45451721|gb|AAS65429.1| Swi/Snf family ATPase [Caenorhabditis... 32 2.6
gi|31542059|ref|NP_766270.1| RIKEN cDNA 9930021J17 [Mus musculus... 32 2.6
gi|20178387|ref|NP_619808.1| CPXV019 protein [Cowpox virus] >gnl... 32 2.6
gi|50294870|ref|XP_449846.1| unnamed protein product [Candida gl... 32 2.6
gi|23509530|ref|NP_702197.1| hypothetical protein [Plasmodium fa... 32 2.6
gi|26345336|dbj|BAC36319.1| unnamed protein product [Mus musculus] 32 2.6
gi|23509431|ref|NP_702098.1| hypothetical protein [Plasmodium fa... 32 2.6
gi|22788715|ref|NP_690423.1| hypothetical protein HZV_4 [Helioth... 32 2.6
gi|48838719|ref|ZP_00295659.1| COG3291: FOG: PKD repeat [Methano... 32 2.6
gi|23487821|gb|EAA21153.1| dentin phosphoryn, putative [Plasmodi... 32 3.4
gi|6692068|emb|CAB65754.1| merozoite surface protein 3 [Plasmodi... 32 3.4
gi|28571865|ref|NP_788733.1| CG33106-PA [Drosophila melanogaster... 32 3.4
gi|18251232|gb|AAL65911.1| multiple ankyrin repeat single KH dom... 32 3.4
gi|46575920|ref|NP_997554.1| zinc finger protein 318 isoform 1 [... 32 3.4
gi|50286755|ref|XP_445807.1| unnamed protein product [Candida gl... 32 3.4
gi|46442467|gb|EAL01756.1| hypothetical protein CaO19.4284 [Cand... 32 3.4
gi|10946664|ref|NP_067321.1| zinc finger protein 318 isoform 2 [... 32 3.4
gi|16805190|ref|NP_473218.1| hypothetical protein [Plasmodium fa... 32 3.4
gi|49070174|ref|XP_399376.1| hypothetical protein UM01761.1 [Ust... 32 3.4
gi|23613580|ref|NP_704601.1| beta subunit of coatomer complex, p... 32 3.4
gi|50307369|ref|XP_453663.1| unnamed protein product [Kluyveromy... 32 4.4
gi|50399995|gb|AAT76383.1| putative SWI/SNF complex protein [Ory... 32 4.4
gi|46433849|gb|EAK93277.1| hypothetical protein CaO19.8790 [Cand... 32 4.4
gi|50311443|ref|XP_455746.1| unnamed protein product [Kluyveromy... 32 4.4
gi|46434724|gb|EAK94126.1| hypothetical protein CaO19.2410 [Cand... 32 4.4
gi|42374898|gb|AAS13449.1| merozoite surface protein 6 [Plasmodi... 32 4.4
gi|46434778|gb|EAK94179.1| hypothetical protein CaO19.9948 [Cand... 32 4.4
gi|15235385|ref|NP_194593.1| auxin-responsive protein / indoleac... 32 4.4
gi|42600552|dbj|BAD11134.1| glutamate-rich protein [Lotus cornic... 32 4.4
gi|20466408|gb|AAM20521.1| early auxin-inducible protein 11 [Ara... 32 4.4
gi|23509280|ref|NP_701947.1| hypothetical protein [Plasmodium fa... 32 4.4
gi|29251449|gb|EAA42930.1| GLP_170_20696_24760 [Giardia lamblia ... 32 4.4
gi|48119794|ref|XP_396453.1| similar to CG15628-PA [Apis mellifera] 32 4.4
gi|23612578|ref|NP_704139.1| hypothetical protein [Plasmodium fa... 32 4.4
gi|48097616|ref|XP_391923.1| similar to ENSANGP00000019063 [Apis... 32 4.4
gi|23481834|gb|EAA17992.1| probable RNA 3'-terminal phosphate cy... 31 5.8
gi|11357857|pir||T47364 hypothetical protein F7M19.70 - Arabidop... 31 5.8
gi|14589862|ref|NP_115856.1| aspartate beta-hydroxylase isoform ... 31 5.8
gi|19173002|ref|NP_597553.1| similarity to yeast CDC68 [Encephal... 31 5.8
gi|25148366|ref|NP_500064.2| zn-finger-like, PHD finger family m... 31 5.8
gi|15224261|ref|NP_179483.1| hypothetical protein [Arabidopsis t... 31 5.8
gi|50294017|ref|XP_449420.1| unnamed protein product [Candida gl... 31 5.8
gi|39589800|emb|CAE67035.1| Hypothetical protein CBG12437 [Caeno... 31 5.8
gi|13095848|ref|NP_076738.1| capsid protein [Bacteriophage bIL30... 31 5.8
gi|25395995|pir||G88637 protein F53H1.4 [imported] - Caenorhabdi... 31 5.8
gi|7487894|pir||T01029 hypothetical protein YUP8H12R.12 - Arabid... 31 5.8
gi|23481824|gb|EAA17986.1| hypothetical protein [Plasmodium yoel... 31 5.8
gi|9910364|ref|NP_064549.1| aspartate beta-hydroxylase isoform e... 31 5.8
gi|46561990|gb|AAT01212.1| SPARC [Ciona intestinalis] 31 5.8
gi|15242707|ref|NP_198861.1| expressed protein [Arabidopsis thal... 31 5.8
gi|46433694|gb|EAK93126.1| hypothetical protein CaO19.1199 [Cand... 31 5.8
gi|23487564|gb|EAA21085.1| hypothetical protein [Plasmodium yoel... 31 5.8
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 31 5.8
gi|15219336|ref|NP_178048.1| expressed protein [Arabidopsis thal... 31 5.8
gi|38090880|ref|XP_137065.4| similar to hypothetical protein [Mu... 31 5.8
gi|15923667|ref|NP_371201.1| conserved hypothetical protein [Sta... 31 5.8
gi|21282368|ref|NP_645456.1| conserved hypothetical protein [Sta... 31 5.8
gi|25403670|pir||G86491 hypothetical protein CPj0007 [imported] ... 31 5.8
gi|33241343|ref|NP_876284.1| HB1 protein [Chlamydophila pneumoni... 31 5.8
gi|15617936|ref|NP_224220.1| hypothetical protein [Chlamydophila... 31 5.8
gi|33865487|ref|NP_897046.1| hypothetical [Synechococcus sp. WH ... 31 5.8
gi|23483366|gb|EAA19060.1| hypothetical protein [Plasmodium yoel... 31 5.8
gi|31222811|ref|XP_317227.1| ENSANGP00000025200 [Anopheles gambi... 31 5.8
gi|16753035|ref|NP_445308.1| hypothetical protein [Chlamydophila... 31 5.8
gi|15835542|ref|NP_300066.1| hypothetical protein [Chlamydophila... 31 5.8
gi|32394454|gb|AAM93925.1| cytochrome P450 like protein [Griffit... 31 7.5
gi|48094384|ref|XP_394162.1| similar to MGC68806 protein [Apis m... 31 7.5
gi|6323204|ref|NP_013276.1| major low affinity 55 kDa Centromere... 31 7.5
gi|42374890|gb|AAS13445.1| merozoite surface protein 6 [Plasmodi... 31 7.5
gi|28828709|gb|AAO51304.1| hypothetical protein [Dictyostelium d... 31 7.5
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 31 7.5
gi|23619388|ref|NP_705350.1| hypothetical protein [Plasmodium fa... 31 7.5
gi|23508666|ref|NP_701335.1| hypothetical protein [Plasmodium fa... 31 7.5
gi|50290973|ref|XP_447919.1| unnamed protein product [Candida gl... 31 7.5
gi|23613490|ref|NP_703334.1| hypothetical protein [Plasmodium fa... 31 7.5
gi|38346807|emb|CAD41374.2| OSJNBa0088A01.14 [Oryza sativa (japo... 31 7.5
gi|46441643|gb|EAL00939.1| hypothetical protein CaO19.14124 [Can... 31 7.5
gi|20807677|ref|NP_622848.1| Biotin carboxyl carrier protein [Th... 31 7.5
gi|42733783|gb|AAS38704.1| similar to Dictyostelium discoideum (... 31 7.5
gi|42374902|gb|AAS13451.1| merozoite surface protein 6 [Plasmodi... 31 7.5
gi|50545257|ref|XP_500166.1| hypothetical protein [Yarrowia lipo... 31 7.5
gi|42374896|gb|AAS13448.1| merozoite surface protein 6 [Plasmodi... 31 7.5
gi|23481891|gb|EAA18035.1| hypothetical protein [Plasmodium yoel... 31 7.5
gi|15673632|ref|NP_267806.1| hypothetical protein L98109 [Lactoc... 31 7.5
gi|42733764|gb|AAS38696.1| similar to Plasmodium falciparum (iso... 31 7.5
gi|17158412|ref|NP_477832.1| wsv310 [shrimp white spot syndrome ... 31 7.5
gi|40804954|gb|AAR91745.1| topoisomerase II [Entamoeba histolytica] 31 7.5
gi|17534283|ref|NP_494686.1| predicted CDS, putative nuclear pro... 31 7.5
gi|18310240|ref|NP_562174.1| probable enterotoxin [Clostridium p... 31 7.5
gi|28829097|gb|AAO51659.1| similar to putative protein; protein ... 31 7.5
gi|28828850|gb|AAO51445.1| similar to Arabidopsis thaliana (Mous... 31 7.5
gi|25408116|pir||B84715 hypothetical protein At2g30990 [imported... 30 9.9
gi|31441777|emb|CAB01735.2| Hypothetical protein C33G3.5 [Caenor... 30 9.9
gi|27468133|ref|NP_764770.1| conserved hypothetical protein [Sta... 30 9.9
gi|23508149|ref|NP_700819.1| merozoite surface protein 6 [Plasmo... 30 9.9
gi|40253662|dbj|BAD05605.1| putative nucleolin [Oryza sativa (ja... 30 9.9
gi|486970|pir||S36721 DEP1 protein - yeast (Saccharomyces cerevi... 30 9.9
gi|42374892|gb|AAS13446.1| merozoite surface protein 6 [Plasmodi... 30 9.9
gi|39593039|emb|CAE64508.1| Hypothetical protein CBG09238 [Caeno... 30 9.9
gi|39590065|emb|CAE61063.1| Hypothetical protein CBG04812 [Caeno... 30 9.9
gi|50286503|ref|XP_445680.1| unnamed protein product [Candida gl... 30 9.9
gi|50738728|ref|XP_429829.1| PREDICTED: hypothetical protein XP_... 30 9.9
gi|28850359|gb|AAM08459.2| similar to Plasmodium falciparum. Hyp... 30 9.9
gi|23508059|ref|NP_700729.1| hypothetical protein [Plasmodium fa... 30 9.9
gi|50416488|gb|AAH77218.1| Unknown (protein for IMAGE:4408820) [... 30 9.9
gi|42761494|gb|AAS45312.1| hypothetical protein [Dictyostelium d... 30 9.9
gi|46228734|gb|EAK89604.1| hypothetical protein, transcripts ide... 30 9.9
gi|23619387|ref|NP_705349.1| hypothetical protein [Plasmodium fa... 30 9.9
gi|23613434|ref|NP_703278.1| patched family protein, putative [P... 30 9.9
gi|29374799|ref|NP_813951.1| aggregation substance, putative [En... 30 9.9
gi|23508430|ref|NP_701099.1| hypothetical protein [Plasmodium fa... 30 9.9
gi|41629667|ref|NP_009389.2| Transcriptional modulator involved ... 30 9.9
gi|23508319|ref|NP_700988.1| hypothetical protein [Plasmodium fa... 30 9.9
gi|23490425|gb|EAA22207.1| hypothetical protein [Plasmodium yoel... 30 9.9
gi|17550786|ref|NP_510343.1| putative protein family member (XO6... 30 9.9
gi|46440741|gb|EAL00044.1| hypothetical protein CaO19.13509 [Can... 30 9.9
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib... 30 9.9
gi|23508016|ref|NP_700686.1| 10b antigen, putative [Plasmodium f... 30 9.9
gi|42569494|ref|NP_180656.2| expressed protein [Arabidopsis thal... 30 9.9
gi|7486827|pir||T04913 hypothetical protein T10I14.150 - Arabido... 30 9.9
gi|30685783|ref|NP_193963.2| expressed protein [Arabidopsis thal... 30 9.9
gi|23482801|gb|EAA18676.1| hypothetical protein [Plasmodium yoel... 30 9.9
gi|18157537|dbj|BAB83852.1| BING2~partially supported by GENSCAN... 30 9.9
gi|23509614|ref|NP_702281.1| Ser/Thr protein kinase, putative [P... 30 9.9
gi|7489886|pir||T18277 kinesin heavy chain - slime mold (Dictyos... 30 9.9
>gi|23508831|ref|NP_701499.1| Bi-functional aminoacyl-tRNA
synthetase, putative [Plasmodium falciparum 3D7]
gi|23496667|gb|AAN36223.1| Bi-functional aminoacyl-tRNA synthetase,
putative [Plasmodium falciparum 3D7]
Length = 746
Score = 37.0 bits (84), Expect = 0.11
Identities = 16/55 (29%), Positives = 29/55 (52%)
Frame = +2
Query: 68 VDLLEDMDHHPEVTELQEDTTTKEVSTEDPNLEVTEASNKEADSNKEDNSNKEAS 232
+ E +H PE +++EDTT+K + +++ A N+E +N +N N S
Sbjct: 161 IKFCESFNHAPEYVQIKEDTTSKARVDKKEDVQEEMAKNEELQNNNNNNKNNSNS 215