Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F13B12_6
(1308 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539800|ref|NP_501928.1| cysteine synthase precursor (48.7 k... 855 0.0
gi|39583714|emb|CAE63818.1| Hypothetical protein CBG08368 [Caeno... 629 e-179
gi|17539640|ref|NP_501929.1| cysteine synthase (4L216) [Caenorha... 616 e-175
gi|7508440|pir||T33372 hypothetical protein T25D3.1 - Caenorhabd... 334 3e-90
gi|17536509|ref|NP_493671.1| cysteine synthase (2A447) [Caenorha... 334 3e-90
gi|38176051|gb|AAK84579.2| Hypothetical protein T25D3.3 [Caenorh... 333 4e-90
gi|39586865|emb|CAE62800.1| Hypothetical protein CBG06975 [Caeno... 322 1e-86
gi|27375347|ref|NP_766876.1| cysteine synthase/cystathionine bet... 158 2e-37
gi|37679316|ref|NP_933925.1| cysteine synthase [Vibrio vulnificu... 158 2e-37
gi|27366418|ref|NP_761946.1| Cysteine synthase [Vibrio vulnificu... 158 2e-37
gi|37527721|ref|NP_931066.1| hypothetical protein [Photorhabdus ... 157 4e-37
gi|50120095|ref|YP_049262.1| putative pyridoxal-phosphate depend... 157 5e-37
gi|15641074|ref|NP_230706.1| cysteine synthase/cystathionine bet... 155 3e-36
gi|16123309|ref|NP_406622.1| putative Pyridoxal-phosphate depend... 154 4e-36
gi|46912590|emb|CAG19380.1| putative cysteine synthase/cystathio... 150 8e-35
gi|16763839|ref|NP_459454.1| putative cysteine synthase/cystathi... 149 1e-34
gi|16759439|ref|NP_455056.1| putative lyase [Salmonella enterica... 148 2e-34
gi|47679007|dbj|BAD20691.1| cysteine synthase/cystathionine beta... 148 2e-34
gi|28897720|ref|NP_797325.1| cysteine synthase/cystathionine bet... 148 2e-34
gi|21244353|ref|NP_643935.1| cysteine synthase [Xanthomonas axon... 147 7e-34
gi|48732852|ref|ZP_00266595.1| COG0031: Cysteine synthase [Pseud... 146 9e-34
gi|32041064|ref|ZP_00138647.1| COG0031: Cysteine synthase [Pseud... 144 5e-33
gi|15596258|ref|NP_249752.1| conserved hypothetical protein [Pse... 143 8e-33
gi|49086556|gb|AAT51363.1| PA1061 [synthetic construct] 143 8e-33
gi|22998012|ref|ZP_00042207.1| COG0031: Cysteine synthase [Xylel... 142 1e-32
gi|22994955|ref|ZP_00039441.1| COG0031: Cysteine synthase [Xylel... 142 2e-32
gi|28198034|ref|NP_778348.1| cysteine synthase [Xylella fastidio... 142 2e-32
gi|15836733|ref|NP_297421.1| cysteine synthase [Xylella fastidio... 141 4e-32
gi|41406488|ref|NP_959324.1| hypothetical protein MAP0390c [Myco... 140 9e-32
gi|15843302|ref|NP_338339.1| cysteine synthase/cystathionine bet... 140 9e-32
gi|21230054|ref|NP_635971.1| cysteine synthase [Xanthomonas camp... 139 2e-31
gi|15610820|ref|NP_218201.1| hypothetical protein Rv3684 [Mycoba... 135 3e-30
gi|21219544|ref|NP_625323.1| putative lyase [Streptomyces coelic... 135 3e-30
gi|48851191|ref|ZP_00305433.1| COG0031: Cysteine synthase [Novos... 131 4e-29
gi|29827976|ref|NP_822610.1| putative lyase [Streptomyces avermi... 129 2e-28
gi|46363778|ref|ZP_00226480.1| COG0031: Cysteine synthase [Kineo... 127 8e-28
gi|45515196|ref|ZP_00166751.1| COG0031: Cysteine synthase [Ralst... 100 1e-19
gi|48765400|ref|ZP_00269951.1| COG0031: Cysteine synthase [Rhodo... 99 2e-19
gi|48862219|ref|ZP_00316116.1| COG0031: Cysteine synthase [Micro... 90 1e-16
gi|46315608|ref|ZP_00216190.1| COG0031: Cysteine synthase [Burkh... 89 2e-16
gi|42523238|ref|NP_968618.1| cysM [Bdellovibrio bacteriovorus HD... 85 4e-15
gi|13473791|ref|NP_105359.1| cystathionine beta-synthase [Mesorh... 84 1e-14
gi|22997070|ref|ZP_00041308.1| COG0031: Cysteine synthase [Xylel... 83 2e-14
gi|28199710|ref|NP_780024.1| cysteine synthase [Xylella fastidio... 82 4e-14
gi|15837433|ref|NP_298121.1| cysteine synthase [Xylella fastidio... 81 6e-14
gi|22995287|ref|ZP_00039766.1| COG0031: Cysteine synthase [Xylel... 81 6e-14
gi|16329256|ref|NP_439984.1| cysteine synthase [Synechocystis sp... 80 8e-14
gi|37524532|ref|NP_927876.1| hypothetical protein [Photorhabdus ... 80 8e-14
gi|45201116|ref|NP_986686.1| AGR021Cp [Eremothecium gossypii] >g... 80 1e-13
gi|34498850|ref|NP_903065.1| cystathionine beta-synthase [Chromo... 80 1e-13
gi|48769387|ref|ZP_00273733.1| COG0031: Cysteine synthase [Ralst... 79 3e-13
gi|50424945|ref|XP_461064.1| unnamed protein product [Debaryomyc... 79 3e-13
gi|6321449|ref|NP_011526.1| Hypothetical ORF; Ygr012wp [Saccharo... 78 4e-13
gi|34763312|ref|ZP_00144268.1| Cysteine synthase [Fusobacterium ... 77 7e-13
gi|50310285|ref|XP_455162.1| unnamed protein product [Kluyveromy... 77 1e-12
gi|17548497|ref|NP_521837.1| PROBABLE CYSTEINE SYNTHASE A PROTEI... 76 2e-12
gi|50552578|ref|XP_503699.1| hypothetical protein [Yarrowia lipo... 76 2e-12
gi|32452333|emb|CAD59398.1| putative cysteine synthase 2 [Propio... 76 2e-12
gi|50256106|gb|EAL18833.1| hypothetical protein CNBI0940 [Crypto... 76 2e-12
gi|20807594|ref|NP_622765.1| Cysteine synthase [Thermoanaerobact... 76 2e-12
gi|23118592|ref|ZP_00102055.1| COG0031: Cysteine synthase [Desul... 75 3e-12
gi|46440940|gb|EAL00241.1| hypothetical protein CaO19.5574 [Cand... 75 3e-12
gi|19114255|ref|NP_593343.1| putative cysteine synthase [Schizos... 75 3e-12
gi|28870138|ref|NP_792757.1| pyridoxal-phosphate dependent enzym... 75 4e-12
gi|48856110|ref|ZP_00310268.1| COG0031: Cysteine synthase [Cytop... 75 4e-12
gi|16520032|ref|NP_444152.1| Y4xP [Rhizobium sp. NGR234] >gnl|BL... 75 4e-12
gi|21244066|ref|NP_643648.1| cysteine synthase [Xanthomonas axon... 75 4e-12
gi|19749319|gb|AAL98689.1| Y4xP [Sinorhizobium fredii] 74 6e-12
gi|48844146|ref|ZP_00298477.1| COG0031: Cysteine synthase [Geoba... 74 6e-12
gi|50287843|ref|XP_446351.1| unnamed protein product [Candida gl... 74 8e-12
gi|21230072|ref|NP_635989.1| cystathionine beta-synthase [Xantho... 74 1e-11
gi|14090409|gb|AAK53485.1| cystathionine beta-lyase [Xanthomonas... 74 1e-11
gi|46579077|ref|YP_009885.1| cysteine synthase A [Desulfovibrio ... 74 1e-11
gi|42780988|ref|NP_978235.1| cysteine synthase A [Bacillus cereu... 73 1e-11
gi|47565559|ref|ZP_00236600.1| cysteine synthase A [Bacillus cer... 73 2e-11
gi|21244328|ref|NP_643910.1| cystathionine beta-synthase [Xantho... 73 2e-11
gi|15923106|ref|NP_370640.1| hypothetical protein SAV0116 [Staph... 73 2e-11
gi|46188912|ref|ZP_00205850.1| COG0031: Cysteine synthase [Pseud... 72 3e-11
gi|19704390|ref|NP_603952.1| Cysteine synthase [Fusobacterium nu... 72 3e-11
gi|21232611|ref|NP_638528.1| cysteine synthase [Xanthomonas camp... 72 3e-11
gi|15925820|ref|NP_373353.1| hypothetical protein, similar to cy... 72 3e-11
gi|23473736|ref|ZP_00129031.1| COG0031: Cysteine synthase [Desul... 72 4e-11
gi|46436814|gb|EAK96170.1| hypothetical protein CaO19.7152 [Cand... 72 4e-11
gi|32266348|ref|NP_860380.1| cysteine synthase [Helicobacter hep... 72 4e-11
gi|50876129|emb|CAG35969.1| probable cysteine synthase A [Desulf... 72 4e-11
gi|42525122|ref|NP_970502.1| cystathionine beta-synthase [Bdello... 71 5e-11
gi|30019907|ref|NP_831538.1| Cysteine synthase [Bacillus cereus ... 71 5e-11
gi|15676661|ref|NP_273805.1| cysteine synthase [Neisseria mening... 71 5e-11
gi|49477395|ref|YP_036010.1| cysteine synthase A [Bacillus thuri... 71 6e-11
gi|21399712|ref|NP_655697.1| PALP, Pyridoxal-phosphate dependent... 70 8e-11
gi|34557557|ref|NP_907372.1| CYSTEINE SYNTHASE/CYSTATHIONINE BET... 70 8e-11
gi|13473904|ref|NP_105472.1| cysteine synthase [Mesorhizobium lo... 70 1e-10
gi|20808833|ref|NP_624004.1| Cysteine synthase [Thermoanaerobact... 70 1e-10
gi|15805815|ref|NP_294513.1| O-acetylserine (thiol)-lyase [Deino... 70 1e-10
gi|23124570|ref|ZP_00106550.1| COG0031: Cysteine synthase [Nosto... 69 2e-10
gi|50306085|ref|XP_453004.1| unnamed protein product [Kluyveromy... 69 2e-10
gi|39935425|ref|NP_947701.1| putative cystathionine beta-synthas... 69 2e-10
gi|36958855|gb|AAQ87280.1| Cysteine synthase [Rhizobium sp. NGR234] 69 2e-10
gi|16123190|ref|NP_406503.1| cysteine synthase B [Yersinia pesti... 69 2e-10
gi|32476290|ref|NP_869284.1| cysteine synthase B [Pirellula sp. ... 69 3e-10
gi|15923503|ref|NP_371037.1| cysteine synthase (o-acetylserine s... 69 3e-10
gi|45190446|ref|NP_984700.1| AEL161Wp [Eremothecium gossypii] >g... 69 3e-10
gi|48891108|ref|ZP_00324682.1| COG0031: Cysteine synthase [Trich... 69 3e-10
gi|28199427|ref|NP_779741.1| cystathionine beta-synthase [Xylell... 69 3e-10
gi|15792241|ref|NP_282064.1| cysteine synthase [Campylobacter je... 68 4e-10
gi|23025205|ref|ZP_00064365.1| COG0031: Cysteine synthase [Leuco... 68 4e-10
gi|27469188|ref|NP_765825.1| cysteine synthase [Staphylococcus e... 68 4e-10
gi|39995642|ref|NP_951593.1| cysteine synthase A [Geobacter sulf... 68 5e-10
gi|9858119|gb|AAG01002.1| O-acetylserine lyase [Selenomonas rumi... 68 5e-10
gi|21325334|dbj|BAB99955.1| Cysteine synthase [Corynebacterium g... 67 7e-10
gi|19112124|ref|NP_595332.1| cysteine synthase [Schizosaccharomy... 67 7e-10
gi|19553758|ref|NP_601760.1| cysteine synthase [Corynebacterium ... 67 7e-10
gi|27379564|ref|NP_771093.1| cysteine synthase [Bradyrhizobium j... 67 7e-10
gi|28211026|ref|NP_781970.1| cysteine synthase A [Clostridium te... 67 7e-10
gi|41326741|emb|CAF21223.1| O-Acetylserine (Thiol)-Lyase [Coryne... 67 7e-10
gi|24214797|ref|NP_712278.1| Cysteine synthase B [Leptospira int... 67 7e-10
gi|46192849|ref|ZP_00005894.2| COG0031: Cysteine synthase [Rhodo... 67 7e-10
gi|15837205|ref|NP_297893.1| cystathionine beta-synthase [Xylell... 67 1e-09
gi|22995247|ref|ZP_00039727.1| COG0031: Cysteine synthase [Xylel... 67 1e-09
gi|22996232|ref|ZP_00040496.1| COG0031: Cysteine synthase [Xylel... 67 1e-09
gi|7436930|pir||JC6185 cysteine synthase (EC 4.2.99.8) B - Campy... 67 1e-09
gi|16080049|ref|NP_390875.1| ytkP [Bacillus subtilis subsp. subt... 67 1e-09
gi|16124141|ref|NP_407454.1| pyridoxal-phosphate dependent prote... 67 1e-09
gi|22127909|ref|NP_671332.1| cysteine synthase [Yersinia pestis ... 67 1e-09
gi|16077141|ref|NP_387954.1| cysteine synthetase A [Bacillus sub... 66 2e-09
gi|16802269|ref|NP_463754.1| highly similar to cysteine synthase... 66 2e-09
gi|16799332|ref|NP_469600.1| highly similar to cysteine synthase... 65 3e-09
gi|46906455|ref|YP_012844.1| cysteine synthase A [Listeria monoc... 65 3e-09
gi|50555974|ref|XP_505395.1| hypothetical protein [Yarrowia lipo... 65 3e-09
gi|33150444|gb|AAP97124.1| cysteine synthase [Porphyra purpurea] 65 4e-09
gi|32411653|ref|XP_326307.1| hypothetical protein [Neurospora cr... 65 4e-09
gi|28869625|ref|NP_792244.1| pyridoxal-phosphate dependent enzym... 65 4e-09
gi|15802953|ref|NP_288982.1| cysteine synthase B, O-acetylserine... 65 5e-09
gi|49081012|ref|XP_403960.1| hypothetical protein UM06345.1 [Ust... 65 5e-09
gi|22299854|ref|NP_683101.1| cysteine synthase [Thermosynechococ... 64 6e-09
gi|15672522|ref|NP_266696.1| cysteine synthase [Lactococcus lact... 64 6e-09
gi|50119828|ref|YP_048995.1| cysteine synthase B [Erwinia caroto... 64 6e-09
gi|38110832|gb|EAA56495.1| hypothetical protein MG06466.4 [Magna... 64 6e-09
gi|17231908|ref|NP_488456.1| cystathionine beta-synthase [Nostoc... 64 8e-09
gi|48851250|ref|ZP_00305492.1| COG0031: Cysteine synthase [Novos... 64 8e-09
gi|49236295|ref|ZP_00330355.1| COG0031: Cysteine synthase [Moore... 64 8e-09
gi|37525347|ref|NP_928691.1| cysteine synthase B (O-acetylserine... 64 8e-09
gi|39935634|ref|NP_947910.1| O-acetylserine (thiol) lyase [Rhodo... 64 8e-09
gi|45505525|ref|ZP_00157902.1| COG0031: Cysteine synthase [Anaba... 64 1e-08
gi|32043573|ref|ZP_00140835.1| COG0031: Cysteine synthase [Pseud... 63 1e-08
gi|285253|pir||C42790 cystathionine beta-synthase (EC 4.2.1.22),... 63 1e-08
gi|543960|sp|P32232|CBS_RAT Cystathionine beta-synthase (Serine ... 63 1e-08
gi|50310963|ref|XP_455504.1| unnamed protein product [Kluyveromy... 63 1e-08
gi|6978611|ref|NP_036654.1| cystathionine beta synthase [Rattus ... 63 1e-08
gi|206600|gb|AAA42024.1| cystathionine beta-synthase 63 1e-08
gi|15965372|ref|NP_385725.1| PROBABLE CYSTEINE SYNTHASE A (O-ACE... 63 1e-08
gi|30089694|ref|NP_835742.1| cystathionine beta-synthase isoform... 63 2e-08
gi|21450071|ref|NP_659104.1| cystathionine beta-synthase isoform... 63 2e-08
gi|46108042|ref|XP_381079.1| hypothetical protein FG00903.1 [Gib... 62 2e-08
gi|45515067|ref|ZP_00166623.1| COG0031: Cysteine synthase [Ralst... 62 2e-08
gi|50418355|gb|AAH77504.1| Unknown (protein for MGC:82640) [Xeno... 62 3e-08
gi|21221518|ref|NP_627297.1| putative cystathionine beta-synthas... 62 3e-08
gi|15595596|ref|NP_249090.1| cystathionine beta-synthase [Pseudo... 62 3e-08
gi|21715911|dbj|BAC02912.1| L-cysteine desulfhydrase [Fusobacter... 62 3e-08
gi|29376146|ref|NP_815300.1| cysteine synthase A [Enterococcus f... 62 3e-08
gi|18309159|ref|NP_561093.1| cysteine synthase [Clostridium perf... 62 4e-08
gi|45201107|ref|NP_986677.1| AGR012Cp [Eremothecium gossypii] >g... 62 4e-08
gi|25029002|ref|NP_739056.1| putative cysteine synthase [Coryneb... 62 4e-08
gi|47565286|ref|ZP_00236328.1| cysteine synthase A [Bacillus cer... 62 4e-08
gi|23097539|ref|NP_691005.1| cysteine synthase A [Oceanobacillus... 62 4e-08
gi|15902017|ref|NP_346621.1| cysteine synthase [Streptococcus pn... 62 4e-08
gi|15888553|ref|NP_354234.1| AGR_C_2247p [Agrobacterium tumefaci... 61 5e-08
gi|16130347|ref|NP_416916.1| cysteine synthase B, O-acetylserine... 61 5e-08
gi|15904056|ref|NP_359606.1| Cysteine synthase, O-acetylserine s... 61 5e-08
gi|46434284|gb|EAK93698.1| hypothetical protein CaO19.12011 [Can... 61 7e-08
gi|1706271|sp|P50867|CYSK_EMENI Cysteine synthase (O-acetylserin... 61 7e-08
gi|48733468|ref|ZP_00267211.1| COG0031: Cysteine synthase [Pseud... 61 7e-08
gi|16765760|ref|NP_461375.1| cysteine synthase B [Salmonella typ... 61 7e-08
gi|19704555|ref|NP_604117.1| Cysteine synthase [Fusobacterium nu... 60 9e-08
gi|48859948|ref|ZP_00313876.1| COG0031: Cysteine synthase [Clost... 60 9e-08
gi|49117325|ref|XP_412194.1| CYSK_EMENI Cysteine synthase (O-ace... 60 9e-08
gi|50842771|ref|YP_055998.1| cystathionine beta-synthase [Propio... 60 9e-08
gi|21954795|ref|NP_665779.1| pANL40 [Synechococcus elongatus PCC... 60 9e-08
gi|32474545|ref|NP_867539.1| cysteine synthase (O-acetylserine s... 60 1e-07
gi|20129101|ref|NP_608424.1| CG1753-PA [Drosophila melanogaster]... 60 1e-07
gi|48838418|ref|ZP_00295362.1| COG0031: Cysteine synthase [Metha... 60 1e-07
gi|48837017|ref|ZP_00294012.1| COG0031: Cysteine synthase [Therm... 60 1e-07
gi|46106191|ref|ZP_00186751.2| COG0031: Cysteine synthase [Rubro... 60 1e-07
gi|50123033|ref|YP_052200.1| putative cystathionine beta-synthas... 60 1e-07
gi|50086082|ref|YP_047592.1| cysteine synthase B (O-acetylserine... 60 1e-07
gi|18310304|ref|NP_562238.1| o-acetylserine sulfhydrylase [Clost... 60 1e-07
gi|15718695|gb|AAF14694.2| O-acetylserine sulfhydrylase CysK [La... 60 1e-07
gi|29830053|ref|NP_824687.1| putative cystathionine beta-synthas... 59 2e-07
gi|28279853|gb|AAH44091.1| Cbs-prov protein [Xenopus laevis] 59 2e-07
gi|15616691|ref|NP_239903.1| cysteine synthase A [Buchnera aphid... 59 2e-07
gi|16761358|ref|NP_456975.1| cysteine synthase B [Salmonella ent... 59 2e-07
gi|11066277|gb|AAG28533.1| cysteine synthase [Geobacillus stearo... 59 2e-07
gi|41725916|ref|ZP_00152674.1| COG0031: Cysteine synthase [Dechl... 59 3e-07
gi|46125819|ref|XP_387463.1| CYSK_EMENI Cysteine synthase (O-ace... 59 3e-07
gi|1071913|pir||A55450 cysteine synthase (EC 4.2.99.8) C precurs... 59 3e-07
gi|50419581|ref|XP_458317.1| unnamed protein product [Debaryomyc... 59 3e-07
gi|26248797|ref|NP_754837.1| Cysteine synthase B [Escherichia co... 59 3e-07
gi|34762980|ref|ZP_00143958.1| Cysteine synthase [Fusobacterium ... 59 3e-07
gi|33519956|ref|NP_878788.1| cysteine synthase A [Candidatus Blo... 59 3e-07
gi|49096994|ref|XP_409957.1| hypothetical protein AN5820.2 [Aspe... 59 3e-07
gi|46106314|ref|ZP_00186959.2| COG0031: Cysteine synthase [Rubro... 59 3e-07
gi|46105733|ref|ZP_00185971.2| COG0031: Cysteine synthase [Rubro... 59 3e-07
gi|17548638|ref|NP_521978.1| PROBABLE CYSTEINE SYNTHASE A PROTEI... 59 3e-07
gi|15596129|ref|NP_249623.1| cysteine synthase B [Pseudomonas ae... 59 3e-07
gi|15615833|ref|NP_244137.1| cysteine synthase [Bacillus halodur... 59 3e-07
gi|48772267|ref|ZP_00276609.1| COG0031: Cysteine synthase [Ralst... 58 4e-07
gi|49087428|ref|XP_405650.1| hypothetical protein AN1513.2 [Aspe... 58 4e-07
gi|30063814|ref|NP_837985.1| cysteine synthase B, O-acetylserine... 58 4e-07
gi|24113765|ref|NP_708275.1| cysteine synthase B, O-acetylserine... 58 4e-07
gi|15644737|ref|NP_206907.1| cysteine synthetase (cysK) [Helicob... 58 4e-07
gi|21221357|ref|NP_627136.1| putative cysteine synthase [Strepto... 58 6e-07
gi|34498480|ref|NP_902695.1| cysteine synthase B [Chromobacteriu... 58 6e-07
gi|34392445|dbj|BAC82550.1| cystein synthase [Penicillium chryso... 58 6e-07
gi|29348489|ref|NP_811992.1| cysteine synthase A [Bacteroides th... 58 6e-07
gi|31204057|ref|XP_310977.1| ENSANGP00000019297 [Anopheles gambi... 58 6e-07
gi|12082815|gb|AAG48621.1| cystathionine beta-synthase [Streptom... 58 6e-07
gi|48833439|ref|ZP_00290458.1| COG0031: Cysteine synthase [Magne... 58 6e-07
gi|45524093|ref|ZP_00175401.1| COG0031: Cysteine synthase [Croco... 58 6e-07
gi|46124333|ref|XP_386720.1| hypothetical protein FG06544.1 [Gib... 58 6e-07
gi|15672764|ref|NP_266938.1| cysteine synthase [Lactococcus lact... 58 6e-07
gi|18978230|ref|NP_579587.1| cysteine synthase [Pyrococcus furio... 57 7e-07
gi|15675496|ref|NP_269670.1| putative O-acetylserine lyase [Stre... 57 7e-07
gi|13470597|ref|NP_102166.1| O-acetylserine (thiol) lyase [Mesor... 57 7e-07
gi|15606692|ref|NP_214072.1| cysteine synthase, O-acetylserine (... 57 7e-07
gi|9887217|gb|AAG01804.1| O-acetylserine sulfhydrylase [Methanos... 57 7e-07
gi|27379793|ref|NP_771322.1| cysteine synthase [Bradyrhizobium j... 57 7e-07
gi|48852269|ref|ZP_00306458.1| COG0031: Cysteine synthase [Ferro... 57 7e-07
gi|49236775|ref|ZP_00330832.1| COG0031: Cysteine synthase [Moore... 57 1e-06
gi|33865207|ref|NP_896766.1| O-acetylserine (thiol)-lyase A [Syn... 57 1e-06
gi|14520590|ref|NP_126065.1| cysteine synthase, o-acetylserine (... 57 1e-06
gi|50119836|ref|YP_049003.1| cysteine synthase A [Erwinia caroto... 57 1e-06
gi|48859558|ref|ZP_00313491.1| COG0031: Cysteine synthase [Clost... 57 1e-06
gi|27807844|dbj|BAC55275.1| O-acetyl-L-serine sulfhydrylase [Geo... 57 1e-06
gi|30249414|ref|NP_841484.1| Pyridoxal-5'-phosphate-dependent en... 57 1e-06
gi|1168806|sp|P46794|CBS_DICDI Cystathionine beta-synthase (Seri... 57 1e-06
gi|11269073|pir||T47233 cysteine synthase (EC 4.2.99.8) cysK - L... 57 1e-06
gi|33152038|ref|NP_873391.1| cysteine synthase; O-acetylserine s... 57 1e-06
gi|21673530|ref|NP_661595.1| cysteine synthase [Chlorobium tepid... 57 1e-06
gi|15802947|ref|NP_288976.1| cysteine synthase A, O-acetylserine... 57 1e-06
gi|1799833|dbj|BAA16288.1| CYSTEINE SYNTHASE A (EC 4.2.99.8) (O-... 57 1e-06
gi|6009891|dbj|BAA85110.1| O-acetylserine (thiol) lyase 1 [Cyani... 57 1e-06
gi|25027974|ref|NP_738028.1| putative cysteine synthase [Coryneb... 57 1e-06
gi|23008828|ref|ZP_00050108.1| COG0031: Cysteine synthase [Magne... 57 1e-06
gi|48852813|ref|ZP_00306996.1| COG0031: Cysteine synthase [Ferro... 57 1e-06
gi|29831707|ref|NP_826341.1| putative cysteine synthase [Strepto... 56 2e-06
gi|30840956|gb|AAN86822.1| beta-cyanoalanine synthase [Betula pe... 56 2e-06
gi|28377182|ref|NP_784074.1| cysteine synthase [Lactobacillus pl... 56 2e-06
gi|46114064|ref|ZP_00184293.2| COG0031: Cysteine synthase [Exigu... 56 2e-06
gi|50552620|ref|XP_503720.1| hypothetical protein [Yarrowia lipo... 56 2e-06
gi|13541420|ref|NP_111108.1| Cysteine synthase [Thermoplasma vol... 56 2e-06
gi|19746544|ref|NP_607680.1| putative O-acetylserine lyase [Stre... 56 2e-06
gi|21910899|ref|NP_665167.1| putative O-acetylserine lyase [Stre... 56 2e-06
gi|16123173|ref|NP_406486.1| cysteine synthase A [Yersinia pesti... 56 2e-06
gi|30063808|ref|NP_837979.1| cysteine synthase A, O-acetylserine... 56 2e-06
gi|49072236|ref|XP_400407.1| hypothetical protein UM02792.1 [Ust... 56 2e-06
gi|50730019|ref|XP_416752.1| PREDICTED: similar to hypothetical ... 55 3e-06
gi|23466532|ref|ZP_00122120.1| COG0031: Cysteine synthase [Haemo... 55 3e-06
gi|27469242|ref|NP_765879.1| cysteine synthase [Staphylococcus e... 55 3e-06
gi|33860964|ref|NP_892525.1| O-acetylserine (thiol)-lyase A [Pro... 55 3e-06
gi|24113759|ref|NP_708269.1| cysteine synthase A, O-acetylserine... 55 3e-06
gi|21280312|dbj|BAB96806.1| probable cystathionine beta-synthase... 55 3e-06
gi|48764586|ref|ZP_00269137.1| COG0031: Cysteine synthase [Rhodo... 55 3e-06
gi|48845587|ref|ZP_00299864.1| COG0031: Cysteine synthase [Geoba... 55 3e-06
gi|20091544|ref|NP_617619.1| cysteine synthase [Methanosarcina a... 55 3e-06
gi|11559260|dbj|BAB18760.1| beta-cyanoalanine synthase [Solanum ... 55 3e-06
gi|32029221|ref|ZP_00132275.1| COG0031: Cysteine synthase [Haemo... 55 4e-06
gi|23465722|ref|NP_696325.1| cystathionine beta-synthase [Bifido... 55 4e-06
gi|3776243|gb|AAC64684.1| cystathionine beta-synthase minor isof... 55 4e-06
gi|32265562|ref|NP_859594.1| cysteine synthase [Helicobacter hep... 55 4e-06
gi|23335763|ref|ZP_00120996.1| COG0031: Cysteine synthase [Bifid... 55 4e-06
gi|4557415|ref|NP_000062.1| cystathionine-beta-synthase; serine ... 55 4e-06
gi|12653343|gb|AAH00440.1| CBS protein [Homo sapiens] 55 4e-06
gi|3850687|emb|CAA61252.1| cystathionine beta-synthase [Homo sap... 55 4e-06
gi|30585233|gb|AAP36889.1| Homo sapiens cystathionine-beta-synth... 55 4e-06
gi|15923449|ref|NP_370983.1| cysteine synthase homologue [Staphy... 55 4e-06
gi|15825696|pdb|1JBQ|A Chain A, Structure Of Human Cystathionine... 55 4e-06
gi|2493891|sp|Q59447|CYSK_FLAS3 Cysteine synthase (O-acetylserin... 55 4e-06
gi|15894218|ref|NP_347567.1| Cysteine synthase [Clostridium acet... 55 4e-06
gi|28868898|ref|NP_791517.1| cysteine synthase B [Pseudomonas sy... 55 4e-06
gi|23200446|pdb|1M54|A Chain A, Cystathionine-Beta Synthase: Red... 55 4e-06
gi|34499016|ref|NP_903231.1| cysteine synthase [Chromobacterium ... 55 5e-06
gi|22958488|ref|ZP_00006158.1| COG0031: Cysteine synthase [Rhodo... 55 5e-06
gi|39933634|ref|NP_945910.1| cysteine synthase, cytosolic O-acet... 55 5e-06
gi|48824002|ref|ZP_00285445.1| COG0031: Cysteine synthase [Enter... 55 5e-06
gi|26248790|ref|NP_754830.1| Cysteine synthase A [Escherichia co... 55 5e-06
gi|21666608|gb|AAM73774.1| cystathionine beta synthase [Magnapor... 55 5e-06
gi|6807800|emb|CAB70691.1| hypothetical protein [Homo sapiens] 55 5e-06
gi|17545636|ref|NP_519038.1| PROBABLE CYSTEINE SYNTHASE B (CSASE... 55 5e-06
gi|15228596|ref|NP_187013.1| cysteine synthase, chloroplast, put... 55 5e-06
gi|46364811|ref|ZP_00227382.1| COG0031: Cysteine synthase [Kineo... 54 6e-06
gi|21672356|ref|NP_660423.1| cysteine synthase A [Buchnera aphid... 54 6e-06
gi|16761350|ref|NP_456967.1| cysteine synthase A [Salmonella ent... 54 6e-06
gi|32422639|ref|XP_331763.1| hypothetical protein [Neurospora cr... 54 6e-06
gi|50590891|ref|ZP_00332232.1| COG0031: Cysteine synthase [Strep... 54 6e-06
gi|47565578|ref|ZP_00236619.1| threonine dehydratase [Bacillus c... 54 8e-06
gi|29374928|ref|NP_814081.1| cysteine synthase B, putative [Ente... 54 8e-06
gi|2121038|pir||S52983 probable cystathionine gamma-lyase (EC 4.... 54 8e-06
gi|6567187|dbj|BAA88310.1| O-acetylserine lyase [Streptococcus s... 54 8e-06
gi|22536517|ref|NP_687368.1| cysteine synthase A [Streptococcus ... 54 8e-06
gi|12644209|sp|P32260|CYSL_SPIOL Cysteine synthase, chloroplast ... 54 8e-06
gi|303902|dbj|BAA03542.1| cysteine synthase [Spinacia oleracea] 54 8e-06
gi|421795|pir||S29733 cysteine synthase (EC 4.2.99.8) B precurso... 54 8e-06
gi|46199938|ref|YP_005605.1| cysteine synthase [Thermus thermoph... 54 8e-06
gi|15640559|ref|NP_230188.1| cysteine synthase B [Vibrio cholera... 54 8e-06
gi|19553335|ref|NP_601337.1| cysteine synthase [Corynebacterium ... 54 8e-06
gi|32473073|ref|NP_866067.1| cysteine synthase [Pirellula sp. 1]... 54 1e-05
gi|23102808|ref|ZP_00089307.1| COG0031: Cysteine synthase [Azoto... 54 1e-05
gi|39590981|emb|CAE58761.1| Hypothetical protein CBG01953 [Caeno... 54 1e-05
gi|49482684|ref|YP_039908.1| pyridoxal-phosphate dependent enzym... 54 1e-05
gi|416161|dbj|BAA03952.1| cystathionine beta-synthase [Saccharom... 54 1e-05
gi|29832158|ref|NP_826792.1| putative cysteine synthase (O-acety... 54 1e-05
gi|10241630|emb|CAC09469.1| cysteine synthase [Oryza sativa (ind... 53 1e-05
gi|6980381|pdb|1OAS|A Chain A, O-Acetylserine Sulfhydrylase From... 53 1e-05
gi|572517|emb|CAA57344.1| cysteine synthase [Arabidopsis thaliana] 53 1e-05
gi|15612651|ref|NP_240954.1| cysteine synthase A [Bacillus halod... 53 1e-05
gi|45516625|ref|ZP_00168177.1| COG0031: Cysteine synthase [Ralst... 53 1e-05
gi|45915507|ref|ZP_00194190.2| COG0031: Cysteine synthase [Mesor... 53 2e-05
gi|38346461|emb|CAE02117.2| OSJNBa0019G23.9 [Oryza sativa (japon... 53 2e-05
gi|7579023|gb|AAF64226.1| cystathionine beta-synthase [Oryctolag... 53 2e-05
gi|47566560|ref|ZP_00237382.1| cysteine synthase/cystathionine b... 53 2e-05
gi|50286793|ref|XP_445826.1| unnamed protein product [Candida gl... 53 2e-05
gi|46322209|ref|ZP_00222580.1| COG0031: Cysteine synthase [Burkh... 53 2e-05
gi|6321594|ref|NP_011671.1| encodes the first enzyme in cysteine... 53 2e-05
gi|48730621|ref|ZP_00264368.1| COG0031: Cysteine synthase [Pseud... 53 2e-05
gi|15827370|ref|NP_301633.1| putative cysteine synthase [Mycobac... 52 2e-05
gi|11131899|sp|Q9XEA6|CYK1_ORYSA Cysteine synthase (O-acetylseri... 52 2e-05
gi|37679163|ref|NP_933772.1| cysteine synthase A [Vibrio vulnifi... 52 2e-05
gi|24374432|ref|NP_718475.1| cysteine synthase A [Shewanella one... 52 2e-05
gi|23099158|ref|NP_692624.1| cysteine synthase [Oceanobacillus i... 52 2e-05
gi|415317|dbj|BAA03947.1| cystathionine beta-synthase [Saccharom... 52 2e-05
gi|17987216|ref|NP_539850.1| CYSTEINE SYNTHASE [Brucella meliten... 52 2e-05
gi|48477223|ref|YP_022929.1| cysteine synthase [Picrophilus torr... 52 3e-05
gi|21399732|ref|NP_655717.1| PALP, Pyridoxal-phosphate dependent... 52 3e-05
gi|48863355|ref|ZP_00317249.1| COG0031: Cysteine synthase [Micro... 52 3e-05
gi|2209126|gb|AAB95443.1| O-acetylserine (thiol)-lyase [Rhodobac... 52 3e-05
gi|16801164|ref|NP_471432.1| similar to threonine dehydratase [L... 52 3e-05
gi|6009893|dbj|BAA85111.1| O-acetylserine (thiol) lyase 2 [Cyani... 52 3e-05
gi|50260416|gb|EAL23073.1| hypothetical protein CNBA5980 [Crypto... 52 3e-05
gi|46143473|ref|ZP_00135187.2| COG0031: Cysteine synthase [Actin... 52 4e-05
gi|30261894|ref|NP_844271.1| threonine dehydratase, biosynthetic... 52 4e-05
gi|30019923|ref|NP_831554.1| Threonine dehydratase [Bacillus cer... 52 4e-05
gi|33866754|ref|NP_898313.1| O-acetylserine (thiol)-lyase A [Syn... 52 4e-05
gi|16125675|ref|NP_420239.1| cysteine synthase [Caulobacter cres... 52 4e-05
gi|6552355|dbj|BAA88219.1| cysteine synthase 1 [Entamoeba dispar] 52 4e-05
gi|15224351|ref|NP_181903.1| cysteine synthase, chloroplast / O-... 52 4e-05
gi|7481864|pir||T30242 cystathione synthase homolog - Streptomyc... 52 4e-05
gi|47220970|emb|CAF98199.1| unnamed protein product [Tetraodon n... 52 4e-05
gi|47096634|ref|ZP_00234222.1| threonine dehydratase, biosynthet... 52 4e-05
gi|46908218|ref|YP_014607.1| threonine dehydratase [Listeria mon... 52 4e-05
gi|16804030|ref|NP_465515.1| similar to threonine dehydratase [L... 52 4e-05
gi|5924398|gb|AAD56585.2| cysteine synthase [Geobacillus thermol... 52 4e-05
gi|23501931|ref|NP_698058.1| cysteine synthase [Brucella suis 13... 52 4e-05
gi|49481117|ref|YP_036027.1| threonine dehydratase [Bacillus thu... 51 5e-05
gi|4584120|emb|CAB40616.1| threonine dehydratase [Bacillus cereus] 51 5e-05
gi|68323|pir||SYEBAC cysteine synthase (EC 4.2.99.8) A - Salmone... 51 5e-05
gi|145686|gb|AAA23654.1| cysK protein 51 5e-05
gi|33239595|ref|NP_874537.1| Cysteine synthase [Prochlorococcus ... 51 5e-05
gi|42781007|ref|NP_978254.1| threonine dehydratase, biosynthetic... 51 5e-05
gi|15233111|ref|NP_191703.1| cysteine synthase, putative / O-ace... 51 5e-05
gi|23106070|ref|ZP_00092524.1| COG0031: Cysteine synthase [Azoto... 51 5e-05
gi|15611169|ref|NP_222820.1| CYSTEINE SYNTHASE [Helicobacter pyl... 51 5e-05
gi|231970|sp|Q00834|CYSK_SPIOL Cysteine synthase (O-acetylserine... 51 5e-05
gi|15608476|ref|NP_215852.1| cysM [Mycobacterium tuberculosis H3... 51 7e-05
gi|7188603|gb|AAF37822.1| cysteine sulfhydrylase [Salmonella ent... 51 7e-05
gi|7767090|pdb|1D6S|A Chain A, Crystal Structure Of The K41a Mut... 51 7e-05
gi|15640984|ref|NP_230615.1| cysteine synthase A [Vibrio cholera... 51 7e-05
gi|15603558|ref|NP_246632.1| CysK [Pasteurella multocida Pm70] >... 51 7e-05
gi|41351505|dbj|BAD08329.1| cysteine synthase like protein [Spin... 51 7e-05
gi|42783501|ref|NP_980748.1| O-acetylserine lyase [Bacillus cere... 51 7e-05
gi|30018339|ref|NP_829970.1| Cysteine synthase [Bacillus cereus ... 51 7e-05
gi|47226949|emb|CAG05841.1| unnamed protein product [Tetraodon n... 51 7e-05
gi|32967977|gb|AAP92492.1| 2,3-diaminopropionate synthase [Strep... 50 9e-05
gi|15609471|ref|NP_216850.1| cysK [Mycobacterium tuberculosis H3... 50 9e-05
gi|33862497|ref|NP_894057.1| O-acetylserine (thiol)-lyase A [Pro... 50 9e-05
gi|46912485|emb|CAG19277.1| putative cysteine synthase A [Photob... 50 9e-05
gi|15643430|ref|NP_228474.1| cysteine synthase [Thermotoga marit... 50 9e-05
gi|42779147|ref|NP_976394.1| cysteine synthase A [Bacillus cereu... 50 9e-05
gi|34810049|pdb|1O58|A Chain A, Crystal Structure Of Cysteine Sy... 50 9e-05
gi|46140457|ref|ZP_00151993.2| COG0031: Cysteine synthase [Dechl... 50 9e-05
gi|4574141|gb|AAD23910.1| cysteine synthase [Oryza sativa] 50 9e-05
gi|48766520|ref|ZP_00271070.1| COG0031: Cysteine synthase [Rhodo... 50 9e-05
gi|7436947|pir||T07962 probable cysteine synthase (EC 4.2.99.8) ... 50 1e-04
gi|21402417|ref|NP_658402.1| PALP, Pyridoxal-phosphate dependent... 50 1e-04
gi|50842447|ref|YP_055674.1| cysteine synthase [Propionibacteriu... 50 1e-04
gi|39589200|emb|CAE57933.1| Hypothetical protein CBG00986 [Caeno... 50 1e-04
gi|37525351|ref|NP_928695.1| cysteine synthase A (O-acetylserine... 50 1e-04
gi|33860683|ref|NP_892244.1| O-acetylserine (thiol)-lyase A [Pro... 50 2e-04
gi|15895503|ref|NP_348852.1| Cysteine synthase/cystathionine bet... 50 2e-04
gi|17535051|ref|NP_497008.1| cysteine synthase spiol family mem... 50 2e-04
gi|21398032|ref|NP_654017.1| PALP, Pyridoxal-phosphate dependent... 50 2e-04
gi|30022448|ref|NP_834079.1| Cysteine synthase [Bacillus cereus ... 50 2e-04
gi|33239855|ref|NP_874797.1| Cysteine synthase [Prochlorococcus ... 49 2e-04
gi|48890648|ref|ZP_00324289.1| COG0031: Cysteine synthase [Trich... 49 2e-04
gi|13473875|ref|NP_105443.1| cysteine synthase, cytosolic O-acet... 49 2e-04
gi|16081644|ref|NP_394010.1| cysteine synthase related protein [... 49 2e-04
gi|48784745|ref|ZP_00281050.1| COG0031: Cysteine synthase [Burkh... 49 2e-04
gi|7384808|dbj|BAA93051.1| cysteine synthase [Allium tuberosum] 49 2e-04
gi|48771072|ref|ZP_00275415.1| COG0031: Cysteine synthase [Ralst... 49 2e-04
gi|22331875|ref|NP_191535.2| cysteine synthase, mitochondrial, p... 49 3e-04
gi|30695056|ref|NP_851022.1| cysteine synthase, mitochondrial, p... 49 3e-04
gi|25291707|pir||T52650 cysteine synthase (EC 4.2.99.8) precurso... 49 3e-04
gi|27363691|ref|NP_759219.1| Cysteine synthase A [Vibrio vulnifi... 49 3e-04
gi|30695058|ref|NP_851023.1| cysteine synthase, mitochondrial, p... 49 3e-04
gi|31195963|ref|XP_306929.1| ENSANGP00000000454 [Anopheles gambi... 49 3e-04
gi|11269069|pir||T47800 cysteine synthase (EC 4.2.99.8) F24G16.3... 49 3e-04
gi|4204469|gb|AAD13393.1| cystathionine beta-synthetase; CBS [Ta... 49 3e-04
gi|41408221|ref|NP_961057.1| CysK [Mycobacterium avium subsp. pa... 49 3e-04
gi|50084819|ref|YP_046329.1| subunit of cysteine synthase A and ... 49 3e-04
gi|11131628|sp|O81155|CYSL_SOLTU Cysteine synthase, chloroplast ... 49 3e-04
gi|46112937|ref|ZP_00200641.1| COG0031: Cysteine synthase [Exigu... 49 3e-04
gi|15897295|ref|NP_341900.1| Cysteine synthase B (cysM) [Sulfolo... 48 4e-04
gi|46441063|gb|EAL00363.1| hypothetical protein CaO19.13020 [Can... 48 4e-04
gi|23471032|ref|ZP_00126363.1| COG0031: Cysteine synthase [Pseud... 48 4e-04
gi|38234460|ref|NP_940227.1| Putative cysteine synthase [Coryneb... 48 4e-04
gi|47572535|ref|ZP_00242578.1| COG0031: Cysteine synthase [Rubri... 48 4e-04
gi|11995005|dbj|BAB20032.1| beta-cyanoalanine synthase like prot... 48 4e-04
gi|46316706|ref|ZP_00217285.1| COG0031: Cysteine synthase [Burkh... 48 4e-04
gi|15825003|gb|AAL09565.1| cystathionine beta-synthase [Pichia p... 48 4e-04
gi|28897571|ref|NP_797176.1| cysteine synthase A [Vibrio parahae... 48 6e-04
gi|23098563|ref|NP_692029.1| cysteine synthase [Oceanobacillus i... 48 6e-04
gi|17550510|ref|NP_509670.1| cysteine synthase spiol (XK572) [C... 48 6e-04
gi|11131901|sp|Q9XEA8|CYK2_ORYSA Cysteine synthase (O-acetylseri... 48 6e-04
gi|21954802|ref|NP_665787.1| pANL49 [Synechococcus elongatus PCC... 48 6e-04
gi|13540902|ref|NP_110590.1| Threonine synthase [Thermoplasma vo... 47 8e-04
gi|37520334|ref|NP_923711.1| cysteine synthase [Gloeobacter viol... 47 8e-04
gi|15241112|ref|NP_198155.1| cysteine synthase, putative / O-ace... 47 8e-04
gi|33592115|ref|NP_879759.1| cysteine synthase B [Bordetella per... 47 8e-04
gi|33597654|ref|NP_885297.1| cysteine synthase B [Bordetella par... 47 8e-04
gi|26988386|ref|NP_743811.1| cysteine synthase B [Pseudomonas pu... 47 8e-04
gi|18252506|gb|AAL66291.1| cysteine synthase [Glycine max] 47 8e-04
gi|29347262|ref|NP_810765.1| cysteine synthase A [Bacteroides th... 47 8e-04
gi|16330042|ref|NP_440770.1| cysteine synthase [Synechocystis sp... 47 0.001
gi|29655305|ref|NP_820997.1| cystathionine beta-synthase, putati... 47 0.001
gi|26991255|ref|NP_746680.1| cysteine synthase A [Pseudomonas pu... 47 0.001
gi|23116689|ref|ZP_00101116.1| COG0031: Cysteine synthase [Desul... 47 0.001
gi|6225232|sp|P73410|CYSK_SYNY3 Cysteine synthase (O-acetylserin... 47 0.001
gi|49083718|gb|AAT51121.1| PA2709 [synthetic construct] 47 0.001
gi|2829688|sp|P80608|CYSK_MAIZE Cysteine synthase (O-acetylserin... 47 0.001
gi|23125839|ref|ZP_00107756.1| COG0031: Cysteine synthase [Nosto... 47 0.001
gi|16127855|ref|NP_422419.1| cysteine synthase [Caulobacter cres... 47 0.001
gi|17987218|ref|NP_539852.1| THREONINE DEHYDRATASE BIOSYNTHETIC ... 47 0.001
gi|22970040|ref|ZP_00017205.1| hypothetical protein [Chloroflexu... 47 0.001
gi|12081919|dbj|BAB20862.1| plastidic cysteine synthase 1 [Solan... 47 0.001
gi|15597905|ref|NP_251399.1| cysteine synthase A [Pseudomonas ae... 47 0.001
gi|585032|sp|P38076|CYSK_WHEAT Cysteine synthase (O-acetylserine... 47 0.001
gi|45657930|ref|YP_002016.1| cysteine synthase [Leptospira inter... 46 0.002
gi|50308057|ref|XP_454029.1| unnamed protein product [Kluyveromy... 46 0.002
gi|15900367|ref|NP_344971.1| threonine dehydratase [Streptococcu... 46 0.002
gi|23394394|gb|AAN31486.1| cystathionine beta-synthase [Phytopht... 46 0.002
gi|18087669|gb|AAL58961.1| cysteine synthase, 5'-partial [Oryza ... 46 0.002
gi|24214419|ref|NP_711900.1| Cysteine synthase [Leptospira inter... 46 0.002
gi|15897418|ref|NP_342023.1| Threonine synthase (thrC-1) [Sulfol... 46 0.002
gi|1488519|emb|CAA57498.1| cysteine synthase [Arabidopsis thaliana] 46 0.002
gi|48785260|ref|ZP_00281510.1| COG0031: Cysteine synthase [Burkh... 46 0.002
gi|48835731|ref|ZP_00292730.1| COG0031: Cysteine synthase [Therm... 46 0.002
gi|399333|sp|P31300|CYSL_CAPAN Cysteine synthase, chloroplast pr... 46 0.002
gi|32452331|emb|CAD59397.1| putative cysteine synthase 1 [Propio... 46 0.002
gi|393279|gb|AAC37401.1| cystathionine beta-synthase 46 0.002
gi|48866719|ref|ZP_00320466.1| COG0031: Cysteine synthase [Haemo... 45 0.003
gi|50255003|gb|EAL17743.1| hypothetical protein CNBL2560 [Crypto... 45 0.003
gi|6552357|dbj|BAA88220.1| cysteine synthase 2 [Entamoeba dispar] 45 0.003
gi|48823911|ref|ZP_00285367.1| COG0031: Cysteine synthase [Enter... 45 0.003
gi|50590189|ref|ZP_00331602.1| COG1171: Threonine dehydratase [S... 45 0.003
gi|45545538|ref|ZP_00185687.1| COG0031: Cysteine synthase [Rubro... 45 0.003
gi|15608217|ref|NP_215593.1| cysM2 [Mycobacterium tuberculosis H... 45 0.004
gi|12081921|dbj|BAB20863.1| plastidic cysteine synthase 2 [Solan... 45 0.005
gi|15964093|ref|NP_384446.1| PROBABLE CYSTEINE SYNTHASE A (O-ACE... 45 0.005
gi|34906120|ref|NP_914407.1| putative plastidic cysteine synthas... 45 0.005
gi|11131564|sp|O23735|CYK2_BRAJU Cysteine synthase (O-acetylseri... 45 0.005
gi|48865704|ref|ZP_00319563.1| COG0031: Cysteine synthase [Oenoc... 45 0.005
gi|15027937|gb|AAK76499.1| putative cytosolic O-acetylserine(thi... 44 0.006
gi|38350579|gb|AAR18402.1| cysteine synthase [Nicotiana plumbagi... 44 0.006
gi|2346964|dbj|BAA21916.1| cysteine synthase [Entamoeba histolyt... 44 0.006
gi|23472306|ref|ZP_00127632.1| COG0031: Cysteine synthase [Pseud... 44 0.006
gi|34099833|gb|AAQ57205.1| O-acetylserine (thiol)lyase [Populus ... 44 0.006
gi|42631407|ref|ZP_00156945.1| COG0031: Cysteine synthase [Haemo... 44 0.008
gi|804950|emb|CAA58893.1| cysteine synthase [Arabidopsis thalian... 44 0.008
gi|15233613|ref|NP_193224.1| cysteine synthase / O-acetylserine ... 44 0.008
gi|17534315|ref|NP_494215.1| cystathionine beta-synthase (2C510)... 44 0.008
gi|24378744|ref|NP_720699.1| threonine dehydratase [Streptococcu... 44 0.008
gi|7436949|pir||T09000 cysteine synthase (EC 4.2.99.8) - spinach... 44 0.008
gi|6685117|gb|AAF23788.1| CysZ [Zymomonas mobilis] 44 0.008
gi|24378980|ref|NP_720935.1| putative cysteine synthetase A; O-a... 44 0.008
gi|46129027|ref|ZP_00155629.2| COG0031: Cysteine synthase [Haemo... 44 0.011
gi|16273029|ref|NP_439260.1| cysteine synthetase [Haemophilus in... 44 0.011
gi|22298047|ref|NP_681294.1| cysteine synthase [Thermosynechococ... 44 0.011
gi|23129136|ref|ZP_00110969.1| COG0031: Cysteine synthase [Nosto... 44 0.011
gi|41690092|ref|ZP_00146624.1| COG0031: Cysteine synthase [Psych... 44 0.011
gi|3127890|emb|CAA06819.1| cysteine synthase, O-acetyl-L-serine ... 44 0.011
gi|1084347|pir||S48695 cysteine synthase (EC 4.2.99.8) isoform 7... 44 0.011
gi|37528387|ref|NP_931732.1| hypothetical protein [Photorhabdus ... 44 0.011
gi|46118236|ref|ZP_00174850.2| COG0031: Cysteine synthase [Croco... 43 0.014
gi|15887662|ref|NP_353343.1| AGR_C_543p [Agrobacterium tumefacie... 43 0.014
gi|40782203|emb|CAE45017.1| putative o-acetylserine thiol lyase ... 43 0.014
gi|17986385|ref|NP_539019.1| CYSTEINE SYNTHASE A [Brucella melit... 43 0.014
gi|15614274|ref|NP_242577.1| threonine dehydratase [Bacillus hal... 43 0.014
gi|2366771|dbj|BAA22144.1| cysteine synthase type II [Entamoeba ... 43 0.014
gi|48851621|ref|ZP_00305826.1| COG0498: Threonine synthase [Ferr... 43 0.014
gi|6899994|emb|CAB71303.1| o-acetylserine sulfhydrylase [Clostri... 43 0.014
gi|17298074|dbj|BAB78511.1| cystathionine beta-synthase [Pichia ... 43 0.014
>gi|17539800|ref|NP_501928.1| cysteine synthase precursor (48.7 kD)
(4L210) [Caenorhabditis elegans]
gi|7498980|pir||T20819 hypothetical protein F13B12.4 - Caenorhabditis
elegans
gi|3875828|emb|CAA94589.1| Hypothetical protein F13B12.4
[Caenorhabditis elegans]
Length = 435
Score = 855 bits (2210), Expect = 0.0
Identities = 417/417 (100%), Positives = 417/417 (100%)
Frame = -1
Query: 1254 EDITKISESRIPNEDAVPDYEAKWRLGAIQKLWNERRKMGHTPMTKFSPPGFPNADIFFK 1075
EDITKISESRIPNEDAVPDYEAKWRLGAIQKLWNERRKMGHTPMTKFSPPGFPNADIFFK
Sbjct: 19 EDITKISESRIPNEDAVPDYEAKWRLGAIQKLWNERRKMGHTPMTKFSPPGFPNADIFFK 78
Query: 1074 NETATATRTLKHRFAWALLLWAITEGKVTSKTSAVYDSTSGNTGSAEAYMCTLVNVPYYA 895
NETATATRTLKHRFAWALLLWAITEGKVTSKTSAVYDSTSGNTGSAEAYMCTLVNVPYYA
Sbjct: 79 NETATATRTLKHRFAWALLLWAITEGKVTSKTSAVYDSTSGNTGSAEAYMCTLVNVPYYA 138
Query: 894 VVADNLEKEKVKQIESFGGKIIKVPVALRNAKAKEFADKNHGFYMNQFGNAEKAEEFHES 715
VVADNLEKEKVKQIESFGGKIIKVPVALRNAKAKEFADKNHGFYMNQFGNAEKAEEFHES
Sbjct: 139 VVADNLEKEKVKQIESFGGKIIKVPVALRNAKAKEFADKNHGFYMNQFGNAEKAEEFHES 198
Query: 714 GDFYFESTNVYHEIIVQLKKDKEQIVKIPDYFVHSAGTGGTISSVGRYVARYGAPTKVVL 535
GDFYFESTNVYHEIIVQLKKDKEQIVKIPDYFVHSAGTGGTISSVGRYVARYGAPTKVVL
Sbjct: 199 GDFYFESTNVYHEIIVQLKKDKEQIVKIPDYFVHSAGTGGTISSVGRYVARYGAPTKVVL 258
Query: 534 SDSQYSLFYDYVIGHKFTNQSGAGIWTPPGIAGIGYGYDIEPVWYGETTSLTRNVIHEAM 355
SDSQYSLFYDYVIGHKFTNQSGAGIWTPPGIAGIGYGYDIEPVWYGETTSLTRNVIHEAM
Sbjct: 259 SDSQYSLFYDYVIGHKFTNQSGAGIWTPPGIAGIGYGYDIEPVWYGETTSLTRNVIHEAM 318
Query: 354 KMPDIASVATMRILDEKGYNVGPSTSLNFLVSLYKAYQNKARKSAIKHRLTIVTLACDPG 175
KMPDIASVATMRILDEKGYNVGPSTSLNFLVSLYKAYQNKARKSAIKHRLTIVTLACDPG
Sbjct: 319 KMPDIASVATMRILDEKGYNVGPSTSLNFLVSLYKAYQNKARKSAIKHRLTIVTLACDPG 378
Query: 174 DFYRSTYLNNEWVEKSFKKFGGVMGMECWKKLIQESIDTGSDFYSKGLTMCPGAFKV 4
DFYRSTYLNNEWVEKSFKKFGGVMGMECWKKLIQESIDTGSDFYSKGLTMCPGAFKV
Sbjct: 379 DFYRSTYLNNEWVEKSFKKFGGVMGMECWKKLIQESIDTGSDFYSKGLTMCPGAFKV 435