Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F10D7_2
(1338 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17551570|ref|NP_510814.1| tetracycline transporter-like prote... 807 0.0
gi|39596047|emb|CAE69683.1| Hypothetical protein CBG15936 [Caeno... 770 0.0
gi|47221449|emb|CAG08111.1| unnamed protein product [Tetraodon n... 296 7e-79
gi|47124850|gb|AAH70866.1| MGC84630 protein [Xenopus laevis] 296 1e-78
gi|31242629|ref|XP_321745.1| ENSANGP00000016823 [Anopheles gambi... 286 8e-76
gi|13386144|ref|NP_080936.1| tetracycline transporter-like prote... 278 2e-73
gi|17738085|ref|NP_524429.1| CG5760-PA [Drosophila melanogaster]... 273 9e-72
gi|34878487|ref|XP_223533.2| similar to tetracycline transporter... 270 7e-71
gi|20127440|ref|NP_001111.2| tetracycline transporter-like prote... 264 4e-69
gi|15929042|gb|AAH14979.1| Tetracycline transporter-like protein... 264 4e-69
gi|50747296|ref|XP_420825.1| PREDICTED: similar to tetracycline ... 248 2e-64
gi|32422093|ref|XP_331490.1| hypothetical protein [Neurospora cr... 209 9e-53
gi|46129250|ref|XP_388986.1| hypothetical protein FG08810.1 [Gib... 201 3e-50
gi|38100342|gb|EAA47479.1| hypothetical protein MG02722.4 [Magna... 199 2e-49
gi|50259269|gb|EAL21942.1| hypothetical protein CNBC0820 [Crypto... 194 4e-48
gi|49095632|ref|XP_409277.1| hypothetical protein AN5140.2 [Aspe... 191 3e-47
gi|12834627|dbj|BAB22982.1| unnamed protein product [Mus musculus] 169 1e-40
gi|24214633|ref|NP_712114.1| tetracycline resistance protein [Le... 137 4e-31
gi|48141033|ref|XP_393532.1| similar to CG5760-PA [Apis mellifera] 135 2e-30
gi|48855714|ref|ZP_00309872.1| COG0477: Permeases of the major f... 124 5e-27
gi|48833477|ref|ZP_00290496.1| COG0477: Permeases of the major f... 119 2e-25
gi|42522244|ref|NP_967624.1| tetracycline-efflux transporter [Bd... 107 6e-22
gi|23124389|ref|ZP_00106381.1| COG0477: Permeases of the major f... 107 6e-22
gi|48862500|ref|ZP_00316396.1| COG0477: Permeases of the major f... 102 3e-20
gi|37521059|ref|NP_924436.1| tetracycline resistance protein [Gl... 100 1e-19
gi|42522069|ref|NP_967449.1| multidrug resistance protein [Bdell... 99 3e-19
gi|22297683|ref|NP_680930.1| multidrug-efflux transporter [Therm... 98 5e-19
gi|21673820|ref|NP_661885.1| drug resistance protein, putative [... 97 9e-19
gi|22971126|ref|ZP_00018116.1| hypothetical protein [Chloroflexu... 96 1e-18
gi|23111368|ref|ZP_00097036.1| COG0477: Permeases of the major f... 94 6e-18
gi|29169138|gb|AAO66313.1| adventurous gliding motility protein ... 91 5e-17
gi|15805499|ref|NP_294195.1| tetracycline-efflux transporter [De... 90 1e-16
gi|16125530|ref|NP_420094.1| tetracycline resistance protein [Ca... 89 2e-16
gi|33862251|ref|NP_893812.1| multidrug efflux transporter, MFS f... 89 2e-16
gi|15894049|ref|NP_347398.1| Permease, probably tetracycline res... 89 2e-16
gi|47076809|dbj|BAD18350.1| multidrug-efflux transporter [Geobac... 89 2e-16
gi|13472258|ref|NP_103825.1| probable transporter [Mesorhizobium... 89 3e-16
gi|47076760|dbj|BAD18304.1| multidrug-efflux transporter [Geobac... 87 7e-16
gi|33867024|ref|NP_898583.1| multidrug efflux transporter, MFS f... 86 2e-15
gi|21227567|ref|NP_633489.1| hypothetical membrane spanning prot... 86 2e-15
gi|45658207|ref|YP_002293.1| permease [Leptospira interrogans se... 84 6e-15
gi|47094845|ref|ZP_00232459.1| tetracycline resistance protein [... 84 8e-15
gi|45513480|ref|ZP_00165046.1| COG0477: Permeases of the major f... 84 8e-15
gi|24214072|ref|NP_711553.1| Tetracycline resistance protein, cl... 84 8e-15
gi|48850461|ref|ZP_00304703.1| COG0477: Permeases of the major f... 83 1e-14
gi|15965332|ref|NP_385685.1| PUTATIVE TRANSPORT TRANSMEMBRANE PR... 83 2e-14
gi|16802880|ref|NP_464365.1| similar to Tetracycline resistance ... 82 2e-14
gi|33241310|ref|NP_876252.1| Permease of the major facilitator s... 82 2e-14
gi|15890776|ref|NP_356448.1| AGR_L_1300p [Agrobacterium tumefaci... 82 3e-14
gi|47092046|ref|ZP_00229839.1| tetracycline resistance protein [... 82 3e-14
gi|16799904|ref|NP_470172.1| similar to Tetracycline resistance ... 82 3e-14
gi|30020533|ref|NP_832164.1| Tetracycline resistance protein [Ba... 81 5e-14
gi|42781566|ref|NP_978813.1| tetracycline-efflux transporter, pu... 81 5e-14
gi|46907070|ref|YP_013459.1| tetracycline resistance protein [Li... 81 5e-14
gi|39936157|ref|NP_948433.1| putative tetracycline-efflux transp... 81 6e-14
gi|27379165|ref|NP_770694.1| tetracycline resistance protein [Br... 80 8e-14
gi|21245007|ref|NP_644589.1| tetracycline-efflux transporter [Xa... 80 8e-14
gi|32471188|ref|NP_864181.1| tetracycline-efflux transporter [Pi... 79 2e-13
gi|33864508|ref|NP_896068.1| multidrug efflux transporter, MFS f... 79 2e-13
gi|22959364|ref|ZP_00007017.1| COG0477: Permeases of the major f... 79 3e-13
gi|21233573|ref|NP_639490.1| tetracycline-efflux transporter [Xa... 79 3e-13
gi|21228433|ref|NP_634355.1| Uncharacterized permease [Methanosa... 79 3e-13
gi|49474482|ref|YP_032524.1| Probable transporter [Bartonella qu... 78 4e-13
gi|47571782|ref|ZP_00241831.1| COG0477: Permeases of the major f... 77 7e-13
gi|48478602|ref|YP_024308.1| tetracycline resistance protein [Pi... 77 9e-13
gi|47570075|ref|ZP_00240735.1| tetracycline-efflux transporter, ... 76 2e-12
gi|20089067|ref|NP_615142.1| class H tetracycline resistance eff... 76 2e-12
gi|20090207|ref|NP_616282.1| drug-efflux transporter [Methanosar... 75 3e-12
gi|18313429|ref|NP_560096.1| tetracycline resistance protein [Py... 74 8e-12
gi|15672288|ref|NP_266462.1| multidrug-efflux transporter [Lacto... 73 1e-11
gi|48823917|ref|ZP_00285373.1| COG0477: Permeases of the major f... 73 2e-11
gi|13623283|gb|AAH06242.1| Hypothetical protein MGC11332 [Homo s... 72 2e-11
gi|2274944|emb|CAA04021.1| NapC protein [Enterococcus hirae] 72 2e-11
gi|18478302|emb|CAD22161.1| NapC protein [Enterococcus hirae] 72 2e-11
gi|38049243|gb|AAR10414.1| putative multidrug efflux protein [En... 72 3e-11
gi|48840622|ref|ZP_00297548.1| COG0477: Permeases of the major f... 72 4e-11
gi|46316158|ref|ZP_00216738.1| COG0477: Permeases of the major f... 71 5e-11
gi|15615871|ref|NP_244175.1| multidrug resistance protein [Bacil... 70 9e-11
gi|31377652|ref|NP_116107.2| hypothetical protein MGC11332 [Homo... 70 9e-11
gi|15807163|ref|NP_295892.1| drug transport protein [Deinococcus... 70 9e-11
gi|30794992|ref|NP_851442.1| putative efflux transporter protein... 70 1e-10
gi|27378961|ref|NP_770490.1| bll3850 [Bradyrhizobium japonicum U... 69 2e-10
gi|27369688|ref|NP_766087.1| RIKEN cDNA 4931419K03 [Mus musculus... 69 3e-10
gi|15613737|ref|NP_242040.1| multidrug-efflux transporter [Bacil... 69 3e-10
gi|16079712|ref|NP_390536.1| multidrug-efflux transporter [Bacil... 69 3e-10
gi|42494907|gb|AAS17730.1| tetracycline efflux pump protein [Esc... 69 3e-10
gi|22450182|dbj|BAC10599.1| tetracycline resistance determinant ... 69 3e-10
gi|15596328|ref|NP_249822.1| probable MFS transporter [Pseudomon... 68 4e-10
gi|46200024|ref|YP_005691.1| multidrug resistance protein 2 [The... 68 4e-10
gi|10956601|ref|NP_052571.1| tetracycline resistance protein Tet... 68 6e-10
gi|16082109|ref|NP_394544.1| multidrug-efflux transporter relate... 67 7e-10
gi|23023737|ref|ZP_00062968.1| COG0477: Permeases of the major f... 67 1e-09
gi|47226907|emb|CAG05799.1| unnamed protein product [Tetraodon n... 67 1e-09
gi|34875654|ref|XP_237091.2| similar to RIKEN cDNA 4931419K03 [R... 67 1e-09
gi|12054719|emb|CAC20911.1| tetracycline resistance [Shigella fl... 67 1e-09
gi|29467397|dbj|BAC67143.1| tetB [Gram-negative bacterium TC71] 67 1e-09
gi|29467387|dbj|BAC67138.1| tetB [Gram-negative bacterium TA45] ... 67 1e-09
gi|15020834|emb|CAC44638.1| tetracycline resistance protein, cla... 67 1e-09
gi|29467383|dbj|BAC67136.1| tetB [Gram-negative bacterium TC31] 67 1e-09
gi|29467395|dbj|BAC67142.1| tetB [Pseudomonas sp. TC69] 67 1e-09
gi|29467379|dbj|BAC67134.1| tetB [Photobacterium sp. TC21] >gnl|... 67 1e-09
gi|10955433|ref|NP_061379.1| TetA protein [Escherichia coli] >gn... 67 1e-09
gi|9507600|ref|NP_052931.1| tetracycline resistance protein A [P... 67 1e-09
gi|10957271|ref|NP_058295.1| tetracycline antiporter protein [Sa... 67 1e-09
gi|49480259|ref|YP_035088.1| multidrug resistance protein B [Bac... 67 1e-09
gi|50730468|ref|XP_416919.1| PREDICTED: similar to Hypothetical ... 67 1e-09
gi|22970713|ref|ZP_00017755.1| hypothetical protein [Chloroflexu... 66 2e-09
gi|42780004|ref|NP_977251.1| multidrug resistance protein [Bacil... 65 3e-09
gi|47564775|ref|ZP_00235819.1| NorA [Bacillus cereus G9241] >gnl... 65 3e-09
gi|32029347|ref|ZP_00132380.1| COG0477: Permeases of the major f... 65 4e-09
gi|10129778|emb|CAC08220.1| tetracycline resistance efflux prote... 65 4e-09
gi|46141855|ref|ZP_00147324.2| COG0477: Permeases of the major f... 65 5e-09
gi|4104705|gb|AAD12753.1| tetracycline resistance protein [Prote... 65 5e-09
gi|23928457|ref|NP_478096.2| TetA protein [Corynebacterium gluta... 64 6e-09
gi|21398793|ref|NP_654778.1| sugar_tr, Sugar (and other) transpo... 64 6e-09
gi|16125299|ref|NP_419863.1| multidrug resistance protein, putat... 64 8e-09
gi|1729881|sp|P51564|TCR8_PASMU Tetracycline resistance protein,... 64 8e-09
gi|4138316|emb|CAA76069.1| tetracycline resistance efflux protei... 64 8e-09
gi|30019010|ref|NP_830641.1| Multidrug resistance protein B [Bac... 64 8e-09
gi|15614338|ref|NP_242641.1| multidrug-efflux transporter [Bacil... 64 8e-09
gi|3309049|gb|AAC72341.1| tetracycline resistance protein [IncQ ... 64 8e-09
gi|15672105|ref|NP_266279.1| multidrug efflux transporter [Lacto... 64 1e-08
gi|29375656|ref|NP_814810.1| multidrug resistance protein, putat... 63 1e-08
gi|23112070|ref|ZP_00097608.1| COG0477: Permeases of the major f... 63 2e-08
gi|28610460|emb|CAD32233.1| tetracycline efflux protein [Acineto... 63 2e-08
gi|28377626|ref|NP_784518.1| multidrug transport protein [Lactob... 62 2e-08
gi|24667557|ref|NP_649236.1| CG18281-PA [Drosophila melanogaster... 62 3e-08
gi|32411431|ref|XP_326196.1| hypothetical protein [Neurospora cr... 62 3e-08
gi|29467415|dbj|BAC67152.1| tetY [Photobacterium sp. TC32] >gnl|... 62 3e-08
gi|16151348|emb|CAC80727.1| tetracycline pump TetA(31) [Aeromona... 61 5e-08
gi|30314828|emb|CAD70196.1| putative syringolin A exporter [Pseu... 61 7e-08
gi|46189213|ref|ZP_00124541.2| COG0477: Permeases of the major f... 61 7e-08
gi|22775587|dbj|BAC11911.1| multidrug efflux pump [Enterococcus ... 61 7e-08
gi|15983535|ref|NP_387454.1| tetracycline resistance structural ... 61 7e-08
gi|50747862|ref|XP_421021.1| PREDICTED: similar to Solute carrie... 60 9e-08
gi|48870975|ref|ZP_00323692.1| COG0477: Permeases of the major f... 60 9e-08
gi|1236519|gb|AAA92917.1| tetracycline resistance protein 60 1e-07
gi|15983524|ref|NP_387461.1| tetracycline resistance structural ... 60 1e-07
gi|40850635|gb|AAR96034.1| Tet(C) [Chlamydia suis] 60 1e-07
gi|984918|gb|AAC53625.1| tetracycline resistance protein >gnl|BL... 60 1e-07
gi|40850645|gb|AAR96043.1| Tet(C) [Chlamydia suis] 60 1e-07
gi|10954621|ref|NP_052244.1| tetracycline-resistance protein [Fr... 60 1e-07
gi|12053582|emb|CAC20134.1| tetracycline resistance [Escherichia... 60 1e-07
gi|16764890|ref|NP_460505.1| putative multidrug efflux protein [... 60 1e-07
gi|17530575|ref|NP_511233.1| tetracycline resistance protein [In... 60 1e-07
gi|39586866|emb|CAE62801.1| Hypothetical protein CBG06976 [Caeno... 60 2e-07
gi|45550667|ref|NP_649238.2| CG5078-PA [Drosophila melanogaster]... 60 2e-07
gi|20089079|ref|NP_615154.1| multidrug-efflux transporter [Metha... 60 2e-07
gi|16760323|ref|NP_455940.1| putative multidrug efflux protein [... 60 2e-07
gi|32420199|ref|XP_330543.1| hypothetical protein [Neurospora cr... 59 2e-07
gi|32267113|ref|NP_861145.1| conserved hypothetical protein [Hel... 59 2e-07
gi|46314025|ref|ZP_00214612.1| COG0477: Permeases of the major f... 59 2e-07
gi|15612172|ref|NP_223824.1| putative transporter [Helicobacter ... 59 3e-07
gi|7508440|pir||T33372 hypothetical protein T25D3.1 - Caenorhabd... 59 3e-07
gi|16079457|ref|NP_390281.1| multidrug-efflux transporter [Bacil... 59 3e-07
gi|17536511|ref|NP_493670.1| hippocampus abundant gene transcrip... 59 3e-07
gi|22970252|ref|ZP_00017367.1| hypothetical protein [Chloroflexu... 58 4e-07
gi|24667561|ref|NP_649237.1| CG17637-PA [Drosophila melanogaster... 58 4e-07
gi|628866|pir||S44207 hypothetical protein 337 - Coxiella burnetii 58 6e-07
gi|46438139|gb|EAK97475.1| hypothetical protein CaO19.7336 [Cand... 58 6e-07
gi|49074008|ref|XP_401169.1| hypothetical protein UM03554.1 [Ust... 58 6e-07
gi|474915|emb|CAA55564.1| unnamed protein product [Coxiella burn... 58 6e-07
gi|29655250|ref|NP_820942.1| drug resistance transporter, Bcr/Cf... 58 6e-07
gi|38176052|gb|AAK84580.2| Hypothetical protein T25D3.4 [Caenorh... 57 8e-07
gi|46136577|ref|XP_389980.1| hypothetical protein FG09804.1 [Gib... 57 8e-07
gi|46142444|ref|ZP_00149137.2| COG0477: Permeases of the major f... 57 8e-07
gi|46115036|ref|XP_383536.1| hypothetical protein FG03360.1 [Gib... 57 1e-06
gi|15645795|ref|NP_207972.1| multidrug-efflux transporter [Helic... 57 1e-06
gi|50410426|ref|XP_456960.1| unnamed protein product [Debaryomyc... 57 1e-06
gi|46913143|emb|CAG19932.1| putative multidrug resistance protei... 57 1e-06
gi|29828445|ref|NP_823079.1| putative efflux protein [Streptomyc... 56 2e-06
gi|21224787|ref|NP_630566.1| putative efflux protein [Streptomyc... 56 2e-06
gi|15617064|ref|NP_240277.1| hypothetical protein BU466 [Buchner... 56 2e-06
gi|49482951|ref|YP_040175.1| fluoroquinolone resistance protein ... 56 2e-06
gi|4115707|dbj|BAA36484.1| NorA [Staphylococcus aureus] 56 2e-06
gi|49485567|ref|YP_042788.1| fluoroquinolone resistance protein ... 56 2e-06
gi|15923685|ref|NP_371219.1| quinolone resistance protein [Staph... 56 2e-06
gi|23120629|ref|ZP_00103220.1| COG0477: Permeases of the major f... 56 2e-06
gi|28828590|gb|AAO51193.1| similar to Rhizobium meliloti (Sinorh... 56 2e-06
gi|693735|gb|AAB31949.1| NorA [Staphylococcus aureus] 56 2e-06
gi|46131650|ref|ZP_00169994.2| COG0477: Permeases of the major f... 55 3e-06
gi|48866453|ref|ZP_00320309.1| COG0477: Permeases of the major f... 55 3e-06
gi|37525803|ref|NP_929147.1| hypothetical protein [Photorhabdus ... 55 3e-06
gi|48870523|ref|ZP_00323245.1| COG0477: Permeases of the major f... 55 3e-06
gi|50121184|ref|YP_050351.1| putative transporter [Erwinia carot... 55 3e-06
gi|30387187|ref|NP_848166.1| tetracycline resistance protein; Te... 55 4e-06
gi|49085878|ref|XP_405027.1| hypothetical protein AN0890.2 [Aspe... 55 4e-06
gi|31199203|ref|XP_308549.1| ENSANGP00000009556 [Anopheles gambi... 55 4e-06
gi|27378215|ref|NP_769744.1| major facilitator superfamily trans... 55 4e-06
gi|153053|gb|AAA16158.1| norA1199 protein >gnl|BL_ORD_ID|1369083... 55 4e-06
gi|49099382|ref|XP_410760.1| hypothetical protein AN6623.2 [Aspe... 55 5e-06
gi|38105713|gb|EAA52106.1| hypothetical protein MG03701.4 [Magna... 55 5e-06
gi|21357569|ref|NP_647771.1| CG11537-PC [Drosophila melanogaster... 54 6e-06
gi|24656463|ref|NP_728811.1| CG11537-PA [Drosophila melanogaster... 54 6e-06
gi|45825071|gb|AAS77443.1| GH21943p [Drosophila melanogaster] 54 6e-06
gi|15004834|ref|NP_149294.1| Permease, MDR related [Clostridium ... 54 8e-06
gi|15678132|ref|NP_275247.1| multidrug transporter homolog [Meth... 54 8e-06
gi|29467413|dbj|BAC67151.1| tetG [Stenotrophomonas sp. TA57] 54 8e-06
gi|27467384|ref|NP_764021.1| quinolone resistance protein [Staph... 54 1e-05
gi|34558097|ref|NP_907912.1| MULTIDRUG-EFFLUX TRANSPORTER [Wolin... 53 1e-05
gi|48852855|ref|ZP_00307037.1| COG0477: Permeases of the major f... 53 1e-05
gi|4063855|gb|AAC98496.1| tetracycline resistance protein [Salmo... 53 1e-05
gi|1729880|sp|P51563|TCR7_VIBAN Tetracycline resistance protein,... 53 1e-05
gi|4583497|gb|AAD25095.1| tetracycline resistance protein [Pseud... 53 1e-05
gi|32411787|ref|XP_326374.1| hypothetical protein [Neurospora cr... 53 2e-05
gi|16945311|emb|CAD11599.1| tetracycline efflux protein [Escheri... 53 2e-05
gi|17549475|ref|NP_522815.1| PROBABLE INTEGRAL MEMBRANE TRANSMEM... 53 2e-05
gi|15792698|ref|NP_282521.1| putative efflux protein [Campylobac... 53 2e-05
gi|4193955|gb|AAD10060.1| multidrug-efflux transporter [Campylob... 53 2e-05
gi|46114013|ref|ZP_00184241.2| COG0477: Permeases of the major f... 52 2e-05
gi|48770036|ref|ZP_00274380.1| COG0477: Permeases of the major f... 52 2e-05
gi|48860677|ref|ZP_00314588.1| COG0477: Permeases of the major f... 52 2e-05
gi|27479655|gb|AAO17182.1| Orf16 [Photorhabdus luminescens] 52 2e-05
gi|15892998|ref|NP_360712.1| bicyclomycin resistance protein [Ri... 52 2e-05
gi|34581308|ref|ZP_00142788.1| bicyclomycin resistance protein [... 52 2e-05
gi|18314015|ref|NP_560682.1| antibiotic resistance (efflux) prot... 52 3e-05
gi|46115748|ref|XP_383892.1| hypothetical protein FG03716.1 [Gib... 52 3e-05
gi|14349110|emb|CAC41338.1| tetracycline resistance protein of c... 52 3e-05
gi|41056936|ref|NP_957551.1| TetA [Escherichia coli] >gnl|BL_ORD... 52 3e-05
gi|14547131|emb|CAC42503.1| tetracycline resistance protein, cla... 52 3e-05
gi|27468853|ref|NP_765490.1| TcaB protein [Staphylococcus epider... 52 3e-05
gi|48895353|ref|ZP_00328337.1| COG0477: Permeases of the major f... 52 3e-05
gi|48771569|ref|ZP_00275911.1| COG0477: Permeases of the major f... 52 3e-05
gi|15027121|emb|CAC44895.1| tetracycline resistance protein, cla... 52 3e-05
gi|20454258|gb|AAM22221.1| TetA [Shigella sonnei] >gnl|BL_ORD_ID... 52 3e-05
gi|45502100|emb|CAF31521.1| tetracycline efflux protein [Salmone... 52 3e-05
gi|34903136|ref|NP_912915.1| unnamed protein product [Oryza sati... 52 4e-05
gi|29654511|ref|NP_820203.1| multidrug transporter, putative [Co... 52 4e-05
gi|15669755|ref|NP_248568.1| multidrug-efflux transporter (bmr1)... 52 4e-05
gi|16078162|ref|NP_388979.1| yitG [Bacillus subtilis subsp. subt... 52 4e-05
gi|2145399|emb|CAA70662.1| YitG [Bacillus subtilis] 52 4e-05
gi|38109323|gb|EAA55213.1| hypothetical protein MG06870.4 [Magna... 52 4e-05
gi|481465|pir||S38656 tetA protein - Pseudomonas aeruginosa >gnl... 51 5e-05
gi|32469321|dbj|BAC79064.1| tetracycline resistance protein A [V... 51 5e-05
gi|72841|pir||YTECR1 tetracycline resistance protein - Escherich... 51 5e-05
gi|46915868|emb|CAG22639.1| putative multidrug transporter [Phot... 51 5e-05
gi|20386407|gb|AAM21661.1| tetracycline resistance protein A [Sh... 51 5e-05
gi|49176954|ref|YP_025722.1| TetA [Escherichia coli] >gnl|BL_ORD... 51 5e-05
gi|46116950|ref|XP_384493.1| hypothetical protein FG04317.1 [Gib... 51 7e-05
gi|49137873|ref|XP_413453.1| hypothetical protein AN9316.2 [Aspe... 51 7e-05
gi|42454142|ref|ZP_00154049.1| hypothetical protein Rick102901 [... 51 7e-05
gi|47087239|ref|NP_998692.1| zgc:55324 [Danio rerio] >gnl|BL_ORD... 51 7e-05
gi|49476889|ref|YP_034996.1| major facilitator family transporte... 51 7e-05
gi|46121481|ref|XP_385295.1| hypothetical protein FG05119.1 [Gib... 51 7e-05
gi|49475727|ref|YP_033768.1| Bicyclomycin resistance protein [Ba... 51 7e-05
gi|15599429|ref|NP_252923.1| probable MFS transporter [Pseudomon... 50 9e-05
gi|47567706|ref|ZP_00238416.1| drug resistance transporter, EmrB... 50 9e-05
gi|42781972|ref|NP_979219.1| drug resistance transporter, EmrB/Q... 50 9e-05
gi|47565582|ref|ZP_00236623.1| major facilitator family transpor... 50 9e-05
gi|30261898|ref|NP_844275.1| major facilitator family transporte... 50 9e-05
gi|49481125|ref|YP_036031.1| multidrug resistance protein B [Bac... 50 9e-05
gi|30019928|ref|NP_831559.1| Multidrug resistance protein B [Bac... 50 9e-05
gi|46114426|ref|XP_383231.1| hypothetical protein FG03055.1 [Gib... 50 9e-05
gi|39934949|ref|NP_947225.1| putative membrane transport protein... 50 9e-05
gi|30020997|ref|NP_832628.1| Multidrug resistance protein B [Bac... 50 9e-05
gi|19075881|ref|NP_588381.1| putative vesicular acetylcholine tr... 50 9e-05
gi|49092118|ref|XP_407520.1| hypothetical protein AN3383.2 [Aspe... 50 9e-05
gi|45185516|ref|NP_983232.1| ACL172Cp [Eremothecium gossypii] >g... 50 9e-05
gi|32410455|ref|XP_325708.1| hypothetical protein [Neurospora cr... 50 1e-04
gi|49090682|ref|XP_406802.1| hypothetical protein AN2665.2 [Aspe... 50 1e-04
gi|45515820|ref|ZP_00167374.1| COG0477: Permeases of the major f... 50 1e-04
gi|42779890|ref|NP_977137.1| major facilitator family transporte... 50 1e-04
gi|28436829|gb|AAH46748.1| Hiat1-prov protein [Xenopus laevis] 50 1e-04
gi|50552744|ref|XP_503782.1| hypothetical protein [Yarrowia lipo... 50 1e-04
gi|11498923|ref|NP_070154.1| multidrug resistance protein [Archa... 50 1e-04
gi|28828081|gb|AAO50764.1| similar to Leptospira interrogans ser... 50 1e-04
gi|21399737|ref|NP_655722.1| sugar_tr, Sugar (and other) transpo... 50 1e-04
gi|50551391|ref|XP_503169.1| hypothetical protein [Yarrowia lipo... 50 1e-04
gi|30410823|ref|NP_660782.2| hypothetical 49.0 kDa protein [Buch... 50 1e-04
gi|23121602|ref|ZP_00103843.1| COG0477: Permeases of the major f... 50 1e-04
gi|25091580|sp|Q8K999|Y450_BUCAP Hypothetical transport protein ... 50 1e-04
gi|49090766|ref|XP_406844.1| hypothetical protein AN2707.2 [Aspe... 50 2e-04
gi|49091322|ref|XP_407122.1| hypothetical protein AN2985.2 [Aspe... 50 2e-04
gi|21400773|ref|NP_656758.1| sugar_tr, Sugar (and other) transpo... 50 2e-04
gi|46914561|emb|CAG21340.1| hypothetical multidrug resistance pr... 50 2e-04
gi|46118468|ref|XP_384885.1| hypothetical protein FG04709.1 [Gib... 50 2e-04
gi|31541926|ref|NP_082416.2| RIKEN cDNA 2810423E13 [Mus musculus... 50 2e-04
gi|18313266|ref|NP_559933.1| sugar transporter, conjectural [Pyr... 50 2e-04
gi|49106303|ref|XP_411414.1| hypothetical protein AN7277.2 [Aspe... 49 2e-04
gi|23480447|gb|EAA17003.1| major facilitator superfamily protein... 49 2e-04
gi|47574455|ref|ZP_00244491.1| COG0477: Permeases of the major f... 49 2e-04
gi|41054609|ref|NP_955878.1| Unknown (protein for MGC:63758); wu... 49 2e-04
gi|12850324|dbj|BAB28676.1| unnamed protein product [Mus musculus] 49 2e-04
gi|15898838|ref|NP_343443.1| Multidrug resistance protein [Sulfo... 49 2e-04
gi|47213650|emb|CAF90354.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|49235702|ref|ZP_00329768.1| COG0477: Permeases of the major f... 49 2e-04
gi|48730351|ref|ZP_00264099.1| COG0477: Permeases of the major f... 49 2e-04
gi|37524975|ref|NP_928319.1| hypothetical protein [Photorhabdus ... 49 2e-04
gi|28829480|gb|AAL92368.2| similar to Homo sapiens (Human). simi... 49 3e-04
gi|19075248|ref|NP_587748.1| MFS multidrug efflux transporter [S... 49 3e-04
gi|50259222|gb|EAL21895.1| hypothetical protein CNBC0360 [Crypto... 49 3e-04
gi|50259581|gb|EAL22254.1| hypothetical protein CNBC3920 [Crypto... 49 3e-04
gi|13541087|ref|NP_110775.1| Multidrug efflux permease [Thermopl... 49 3e-04
gi|49097908|ref|XP_410414.1| hypothetical protein AN6277.2 [Aspe... 49 3e-04
gi|49235914|ref|ZP_00329978.1| COG0477: Permeases of the major f... 49 3e-04
gi|41407694|ref|NP_960530.1| hypothetical protein MAP1596 [Mycob... 49 3e-04
gi|49257418|gb|AAH73019.1| Unknown (protein for MGC:82622) [Xeno... 49 3e-04
gi|13540969|ref|NP_110657.1| Multidrug efflux permease [Thermopl... 49 3e-04
gi|46107656|ref|XP_380887.1| hypothetical protein FG00711.1 [Gib... 49 3e-04
gi|26988122|ref|NP_743547.1| drug resistance transporter, EmrB/Q... 49 3e-04
gi|21227964|ref|NP_633886.1| Transporter [Methanosarcina mazei G... 49 3e-04
gi|14324353|dbj|BAB59281.1| multidrug-efflux transporter [Thermo... 49 3e-04
gi|22970851|ref|ZP_00017873.1| hypothetical protein [Chloroflexu... 49 3e-04
gi|47223102|emb|CAG07189.1| unnamed protein product [Tetraodon n... 49 3e-04
gi|23501937|ref|NP_698064.1| drug resistance transporter, EmrB/Q... 49 4e-04
gi|46106652|ref|ZP_00187576.2| COG0477: Permeases of the major f... 49 4e-04
gi|15595443|ref|NP_248937.1| probable MFS transporter [Pseudomon... 49 4e-04
gi|50256543|gb|EAL19268.1| hypothetical protein CNBH3670 [Crypto... 49 4e-04
gi|37519837|ref|NP_923214.1| similar to multidrug-efflux transpo... 49 4e-04
gi|46314609|ref|ZP_00215194.1| COG0477: Permeases of the major f... 49 4e-04
gi|26987225|ref|NP_742650.1| major facilitator family transporte... 49 4e-04
gi|47094296|ref|ZP_00232000.1| drug resistance transporter, EmrB... 49 4e-04
gi|30018916|ref|NP_830547.1| Bicyclomycin resistance protein [Ba... 49 4e-04
gi|50751786|ref|XP_426637.1| PREDICTED: similar to hippocampus a... 49 4e-04
gi|17987210|ref|NP_539844.1| MULTIDRUG RESISTANCE PROTEIN B [Bru... 49 4e-04
gi|22972929|ref|ZP_00019780.1| hypothetical protein [Chloroflexu... 49 4e-04
gi|34859905|ref|XP_215693.2| similar to hippocampus abundant gen... 49 4e-04
gi|46111993|ref|XP_383045.1| hypothetical protein FG02869.1 [Gib... 49 4e-04
gi|16803021|ref|NP_464506.1| similar to efflux transporter [List... 49 4e-04
gi|47096313|ref|ZP_00233909.1| drug resistance transporter, EmrB... 49 4e-04
gi|16800049|ref|NP_470317.1| similar to efflux transporter [List... 49 4e-04
gi|46907214|ref|YP_013603.1| drug resistance transporter, EmrB/Q... 49 4e-04
gi|16803290|ref|NP_464775.1| similar to antibiotic resistance pr... 49 4e-04
gi|15613447|ref|NP_241750.1| BH0884~unknown conserved protein [B... 49 4e-04
gi|32490906|ref|NP_871160.1| yajR [Wigglesworthia glossinidia en... 49 4e-04
gi|12836216|dbj|BAB23557.1| unnamed protein product [Mus musculus] 49 4e-04
gi|29654275|ref|NP_819967.1| drug resistance transporter, Bcr/Cf... 49 4e-04
gi|39753965|ref|NP_149044.2| hippocampus abundant transcript 1; ... 49 4e-04
gi|21398186|ref|NP_654171.1| sugar_tr, Sugar (and other) transpo... 49 4e-04
gi|42779345|ref|NP_976592.1| major facilitator family transporte... 49 4e-04
gi|49093712|ref|XP_408317.1| hypothetical protein AN4180.2 [Aspe... 48 5e-04
gi|30021002|ref|NP_832633.1| Peptide permease [Bacillus cereus A... 48 5e-04
gi|49091880|ref|XP_407401.1| hypothetical protein AN3264.2 [Aspe... 48 5e-04
gi|38110525|gb|EAA56231.1| hypothetical protein MG01883.4 [Magna... 48 5e-04
gi|30020415|ref|NP_832046.1| Quinolone resistence NorA protein [... 48 5e-04
gi|50303777|ref|XP_451835.1| unnamed protein product [Kluyveromy... 48 5e-04
gi|11415038|ref|NP_068812.1| solute carrier family 22 member 3; ... 48 5e-04
gi|49903699|gb|AAH76868.1| Unknown (protein for IMAGE:6643659) [... 48 5e-04
gi|15807729|ref|NP_285384.1| drug transport protein, putative [D... 48 5e-04
gi|42779544|ref|NP_976791.1| benzoate transport protein, putativ... 48 5e-04
gi|38110058|gb|EAA55834.1| hypothetical protein MG01485.4 [Magna... 48 5e-04
gi|14714684|gb|AAH10483.1| 2810423E13Rik protein [Mus musculus] 48 5e-04
gi|46312712|ref|ZP_00213306.1| COG0477: Permeases of the major f... 48 5e-04
gi|50257971|gb|EAL20665.1| hypothetical protein CNBE0310 [Crypto... 48 5e-04
gi|16800286|ref|NP_470554.1| similar to antibiotic resistance pr... 48 5e-04
gi|47093509|ref|ZP_00231271.1| transporter, putative [Listeria m... 48 5e-04
gi|46907473|ref|YP_013862.1| transporter, putative [Listeria mon... 48 5e-04
gi|47567481|ref|ZP_00238193.1| multidrug resistance protein B [B... 48 5e-04
gi|49480601|ref|YP_036956.1| multidrug resistance protein B [Bac... 48 6e-04
gi|29374735|ref|NP_813887.1| major facilitator family transporte... 48 6e-04
gi|48787567|ref|ZP_00283546.1| COG0477: Permeases of the major f... 48 6e-04
gi|15899835|ref|NP_344440.1| Transporter [Sulfolobus solfataricu... 48 6e-04
gi|12054725|emb|CAC20909.1| tetracycline resistance [Salmonella ... 48 6e-04
gi|15898706|ref|NP_343311.1| Multidrug resistance protein [Sulfo... 48 6e-04
gi|16081624|ref|NP_393987.1| multidrug resistance protein relate... 48 6e-04
gi|48784831|ref|ZP_00281136.1| COG0477: Permeases of the major f... 48 6e-04
gi|30018493|ref|NP_830124.1| Multidrug resistance protein B [Bac... 48 6e-04
gi|6680221|ref|NP_032272.1| hippocampus abundant gene transcript... 48 6e-04
gi|30264074|ref|NP_846451.1| drug resistance transporter, EmrB/Q... 47 8e-04
gi|30022088|ref|NP_833719.1| Multidrug resistance protein B [Bac... 47 8e-04
gi|42783098|ref|NP_980345.1| drug resistance transporter, EmrB/Q... 47 8e-04
gi|49480608|ref|YP_038061.1| multidrug-efflux transporter [Bacil... 47 8e-04
gi|14270513|emb|CAC39443.1| organic cation transporter 3 [Homo s... 47 8e-04
gi|50428095|ref|XP_456783.1| unnamed protein product [Debaryomyc... 47 8e-04
gi|45190550|ref|NP_984804.1| AEL057Cp [Eremothecium gossypii] >g... 47 8e-04
gi|29500764|gb|AAO75105.1| ComD [Dictyostelium discoideum] 47 8e-04
gi|50551177|ref|XP_503062.1| hypothetical protein [Yarrowia lipo... 47 8e-04
gi|42781977|ref|NP_979224.1| major facilitator family transporte... 47 8e-04
gi|46441129|gb|EAL00428.1| hypothetical protein CaO19.7554 [Cand... 47 8e-04
gi|49074162|ref|XP_401234.1| hypothetical protein UM03619.1 [Ust... 47 8e-04
gi|49129385|ref|XP_412908.1| hypothetical protein AN8771.2 [Aspe... 47 8e-04
gi|49484570|ref|YP_041794.1| teicoplanin resistance associated m... 47 8e-04
gi|15925345|ref|NP_372879.1| TcaB protein [Staphylococcus aureus... 47 8e-04
gi|46141014|ref|ZP_00203827.1| COG0477: Permeases of the major f... 47 8e-04
gi|49125964|ref|XP_412697.1| hypothetical protein AN8560.2 [Aspe... 47 8e-04
gi|16552767|dbj|BAB71375.1| unnamed protein product [Homo sapiens] 47 8e-04
gi|47565876|ref|ZP_00236915.1| drug transport protein, putative ... 47 8e-04
gi|50121358|ref|YP_050525.1| putative membrane protein [Erwinia ... 47 0.001
gi|4467970|emb|CAB37973.1| hypothetical protein [Myxococcus xant... 47 0.001
gi|1805379|dbj|BAA08941.1| multidrug resistance protein(EmrB) ho... 47 0.001
gi|50310739|ref|XP_455391.1| unnamed protein product [Kluyveromy... 47 0.001
gi|49085486|ref|XP_404861.1| hypothetical protein AN0724.2 [Aspe... 47 0.001
gi|19386936|gb|AAL87047.1| putative dothistromin transporter [My... 47 0.001
gi|21398703|ref|NP_654688.1| sugar_tr, Sugar (and other) transpo... 47 0.001
gi|49480822|ref|YP_036961.1| peptide permease, major facilitator... 47 0.001
gi|16077376|ref|NP_388189.1| multidrug-efflux transporter [Bacil... 47 0.001
gi|13475703|ref|NP_107270.1| similar to efflux transporter [Meso... 47 0.001
gi|9507117|ref|NP_062103.1| solute carrier family 22, member 3 [... 47 0.001
gi|50547667|ref|XP_501303.1| hypothetical protein [Yarrowia lipo... 47 0.001
gi|50425875|ref|XP_461534.1| unnamed protein product [Debaryomyc... 47 0.001
gi|46442520|gb|EAL01809.1| hypothetical protein CaO19.4337 [Cand... 47 0.001
gi|50259943|gb|EAL22609.1| hypothetical protein CNBB2410 [Crypto... 47 0.001
gi|32418364|ref|XP_329660.1| hypothetical protein [Neurospora cr... 47 0.001
gi|15921973|ref|NP_377642.1| 468aa long hypothetical multidrug r... 47 0.001
gi|42782362|ref|NP_979609.1| major facilitator family transporte... 47 0.001
gi|47564421|ref|ZP_00235466.1| major facilitator family transpor... 47 0.001
gi|30021422|ref|NP_833053.1| Quinolone resistence NorA protein [... 47 0.001
gi|42779283|ref|NP_976530.1| drug resistance transporter, Bcr/Cf... 47 0.001
gi|49480096|ref|YP_034525.1| drug resistance transporter Bcr/Cfl... 47 0.001
gi|50419977|ref|XP_458521.1| unnamed protein product [Debaryomyc... 47 0.001
gi|18310586|ref|NP_562520.1| probable multidrug-efflux transport... 47 0.001
gi|12054723|emb|CAC21193.1| tetracycline resistance [Salmonella ... 47 0.001
gi|50408461|ref|XP_456782.1| unnamed protein product [Debaryomyc... 47 0.001
gi|38099427|gb|EAA46775.1| hypothetical protein MG10469.4 [Magna... 47 0.001
gi|27376042|ref|NP_767571.1| multidrug resistance protein B [Bra... 47 0.001
gi|46442655|gb|EAL01943.1| hypothetical protein CaO19.11813 [Can... 47 0.001
gi|13699874|emb|CAC36405.1| organic cation transporter 3 [Mus mu... 47 0.001
gi|6755538|ref|NP_035525.1| solute carrier family 22 (organic ca... 47 0.001
gi|46126303|ref|XP_387705.1| hypothetical protein FG07529.1 [Gib... 47 0.001
gi|50421555|ref|XP_459329.1| unnamed protein product [Debaryomyc... 47 0.001
gi|21398139|ref|NP_654124.1| sugar_tr, Sugar (and other) transpo... 47 0.001
gi|30018441|ref|NP_830072.1| Bicyclomycin resistance protein [Ba... 47 0.001
gi|46308809|ref|ZP_00211001.1| COG0477: Permeases of the major f... 46 0.002
gi|46124383|ref|XP_386745.1| hypothetical protein FG06569.1 [Gib... 46 0.002
gi|21222427|ref|NP_628206.1| putative integral membrane efflux p... 46 0.002
gi|49478153|ref|YP_037409.1| quinolone resistence NorA protein, ... 46 0.002
gi|21401220|ref|NP_657205.1| sugar_tr, Sugar (and other) transpo... 46 0.002
gi|15921252|ref|NP_376921.1| 473aa long hypothetical multidrug r... 46 0.002
gi|15806345|ref|NP_295051.1| multidrug-efflux transporter [Deino... 46 0.002
gi|49482362|ref|YP_039586.1| putative transport protein [Staphyl... 46 0.002
gi|15923109|ref|NP_370643.1| hypothetical protein SAV0119 [Staph... 46 0.002
gi|1856977|dbj|BAA08793.1| multidrug transporter [Bacillus subti... 46 0.002
gi|28871437|ref|NP_794056.1| drug resistance transporter, EmrB/Q... 46 0.002
gi|15674606|ref|NP_268780.1| putative multi-drug resistance effl... 46 0.002
gi|48866160|ref|ZP_00320017.1| COG0477: Permeases of the major f... 46 0.002
gi|22972766|ref|ZP_00019626.1| hypothetical protein [Chloroflexu... 46 0.002
gi|46113279|ref|ZP_00182596.2| COG0477: Permeases of the major f... 46 0.002
gi|45520499|ref|ZP_00172029.1| COG0477: Permeases of the major f... 46 0.002
gi|15604540|ref|NP_221058.1| BICYCLOMYCIN RESISTANCE PROTEIN (bc... 46 0.002
gi|46131231|ref|ZP_00169354.2| COG0477: Permeases of the major f... 46 0.002
gi|39584802|emb|CAE67697.1| Hypothetical protein CBG13266 [Caeno... 46 0.002
gi|15805290|ref|NP_293981.1| multidrug-efflux transporter, putat... 46 0.002
gi|15900849|ref|NP_345453.1| multi-drug resistance efflux pump [... 46 0.002
gi|28829935|gb|AAO52426.1| similar to Xanthomonas campestris (pv... 46 0.002
gi|22760086|dbj|BAC11062.1| unnamed protein product [Homo sapiens] 46 0.002
gi|48837324|ref|ZP_00294319.1| COG0477: Permeases of the major f... 46 0.002
gi|47570460|ref|ZP_00241094.1| Bicyclomycin resistance protein [... 46 0.002
gi|13470951|ref|NP_102520.1| probable membrane transport protein... 45 0.003
gi|46137209|ref|XP_390296.1| hypothetical protein FG10120.1 [Gib... 45 0.003
gi|46125317|ref|XP_387212.1| hypothetical protein FG07036.1 [Gib... 45 0.003
gi|7494336|pir||A71619 membrane transporter PFB0275w - malaria p... 45 0.003
gi|14521576|ref|NP_127052.1| multidrug resistance protein [Pyroc... 45 0.003
gi|46103522|ref|XP_380271.1| hypothetical protein FG00095.1 [Gib... 45 0.003
gi|48728473|ref|ZP_00262233.1| COG0477: Permeases of the major f... 45 0.003
gi|23593282|ref|NP_472983.2| hypothetical protein, conserved [Pl... 45 0.003
gi|23003645|ref|ZP_00047301.1| COG0477: Permeases of the major f... 45 0.003
gi|46204685|ref|ZP_00049619.2| COG0477: Permeases of the major f... 45 0.003
gi|39581876|emb|CAE60770.1| Hypothetical protein CBG04458 [Caeno... 45 0.003
gi|46316802|ref|ZP_00217381.1| COG0477: Permeases of the major f... 45 0.003
gi|32043123|ref|ZP_00140385.1| COG2814: Arabinose efflux permeas... 45 0.003
gi|46366833|ref|ZP_00229023.1| COG0477: Permeases of the major f... 45 0.004
gi|32409113|ref|XP_325037.1| hypothetical protein [Neurospora cr... 45 0.004
gi|32410903|ref|XP_325932.1| hypothetical protein [Neurospora cr... 45 0.004
gi|48852857|ref|ZP_00307039.1| COG0477: Permeases of the major f... 45 0.004
gi|37527931|ref|NP_931276.1| hypothetical protein [Photorhabdus ... 45 0.004
gi|26247630|ref|NP_753670.1| Putative membrane transport protein... 45 0.004
gi|39933591|ref|NP_945867.1| putative efflux pump protein FarB [... 45 0.004
gi|30018606|ref|NP_830237.1| Benzoate transport protein [Bacillu... 45 0.004
gi|15600741|ref|NP_254235.1| probable MFS transporter [Pseudomon... 45 0.004
gi|15641639|ref|NP_231271.1| multidrug resistance protein [Vibri... 45 0.004
gi|46323359|ref|ZP_00223724.1| COG0477: Permeases of the major f... 45 0.004
gi|48784099|ref|ZP_00280480.1| COG0477: Permeases of the major f... 45 0.005
gi|38103051|gb|EAA49808.1| hypothetical protein MG09972.4 [Magna... 45 0.005
gi|48824246|ref|ZP_00285648.1| COG0477: Permeases of the major f... 45 0.005
gi|17558220|ref|NP_505338.1| putative N-myristoylated protein fa... 45 0.005
gi|31239811|ref|XP_320319.1| ENSANGP00000016591 [Anopheles gambi... 45 0.005
gi|6653749|gb|AAF22849.1| bile acid transporter [Clostridium sp.... 45 0.005
gi|42518600|ref|NP_964530.1| major facilitator superfamily perme... 45 0.005
gi|47564677|ref|ZP_00235721.1| drug resistance transporter, Bcr/... 45 0.005
gi|42520261|ref|NP_966176.1| bicyclomycin resistance protein [Wo... 45 0.005
gi|29376577|ref|NP_815731.1| multidrug resistance protein, putat... 45 0.005
gi|15831120|ref|NP_309893.1| putative membrane transport protein... 45 0.005
gi|14715055|gb|AAH10691.1| MGC9564 protein [Homo sapiens] 45 0.005
gi|21909886|ref|NP_664154.1| putative multi-drug resistance effl... 45 0.005
gi|49117020|gb|AAH73059.1| Unknown (protein for MGC:82690) [Xeno... 45 0.005
gi|24379702|ref|NP_721657.1| putative permease; multidrug efflux... 45 0.005
gi|42781775|ref|NP_979022.1| oxalate:formate antiporter, putativ... 45 0.005
gi|19114460|ref|NP_593548.1| MFS transporter [Schizosaccharomyce... 45 0.005
gi|28896416|ref|NP_802766.1| putative multi-drug resistance effl... 45 0.005
gi|48852306|ref|ZP_00306494.1| COG0477: Permeases of the major f... 45 0.005
gi|47093561|ref|ZP_00231321.1| major facilitator family transpor... 45 0.005
gi|46907913|ref|YP_014302.1| major facilitator family transporte... 45 0.005
gi|42565446|ref|NP_189965.2| transporter-related [Arabidopsis th... 44 0.007
gi|48728897|ref|ZP_00262650.1| COG0477: Permeases of the major f... 44 0.007
gi|45357662|ref|NP_987219.1| General substrate transporter [Meth... 44 0.007
gi|46164687|ref|ZP_00137604.2| COG0477: Permeases of the major f... 44 0.007
gi|42781435|ref|NP_978682.1| major facilitator family transporte... 44 0.007
gi|13474734|ref|NP_106303.1| unknown protein [Mesorhizobium loti... 44 0.007
gi|22537873|ref|NP_688724.1| transporter, putative [Streptococcu... 44 0.007
gi|42572573|ref|NP_974382.1| transporter-related [Arabidopsis th... 44 0.007
gi|25011818|ref|NP_736213.1| Unknown [Streptococcus agalactiae N... 44 0.007
gi|11358901|pir||T47415 transporter-like protein - Arabidopsis t... 44 0.007
gi|6320595|ref|NP_010675.1| Hypothetical ORF; Ydr387cp [Saccharo... 44 0.007
gi|37681383|ref|NP_935992.1| putative multidrug resistance prote... 44 0.007
gi|15599331|ref|NP_252825.1| probable MFS transporter [Pseudomon... 44 0.007
gi|48733497|ref|ZP_00267240.1| COG0477: Permeases of the major f... 44 0.007
gi|46105874|ref|ZP_00186259.2| COG0477: Permeases of the major f... 44 0.007
gi|49474340|ref|YP_032382.1| Bicyclomycin resistance protein [Ba... 44 0.007
gi|37589404|gb|AAH59350.1| MGC69173 protein [Xenopus laevis] 44 0.007
gi|15615773|ref|NP_244077.1| multidrug resistance protein [Bacil... 44 0.007
>gi|17551570|ref|NP_510814.1| tetracycline transporter-like protein
(49.5 kD) (XR980) [Caenorhabditis elegans]
gi|7498823|pir||T16025 hypothetical protein F10D7.2 - Caenorhabditis
elegans
gi|1072210|gb|AAA81720.1| Hypothetical protein F10D7.2
[Caenorhabditis elegans]
Length = 445
Score = 807 bits (2084), Expect = 0.0
Identities = 414/445 (93%), Positives = 414/445 (93%)
Frame = -1
Query: 1338 MTAIGPVDKKAVMKLLIPALICNMLAFTSILPLFPTILNYYSKEGHRDWLYDISVKGLQS 1159
MTAIGPVDKKAVMKLLIPALICNMLAFTSILPLFPTILNYYSKEGHRDWLYDISVKGLQS
Sbjct: 1 MTAIGPVDKKAVMKLLIPALICNMLAFTSILPLFPTILNYYSKEGHRDWLYDISVKGLQS 60
Query: 1158 FQEAIGVPHSERYDKVXXXXXXXXXXSALQFISSPTLGSLSDIYGRRAVISLCCIMTFIS 979
FQEAIGVPHSERYDKV SALQFISSPTLGSLSDIYGRRAVISLCCIMTFIS
Sbjct: 61 FQEAIGVPHSERYDKVFFGGFLGSLFSALQFISSPTLGSLSDIYGRRAVISLCCIMTFIS 120
Query: 978 YVNWLKADIFAYFVLSRILGGLSKGNINVATAIVSDVYSPEDHPKGMALIGISYSLGFLI 799
YVNWLKADIFAYFVLSRILGGLSKGNINVATAIVSDVYSPEDHPKGMALIGISYSLGFLI
Sbjct: 121 YVNWLKADIFAYFVLSRILGGLSKGNINVATAIVSDVYSPEDHPKGMALIGISYSLGFLI 180
Query: 798 GPMIGAYFSTIASIDSPFAYPAMFSIILTILEFGFLFFLPETLDLKEQKSLDDIKKTRKE 619
GPMIGAYFSTIASIDSPFAYPAMFSIILTILEFGFLFFLPETLDLKEQKSLDDIKKTRKE
Sbjct: 181 GPMIGAYFSTIASIDSPFAYPAMFSIILTILEFGFLFFLPETLDLKEQKSLDDIKKTRKE 240
Query: 618 LVTPKDLFQFTAVNAPQERKQEMQKVGWIYFLFLFLYSGLEFTLPFLTHIRFDFDNMQQG 439
LVTPKDLFQFTAVNAPQERKQEMQKVGWIYFLFLFLYSGLEFTLPFLTHIRFDFDNMQQG
Sbjct: 241 LVTPKDLFQFTAVNAPQERKQEMQKVGWIYFLFLFLYSGLEFTLPFLTHIRFDFDNMQQG 300
Query: 438 KVYLFTGLLMLPIQAKYVRKTPIEKQKAVAEFGIACIIPAYLLVAVAKTPLVLYAGLFFY 259
KVYLFTGLLMLPIQAKYVRKTPIEKQKAVAEFGIACIIPAYLLVAVAKTPLVLYAGLFFY
Sbjct: 301 KVYLFTGLLMLPIQAKYVRKTPIEKQKAVAEFGIACIIPAYLLVAVAKTPLVLYAGLFFY 360
Query: 258 AIXXXXXXXXXXXXVHVIYPQSEKGVLAGIFRSLGCLARALGPVISSTFFWLLGATTCYI 79
AI VHVIYPQSEKGVLAGIFRSLGCLARALGPVISSTFFWLLGATTCYI
Sbjct: 361 AIASATVVTSLTSLVHVIYPQSEKGVLAGIFRSLGCLARALGPVISSTFFWLLGATTCYI 420
Query: 78 MGAXXXXXXXXXLKRLENPAAKKTV 4
MGA LKRLENPAAKKTV
Sbjct: 421 MGAFLLFIPLILLKRLENPAAKKTV 445
>gi|39596047|emb|CAE69683.1| Hypothetical protein CBG15936
[Caenorhabditis briggsae]
Length = 446
Score = 770 bits (1989), Expect = 0.0
Identities = 389/446 (87%), Positives = 408/446 (91%), Gaps = 1/446 (0%)
Frame = -1
Query: 1338 MTAIGPVDKKAVMKLLIPALICNMLAFTSILPLFPTILNYYSKEGHRDWLYDISVKGLQS 1159
MTAIGPVD+KAVMKLLIPALICNMLAFTSILPLFPTILNYYSKEGHRDWLYDISVKGLQS
Sbjct: 1 MTAIGPVDRKAVMKLLIPALICNMLAFTSILPLFPTILNYYSKEGHRDWLYDISVKGLQS 60
Query: 1158 FQEAIGVPHSERYDKVXXXXXXXXXXSALQFISSPTLGSLSDIYGRRAVISLCCIMTFIS 979
FQEAIGVPHSERYDKV SALQFISSPTLGSLSDIYGRRA+ISLCCI+TFIS
Sbjct: 61 FQEAIGVPHSERYDKVFFGGFLGSLFSALQFISSPTLGSLSDIYGRRAIISLCCIVTFIS 120
Query: 978 YVNWLKADIFAYFVLSRILGGLSKGNINVATAIVSDVYSPEDHPKGMALIGISYSLGFLI 799
YVNWLKAD FAYFVL+RILGGLSKGNINVATAIVSDVY+PEDHPKGMALIGISYSLGFLI
Sbjct: 121 YVNWLKADTFAYFVLARILGGLSKGNINVATAIVSDVYTPEDHPKGMALIGISYSLGFLI 180
Query: 798 GPMIGAYFSTIAS-IDSPFAYPAMFSIILTILEFGFLFFLPETLDLKEQKSLDDIKKTRK 622
GPMIGAYFSTIAS DSPFA PA+FSI+LT++EF FLFFLPETLDLKEQKSLDDIKKTRK
Sbjct: 181 GPMIGAYFSTIASSTDSPFAAPAIFSIVLTVIEFAFLFFLPETLDLKEQKSLDDIKKTRK 240
Query: 621 ELVTPKDLFQFTAVNAPQERKQEMQKVGWIYFLFLFLYSGLEFTLPFLTHIRFDFDNMQQ 442
EL+TPKDLFQFTAVNAPQ++K+EMQK+GWIYFLFLFLYSGLEFTLPFLTH+RFDFDNMQQ
Sbjct: 241 ELITPKDLFQFTAVNAPQDKKKEMQKIGWIYFLFLFLYSGLEFTLPFLTHLRFDFDNMQQ 300
Query: 441 GKVYLFTGLLMLPIQAKYVRKTPIEKQKAVAEFGIACIIPAYLLVAVAKTPLVLYAGLFF 262
GK+YLFTGLLMLPIQ KYVRKTPIEKQKAVAEFGIACIIPAYLLVAVA+TPLVLYAGLFF
Sbjct: 301 GKLYLFTGLLMLPIQGKYVRKTPIEKQKAVAEFGIACIIPAYLLVAVAQTPLVLYAGLFF 360
Query: 261 YAIXXXXXXXXXXXXVHVIYPQSEKGVLAGIFRSLGCLARALGPVISSTFFWLLGATTCY 82
YAI VHVIYPQ+EKGVLAGIFRSLGCLARALGPVISSTFFWLLGAT+CY
Sbjct: 361 YAIASATVVTSLTSLVHVIYPQNEKGVLAGIFRSLGCLARALGPVISSTFFWLLGATSCY 420
Query: 81 IMGAXXXXXXXXXLKRLENPAAKKTV 4
IMGA LKRLENP AKKTV
Sbjct: 421 IMGALLLIFPLILLKRLENPTAKKTV 446