Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= F01G4_6
(929 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539650|ref|NP_502087.1| phosphate carrier protein, mitochon... 583 e-165
gi|39593720|emb|CAE62012.1| Hypothetical protein CBG06020 [Caeno... 557 e-157
gi|39595156|emb|CAE60193.1| Hypothetical protein CBG03753 [Caeno... 474 e-132
gi|17532293|ref|NP_494870.1| mitochondrial substrate carrier fam... 471 e-131
gi|32563733|ref|NP_492561.2| mitochondrial substrate carrier fam... 469 e-131
gi|7507220|pir||T24543 hypothetical protein T05F1.8 - Caenorhabd... 459 e-128
gi|45709332|gb|AAH67565.1| Solute carrier family 25 (mitochondri... 451 e-125
gi|47523975|ref|NP_998887.1| solute carrier family 25 (mitochond... 450 e-125
gi|34783216|gb|AAH15379.2| SLC25A3 protein [Homo sapiens] 448 e-125
gi|4505775|ref|NP_002626.1| solute carrier family 25 member 3 is... 448 e-125
gi|30802109|gb|AAH51367.1| SLC25A3 protein [Homo sapiens] 448 e-125
gi|22760412|dbj|BAC11187.1| unnamed protein product [Homo sapiens] 446 e-124
gi|47217233|emb|CAF96756.1| unnamed protein product [Tetraodon n... 446 e-124
gi|20806141|ref|NP_620800.1| solute carrier family 25 (mitochond... 445 e-124
gi|19526818|ref|NP_598429.1| solute carrier family 25 (mitochond... 445 e-124
gi|627754|pir||D53737 phosphate carrier protein precursor, mitoc... 444 e-123
gi|45360435|ref|NP_988928.1| hypothetical protein MGC75614 [Xeno... 442 e-123
gi|47718004|gb|AAH70918.1| Unknown (protein for MGC:91476) [Ratt... 441 e-123
gi|6031192|ref|NP_005879.1| solute carrier family 25 member 3 is... 441 e-122
gi|27807185|ref|NP_777082.1| solute carrier family 25 (mitochond... 439 e-122
gi|28422708|gb|AAH46849.1| Slc25a3-prov protein [Xenopus laevis] 439 e-122
gi|41152303|ref|NP_957009.1| solute carrier family 25 (mitochond... 438 e-122
gi|50728534|ref|XP_416165.1| PREDICTED: similar to phosphate car... 437 e-121
gi|22653426|gb|AAN04052.1| mitochondrial inorganic phosphate car... 435 e-121
gi|4580727|gb|AAD24490.1| phosphate transporter precursor [Droso... 431 e-119
gi|24664191|ref|NP_524069.2| CG4994-PA [Drosophila melanogaster]... 430 e-119
gi|24656137|ref|NP_611468.1| CG9090-PA [Drosophila melanogaster]... 429 e-119
gi|31208749|ref|XP_313341.1| ENSANGP00000011905 [Anopheles gambi... 425 e-118
gi|31208745|ref|XP_313339.1| ENSANGP00000011843 [Anopheles gambi... 414 e-114
gi|6016596|sp|O61703|MPCP_CHOFU Phosphate carrier protein, mitoc... 405 e-112
gi|17557958|ref|NP_506148.1| phosphate transporter family member... 400 e-110
gi|39592296|emb|CAE75517.1| Hypothetical protein CBG23535 [Caeno... 394 e-108
gi|28207755|gb|AAO32620.1| CR057 protein [Chlamydomonas reinhard... 358 9e-98
gi|38344833|emb|CAD40869.2| OSJNBa0064H22.14 [Oryza sativa (japo... 336 5e-91
gi|7489796|pir||T01169 phosphate transport protein, mitochondria... 332 7e-90
gi|18150857|dbj|BAB83689.1| mitochondrial phosphate transporter ... 330 2e-89
gi|15241291|ref|NP_196908.1| mitochondrial phosphate transporter... 330 4e-89
gi|3318615|dbj|BAA31584.1| mitochondrial phosphate transporter [... 329 6e-89
gi|15229040|ref|NP_190454.1| mitochondrial phosphate transporter... 328 8e-89
gi|18252510|gb|AAL66293.1| phosphate transporter [Glycine max] 328 1e-88
gi|7488693|pir||T05707 phosphate transport protein G7, mitochond... 325 9e-88
gi|1842188|emb|CAA69726.1| mitochondrial phosphate translocator ... 322 1e-86
gi|19113000|ref|NP_596208.1| putative mitochondrial phosphate ca... 321 1e-86
gi|11358614|pir||T51595 phosphate transport protein, mitochondri... 312 8e-84
gi|49091306|ref|XP_407114.1| hypothetical protein AN2977.2 [Aspe... 305 1e-81
gi|50555990|ref|XP_505403.1| hypothetical protein [Yarrowia lipo... 304 2e-81
gi|46108696|ref|XP_381406.1| hypothetical protein FG01230.1 [Gib... 298 2e-79
gi|38099326|gb|EAA46685.1| hypothetical protein MG09906.4 [Magna... 295 1e-78
gi|32414543|ref|XP_327751.1| hypothetical protein [Neurospora cr... 293 5e-78
gi|50548035|ref|XP_501487.1| hypothetical protein [Yarrowia lipo... 291 2e-77
gi|50414018|ref|XP_457352.1| unnamed protein product [Debaryomyc... 286 3e-76
gi|34902136|ref|NP_912414.1| putative mitochondrial phosphate tr... 283 4e-75
gi|46436146|gb|EAK95514.1| hypothetical protein CaO19.1395 [Cand... 280 3e-74
gi|6320894|ref|NP_010973.1| Mitochondrial phosphate carrier, imp... 278 1e-73
gi|23508719|ref|NP_701387.1| PfmpC [Plasmodium falciparum 3D7] >... 269 6e-71
gi|23479265|gb|EAA16141.1| PfMPC [Plasmodium yoelii yoelii] 266 4e-70
gi|5881950|emb|CAB55764.1| putative mitochondrial phosphate carr... 264 2e-69
gi|15227801|ref|NP_179319.1| mitochondrial substrate carrier fam... 259 5e-68
gi|46228013|gb|EAK88933.1| mitochondrial phosphate translocator ... 256 5e-67
gi|6469119|emb|CAB61741.1| mitochondrial phosphate transporter [... 250 3e-65
gi|46445409|gb|EAL04678.1| hypothetical protein CaO19.12349 [Can... 240 4e-62
gi|49097792|ref|XP_410356.1| hypothetical protein AN6219.2 [Aspe... 236 5e-61
gi|45191051|ref|NP_985305.1| AER450Cp [Eremothecium gossypii] >g... 234 3e-60
gi|50287109|ref|XP_445984.1| unnamed protein product [Candida gl... 233 5e-60
gi|50304449|ref|XP_452174.1| unnamed protein product [Kluyveromy... 229 9e-59
gi|6322537|ref|NP_012611.1| Mitochondrial phosphate carrier, imp... 227 3e-58
gi|50415654|ref|XP_457484.1| unnamed protein product [Debaryomyc... 223 5e-57
gi|32409529|ref|XP_325245.1| hypothetical protein [Neurospora cr... 221 1e-56
gi|17946422|gb|AAL49244.1| RE67391p [Drosophila melanogaster] 220 4e-56
gi|49085830|ref|XP_405007.1| hypothetical protein AN0870.2 [Aspe... 219 5e-56
gi|50254527|gb|EAL17276.1| hypothetical protein CNBN1030 [Crypto... 218 2e-55
gi|7677017|emb|CAB89593.1| possible mitochondrial phosphate carr... 213 5e-54
gi|49077802|ref|XP_402720.1| hypothetical protein UM05105.1 [Ust... 213 5e-54
gi|38106979|gb|EAA53212.1| hypothetical protein MG07489.4 [Magna... 212 8e-54
gi|38108353|gb|EAA54385.1| hypothetical protein MG02370.4 [Magna... 212 8e-54
gi|46109418|ref|XP_381767.1| conserved hypothetical protein [Gib... 194 2e-48
gi|38107105|gb|EAA53324.1| hypothetical protein MG07601.4 [Magna... 189 8e-47
gi|48139042|ref|XP_396960.1| similar to CG9090-PA [Apis mellifera] 189 1e-46
gi|50259957|gb|EAL22623.1| hypothetical protein CNBB2550 [Crypto... 186 6e-46
gi|46134031|ref|XP_389331.1| hypothetical protein FG09155.1 [Gib... 181 3e-44
gi|49067560|ref|XP_398070.1| hypothetical protein UM00455.1 [Ust... 167 4e-40
gi|12958642|gb|AAK09387.1| phosphate carrier [Ophiophagus hannah] 164 2e-39
gi|31208747|ref|XP_313340.1| ENSANGP00000024173 [Anopheles gambi... 135 1e-30
gi|21757621|dbj|BAC05161.1| unnamed protein product [Homo sapiens] 96 6e-26
gi|16769102|gb|AAL28770.1| LD16544p [Drosophila melanogaster] 97 7e-19
gi|27803005|emb|CAD60708.1| unnamed protein product [Podospora a... 97 7e-19
gi|24641052|ref|NP_572639.2| CG1628-PB [Drosophila melanogaster]... 97 7e-19
gi|15222270|ref|NP_172184.1| mitochondrial substrate carrier fam... 96 9e-19
gi|49068770|ref|XP_398674.1| hypothetical protein UM01059.1 [Ust... 96 1e-18
gi|25406950|pir||A86205 hypothetical protein [imported] - Arabid... 94 3e-18
gi|50547439|ref|XP_501189.1| hypothetical protein [Yarrowia lipo... 93 7e-18
gi|22034628|gb|AAL13117.1| putative inner membrane solute transp... 93 1e-17
gi|38105554|gb|EAA51969.1| hypothetical protein MG03564.4 [Magna... 92 1e-17
gi|3378495|emb|CAA07568.1| Mitochondrial carrier protein [Ribes ... 92 1e-17
gi|27369998|ref|NP_766273.1| calcium-binding transporter; solute... 92 2e-17
gi|33286910|gb|AAH55369.1| Calcium-binding transporter [Mus musc... 92 2e-17
gi|20137652|sp|Q9HC21|DNC_HUMAN Mitochondrial deoxynucleotide ca... 91 4e-17
gi|15227718|ref|NP_180577.1| mitochondrial substrate carrier fam... 91 5e-17
gi|34860155|ref|XP_227597.2| similar to calcium-binding transpor... 90 6e-17
gi|31543632|ref|NP_068380.2| solute carrier family 25 (mitochond... 90 6e-17
gi|32421511|ref|XP_331199.1| hypothetical protein [Neurospora cr... 90 8e-17
gi|3991|emb|CAA29582.1| unnamed protein product [Saccharomyces c... 89 1e-16
gi|21553549|gb|AAM62642.1| putative mitochondrial carrier protei... 89 1e-16
gi|3994|emb|CAA39830.1| MRS3 protein [Saccharomyces cerevisiae] 89 1e-16
gi|6322328|ref|NP_012402.1| Mitochondrial iron transporter of th... 89 1e-16
gi|49092732|ref|XP_407827.1| hypothetical protein AN3690.2 [Aspe... 88 2e-16
gi|15241360|ref|NP_199918.1| mitochondrial substrate carrier fam... 88 3e-16
gi|49077502|ref|XP_402603.1| hypothetical protein UM04988.1 [Ust... 87 4e-16
gi|21593290|gb|AAM65239.1| unknown [Arabidopsis thaliana] 87 5e-16
gi|27694811|gb|AAH43993.1| LOC398474 protein [Xenopus laevis] 87 5e-16
gi|46128223|ref|XP_388665.1| hypothetical protein FG08489.1 [Gib... 86 9e-16
gi|46437608|gb|EAK96951.1| hypothetical protein CaO19.9724 [Cand... 86 9e-16
gi|33417112|gb|AAH56033.1| MGC68982 protein [Xenopus laevis] 86 9e-16
gi|6322905|ref|NP_012978.1| Mitochondrial iron transporter of th... 86 9e-16
gi|21313024|ref|NP_080347.1| solute carrier family 25 (mitochond... 86 1e-15
gi|45185946|ref|NP_983662.1| ACR260Wp [Eremothecium gossypii] >g... 86 1e-15
gi|21356611|ref|NP_650084.1| CG31305-PG [Drosophila melanogaster... 86 1e-15
gi|34222668|sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporte... 86 2e-15
gi|27369517|ref|NP_765990.1| mitochondrial folate transporter/ca... 86 2e-15
gi|49086846|ref|XP_405436.1| hypothetical protein AN1299.2 [Aspe... 85 3e-15
gi|11360341|pir||T50686 peroxisomal Ca-dependent solute carrier ... 85 3e-15
gi|15240954|ref|NP_195754.1| mitochondrial substrate carrier fam... 85 3e-15
gi|50425615|ref|XP_461404.1| unnamed protein product [Debaryomyc... 84 3e-15
gi|48374379|gb|AAT42021.1| mitochondrial folate transporter [Cri... 84 4e-15
gi|34866087|ref|XP_235359.2| similar to mitochondrial folate tra... 84 4e-15
gi|34875118|ref|XP_221118.2| similar to solute carrier family 25... 84 4e-15
gi|34907168|ref|NP_914931.1| putative mitochondrial carrier prot... 84 6e-15
gi|46435410|gb|EAK94792.1| hypothetical protein CaO19.4447 [Cand... 84 6e-15
gi|28386208|gb|AAH46767.1| Solute carrier family 25 (mitochondri... 84 6e-15
gi|31199987|ref|XP_308941.1| ENSANGP00000013246 [Anopheles gambi... 84 6e-15
gi|15620851|dbj|BAB67789.1| KIAA1896 protein [Homo sapiens] 83 8e-15
gi|48290295|emb|CAF04496.1| small calcium-binding mitochondrial ... 83 8e-15
gi|48290299|emb|CAF04498.1| small calcium-binding mitochondrial ... 83 8e-15
gi|47109344|emb|CAF04060.1| mitochondrial ATP-Mg/Pi carrier [Hom... 83 8e-15
gi|38197071|gb|AAH05163.2| SLC25A25 protein [Homo sapiens] 83 8e-15
gi|39930485|ref|NP_443133.1| solute carrier family 25 (mitochond... 83 8e-15
gi|48290293|emb|CAF04495.1| small calcium-binding mitochondrial ... 83 8e-15
gi|15234063|ref|NP_192019.1| mitochondrial substrate carrier fam... 82 1e-14
gi|47218543|emb|CAF98075.1| unnamed protein product [Tetraodon n... 82 2e-14
gi|46390391|dbj|BAD15855.1| putative Mcsc-pending-prov protein [... 82 2e-14
gi|31210049|ref|XP_313991.1| ENSANGP00000009911 [Anopheles gambi... 82 2e-14
gi|46249805|gb|AAH68561.1| Solute carrier family 25 member 24, i... 82 2e-14
gi|47211393|emb|CAF90629.1| unnamed protein product [Tetraodon n... 82 2e-14
gi|45710075|gb|AAH14519.1| Solute carrier family 25 member 24, i... 82 2e-14
gi|24645975|ref|NP_731587.1| CG31305-PB [Drosophila melanogaster... 82 2e-14
gi|47458041|ref|NP_998816.1| solute carrier family 25 member 24 ... 82 2e-14
gi|21357737|ref|NP_651600.1| CG4963-PA [Drosophila melanogaster]... 81 3e-14
gi|33598954|ref|NP_037518.2| solute carrier family 25 member 24 ... 81 3e-14
gi|50293227|ref|XP_449025.1| unnamed protein product [Candida gl... 81 4e-14
gi|39582673|emb|CAE73777.1| Hypothetical protein CBG21322 [Caeno... 80 5e-14
gi|17554998|ref|NP_498094.1| solute carrier family 25 member 15 ... 80 6e-14
gi|15240756|ref|NP_196349.1| mitochondrial substrate carrier fam... 80 6e-14
gi|47226681|emb|CAG07840.1| unnamed protein product [Tetraodon n... 80 8e-14
gi|50750910|ref|XP_422180.1| PREDICTED: similar to Solute carrie... 80 8e-14
gi|50757414|ref|XP_415513.1| PREDICTED: similar to mitochondrial... 80 8e-14
gi|50292295|ref|XP_448580.1| unnamed protein product [Candida gl... 79 1e-13
gi|50419171|ref|XP_458108.1| unnamed protein product [Debaryomyc... 79 1e-13
gi|6322555|ref|NP_012629.1| Mitochondrial succinate-fumarate tra... 79 1e-13
gi|31203391|ref|XP_310644.1| ENSANGP00000007451 [Anopheles gambi... 79 1e-13
gi|14042724|dbj|BAB55368.1| unnamed protein product [Homo sapiens] 79 2e-13
gi|21314739|ref|NP_110407.2| mitochondrial folate transporter/ca... 79 2e-13
gi|31216089|ref|XP_316164.1| ENSANGP00000020391 [Anopheles gambi... 79 2e-13
gi|44890495|gb|AAH66998.1| Slc25a25 protein [Mus musculus] 78 2e-13
gi|18043565|gb|AAH19978.1| Slc25a25 protein [Mus musculus] >gnl|... 78 2e-13
gi|31215685|ref|XP_316075.1| ENSANGP00000022876 [Anopheles gambi... 78 2e-13
gi|34222684|sp|Q95J75|MFTC_MACFA Mitochondrial folate transporte... 78 2e-13
gi|11545417|gb|AAG37834.1| folate transporter/carrier [Homo sapi... 78 2e-13
gi|28972868|dbj|BAC65850.1| mKIAA1896 protein [Mus musculus] 78 2e-13
gi|26340134|dbj|BAC33730.1| unnamed protein product [Mus musculu... 78 2e-13
gi|31560754|ref|NP_666230.2| mitochondrial Ca2+-dependent solute... 78 2e-13
gi|34856299|ref|XP_218743.2| similar to solute carrier family 25... 78 2e-13
gi|21728406|ref|NP_663710.1| mitochondrial Ca2+-dependent solute... 78 2e-13
gi|396595|emb|CAA80973.1| ACR1-protein [Saccharomyces cerevisiae] 78 3e-13
gi|1785635|emb|CAA65633.1| mitochondrial citrate transport prote... 78 3e-13
gi|7512351|pir||G01789 citrate transporter protein - human >gnl|... 78 3e-13
gi|21389315|ref|NP_005975.1| solute carrier family 25 (mitochond... 78 3e-13
gi|46431307|gb|EAK90893.1| hypothetical protein CaO19.3518 [Cand... 78 3e-13
gi|17158033|ref|NP_080607.2| mitochondrial solute carrier protei... 77 4e-13
gi|49080904|ref|XP_403918.1| hypothetical protein UM06303.1 [Ust... 77 4e-13
gi|46117028|ref|XP_384532.1| hypothetical protein FG04356.1 [Gib... 77 7e-13
gi|50419543|ref|XP_458298.1| unnamed protein product [Debaryomyc... 77 7e-13
gi|47086085|ref|NP_998422.1| zgc:77454 [Danio rerio] >gnl|BL_ORD... 77 7e-13
gi|48096652|ref|XP_392496.1| similar to ENSANGP00000018542 [Apis... 76 9e-13
gi|8394297|ref|NP_059003.1| solute carrier family 25, member 1 p... 76 9e-13
gi|18425065|ref|NP_569032.1| mitochondrial substrate carrier fam... 76 1e-12
gi|21537040|gb|AAM61381.1| contains similarity to peroxisomal me... 76 1e-12
gi|27694792|gb|AAH43834.1| Mcsc-pending-prov protein [Xenopus la... 75 2e-12
gi|50306801|ref|XP_453376.1| unnamed protein product [Kluyveromy... 75 2e-12
gi|8132784|gb|AAF73387.1| unknown [Drosophila melanogaster] 75 2e-12
gi|13259543|ref|NP_073721.1| solute carrier family 25, member 14... 75 2e-12
gi|4507009|ref|NP_003942.1| solute carrier family 25, member 14 ... 75 2e-12
gi|13259162|gb|AAK16829.1| mitochondrial uncoupling protein UCP ... 75 2e-12
gi|21357261|ref|NP_648501.1| CG7314-PB [Drosophila melanogaster]... 75 2e-12
gi|50732900|ref|XP_418818.1| PREDICTED: similar to Hypothetical ... 75 3e-12
gi|34903084|ref|NP_912889.1| unnamed protein product [Oryza sati... 75 3e-12
gi|50745529|ref|XP_420143.1| PREDICTED: similar to solute carrie... 74 4e-12
gi|7768837|dbj|BAA95593.1| brain mitochondrial carrier protein-1... 74 4e-12
gi|6755544|ref|NP_035528.1| solute carrier family 25 (mitochondr... 74 4e-12
gi|17865339|ref|NP_445953.1| solute carrier family 25 (mitochond... 74 4e-12
gi|20141977|sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier pro... 74 4e-12
gi|31198539|ref|XP_308217.1| ENSANGP00000009305 [Anopheles gambi... 74 4e-12
gi|24637838|gb|AAN63886.1| brain mitochondrial carrier protein l... 74 4e-12
gi|24637836|gb|AAN63885.1| brain mitochondrial carrier protein s... 74 4e-12
gi|48843809|gb|AAT47068.1| putative peroxisomal Ca-dependent sol... 74 4e-12
gi|49067140|ref|XP_397860.1| hypothetical protein UM00245.1 [Ust... 74 5e-12
gi|13676520|dbj|BAB41176.1| hypothetical protein [Macaca fascicu... 74 5e-12
gi|45198325|ref|NP_985354.1| AFL196Wp [Eremothecium gossypii] >g... 74 6e-12
gi|17536687|ref|NP_496447.1| mitochondrial solute carrier (34.1 ... 74 6e-12
gi|46443782|gb|EAL03061.1| hypothetical protein CaO19.3931 [Cand... 74 6e-12
gi|20130387|ref|NP_611977.1| CG2857-PA [Drosophila melanogaster]... 73 8e-12
gi|38099451|gb|EAA46798.1| hypothetical protein MG10492.4 [Magna... 73 8e-12
gi|50310411|ref|XP_455225.1| unnamed protein product [Kluyveromy... 73 8e-12
gi|38083666|ref|XP_111757.2| mutant ornithine transporter 2 [Mus... 73 8e-12
gi|50294652|ref|XP_449737.1| unnamed protein product [Candida gl... 73 8e-12
gi|15231083|ref|NP_188659.1| mitochondrial substrate carrier fam... 73 8e-12
gi|34784032|gb|AAH56716.1| Zgc:65787 protein [Danio rerio] >gnl|... 73 8e-12
gi|21537282|gb|AAM61623.1| mitochondrial carrier protein, putati... 73 8e-12
gi|2226436|gb|AAB61765.1| LA-MSC [Oxytricha fallax] 73 8e-12
gi|47228502|emb|CAG05322.1| unnamed protein product [Tetraodon n... 73 8e-12
gi|47214999|emb|CAG03139.1| unnamed protein product [Tetraodon n... 73 1e-11
gi|31226914|ref|XP_317791.1| ENSANGP00000018102 [Anopheles gambi... 73 1e-11
gi|48106631|ref|XP_396134.1| similar to ENSANGP00000018102 [Apis... 73 1e-11
gi|15232420|ref|NP_190979.1| plant uncoupling mitochondrial prot... 73 1e-11
gi|46445453|gb|EAL04721.1| hypothetical protein CaO19.4733 [Cand... 73 1e-11
gi|27807191|ref|NP_777081.1| solute carrier family 25 (mitochond... 73 1e-11
gi|25152781|ref|NP_510638.2| solute carrier family 25 member 21 ... 73 1e-11
gi|45361631|ref|NP_989391.1| hypothetical protein MGC76218 [Xeno... 73 1e-11
gi|17137310|ref|NP_477221.1| CG3057-PA [Drosophila melanogaster]... 72 1e-11
gi|50754517|ref|XP_414419.1| PREDICTED: similar to S-adenosylmet... 72 1e-11
gi|45361479|ref|NP_989316.1| hypothetical protein MGC76123 [Xeno... 72 1e-11
gi|50731821|ref|XP_425937.1| PREDICTED: similar to mitochondrial... 72 1e-11
gi|45200786|ref|NP_986356.1| AGL311Cp [Eremothecium gossypii] >g... 72 1e-11
gi|46108300|ref|XP_381208.1| hypothetical protein FG01032.1 [Gib... 72 1e-11
gi|23943838|ref|NP_694790.1| solute carrier family 25, member 1;... 72 1e-11
gi|47223331|emb|CAF98715.1| unnamed protein product [Tetraodon n... 72 1e-11
gi|50309281|ref|XP_454647.1| unnamed protein product [Kluyveromy... 72 1e-11
gi|39597270|emb|CAE59498.1| Hypothetical protein CBG02884 [Caeno... 72 1e-11
gi|50307047|ref|XP_453501.1| unnamed protein product [Kluyveromy... 72 2e-11
gi|39592080|emb|CAE75300.1| Hypothetical protein CBG23270 [Caeno... 72 2e-11
gi|18424512|ref|NP_568940.1| mitochondrial substrate carrier fam... 72 2e-11
gi|24650120|ref|NP_651415.1| CG4743-PA [Drosophila melanogaster]... 72 2e-11
gi|34866642|ref|XP_217295.2| similar to hypothetical protein MGC... 72 2e-11
gi|27371299|gb|AAH41303.1| Slc25a1-prov protein [Xenopus laevis] 72 2e-11
gi|47219162|emb|CAG01825.1| unnamed protein product [Tetraodon n... 72 2e-11
gi|46445255|gb|EAL04524.1| hypothetical protein CaO19.12195 [Can... 72 2e-11
gi|19921888|ref|NP_610468.1| CG8026-PB [Drosophila melanogaster]... 72 2e-11
gi|27682801|ref|XP_226032.1| similar to mutant ornithine transpo... 72 2e-11
gi|24652037|ref|NP_724769.1| CG8026-PA [Drosophila melanogaster]... 71 3e-11
gi|19115195|ref|NP_594283.1| mitochondial carrier protein; putat... 71 3e-11
gi|50756207|ref|XP_415059.1| PREDICTED: similar to Hypothetical ... 71 3e-11
gi|46444126|gb|EAL03403.1| hypothetical protein CaO19.4966 [Cand... 71 4e-11
gi|15220023|ref|NP_178108.1| mitochondrial substrate carrier fam... 71 4e-11
gi|46440994|gb|EAL00295.1| hypothetical protein CaO19.5628 [Cand... 71 4e-11
gi|32414139|ref|XP_327549.1| hypothetical protein [Neurospora cr... 71 4e-11
gi|41053768|ref|NP_956550.1| hypothetical protein MGC55610 [Dani... 70 5e-11
gi|13537347|dbj|BAB40658.1| uncoupling protein [Oryza sativa (ja... 70 5e-11
gi|42570054|ref|NP_680566.2| mitochondrial substrate carrier fam... 70 5e-11
gi|49899706|gb|AAH76734.1| Unknown (protein for MGC:81365) [Xeno... 70 5e-11
gi|7106157|dbj|BAA92172.1| SfUCPa [Symplocarpus foetidus] 70 5e-11
gi|1351353|sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupli... 70 5e-11
gi|11225256|ref|NP_068605.1| uncoupling protein 1; mitochondrial... 70 5e-11
gi|19401698|gb|AAL87666.1| uncoupling protein [Zea mays] 70 5e-11
gi|47228784|emb|CAG07516.1| unnamed protein product [Tetraodon n... 70 7e-11
gi|18399114|ref|NP_564436.1| mitochondrial substrate carrier fam... 70 9e-11
gi|6841066|gb|AAF28888.1| calcium-binding transporter [Homo sapi... 70 9e-11
gi|34856875|ref|XP_215549.2| similar to osmotic stress protein [... 70 9e-11
gi|19075818|ref|NP_588318.1| putative mitochondrial carrier prot... 69 1e-10
gi|28277721|gb|AAH45464.1| Ucp4 protein [Danio rerio] >gnl|BL_OR... 69 1e-10
gi|50420127|ref|XP_458596.1| unnamed protein product [Debaryomyc... 69 1e-10
gi|25295878|pir||T52024 uncoupling protein [imported] - Arabidop... 69 1e-10
gi|39590729|emb|CAE65099.1| Hypothetical protein CBG09959 [Caeno... 69 1e-10
gi|12833101|dbj|BAB22390.1| unnamed protein product [Mus musculus] 69 1e-10
gi|47085863|ref|NP_998284.1| zgc:64212 [Danio rerio] >gnl|BL_ORD... 69 1e-10
gi|39979123|emb|CAE85498.1| probable succinate-fumarate transpor... 69 1e-10
gi|32418256|ref|XP_329606.1| hypothetical protein [Neurospora cr... 69 1e-10
gi|21593041|gb|AAM64990.1| putative carnitine/acylcarnitine tran... 69 1e-10
gi|24657945|ref|NP_647923.1| CG7514-PA [Drosophila melanogaster]... 69 1e-10
gi|50427569|ref|XP_462397.1| unnamed protein product [Debaryomyc... 69 1e-10
gi|17554166|ref|NP_499187.1| solute carrier family 25 member 1 (... 69 1e-10
gi|49071382|ref|XP_399980.1| hypothetical protein UM02365.1 [Ust... 69 1e-10
gi|27369824|ref|NP_766165.1| solute carrier family 25 (mitochond... 69 1e-10
gi|26331858|dbj|BAC29659.1| unnamed protein product [Mus musculu... 69 1e-10
gi|21450145|ref|NP_659042.1| cDNA sequence BC010801 [Mus musculu... 69 1e-10
gi|45383892|ref|NP_989438.1| uncoupling protein 3 (mitochondrial... 69 1e-10
gi|50307493|ref|XP_453726.1| unnamed protein product [Kluyveromy... 69 1e-10
gi|18424178|ref|NP_568894.1| uncoupling protein (UCP2) [Arabidop... 69 2e-10
gi|37681967|gb|AAQ97861.1| mitochondrial uncoupling protein 3 [D... 69 2e-10
gi|50748440|ref|XP_421247.1| PREDICTED: similar to solute carrie... 69 2e-10
gi|50556378|ref|XP_505597.1| hypothetical protein [Yarrowia lipo... 69 2e-10
gi|17539504|ref|NP_501552.1| agpet8 (29.0 kD) (4J697) [Caenorhab... 69 2e-10
gi|109392|pir||A32446 uncoupling protein - rabbit 69 2e-10
gi|19115123|ref|NP_594211.1| mitochondrial carrier protein; yeas... 69 2e-10
gi|46108986|ref|XP_381551.1| hypothetical protein FG01375.1 [Gib... 69 2e-10
gi|24582068|ref|NP_608977.1| CG18340-PA [Drosophila melanogaster... 69 2e-10
gi|17539126|ref|NP_502337.1| carrier family (34.6 kD) (4N47) [Ca... 69 2e-10
gi|6324796|ref|NP_014865.1| Mitochondrial inner membrane transpo... 69 2e-10
gi|16755900|gb|AAL28138.1| uncoupling protein UCP [Meleagris gal... 69 2e-10
gi|50287747|ref|XP_446303.1| unnamed protein product [Candida gl... 69 2e-10
gi|32412508|ref|XP_326734.1| hypothetical protein ( (AL513442) p... 69 2e-10
gi|46390080|dbj|BAD15497.1| putative Brittle-1 protein, chloropl... 68 3e-10
gi|41053632|ref|NP_957153.1| hypothetical protein MGC77760 [Dani... 68 3e-10
gi|13994341|ref|NP_114153.1| solute carrier family 25 member 2; ... 68 3e-10
gi|39586413|emb|CAE74071.1| Hypothetical protein CBG21724 [Caeno... 68 3e-10
gi|18921040|gb|AAL82482.1| putative uncoupling protein [Lycopers... 68 3e-10
gi|7489287|pir||T07793 uncoupling protein (clone StUCP7), mitoch... 68 3e-10
gi|37748220|gb|AAH59349.1| MGC69168 protein [Xenopus laevis] 68 3e-10
gi|6678495|ref|NP_033490.1| uncoupling protein 3, mitochondrial ... 68 3e-10
gi|19112333|ref|NP_595541.1| MC FAD transporter [Schizosaccharom... 68 3e-10
gi|39588024|emb|CAE57255.1| Hypothetical protein CBG00135 [Caeno... 68 3e-10
gi|28571665|ref|NP_731657.2| CG12201-PB [Drosophila melanogaster... 68 3e-10
gi|46094065|ref|NP_061331.2| mitochondrial carrier family protei... 68 3e-10
gi|39585532|emb|CAE65292.1| Hypothetical protein CBG10209 [Caeno... 68 3e-10
gi|6754952|ref|NP_035147.1| solute carrier family 25 (mitochondr... 68 3e-10
gi|136689|sp|P14271|UCP1_RABIT Mitochondrial brown fat uncouplin... 68 3e-10
gi|1944534|emb|CAA73099.1| colt [Drosophila melanogaster] 68 3e-10
gi|50545838|ref|XP_500457.1| hypothetical protein [Yarrowia lipo... 68 3e-10
gi|31200787|ref|XP_309341.1| ENSANGP00000008222 [Anopheles gambi... 68 3e-10
gi|32407871|ref|XP_324432.1| hypothetical protein [Neurospora cr... 68 3e-10
gi|39596407|emb|CAE63025.1| Hypothetical protein CBG07280 [Caeno... 68 3e-10
gi|22775580|dbj|BAC15532.1| uncoupling protein [Gallus gallus] 68 3e-10
gi|21356397|ref|NP_650034.1| CG6608-PA [Drosophila melanogaster]... 68 3e-10
gi|24638958|ref|NP_569856.2| CG5254-PA [Drosophila melanogaster]... 67 4e-10
gi|39722382|emb|CAE84416.1| putative DIC1 protein [Pichia angusta] 67 4e-10
gi|28849931|ref|NP_776635.1| uncoupling protein 3 (mitochondrial... 67 4e-10
gi|46442822|gb|EAL02108.1| hypothetical protein CaO19.804 [Candi... 67 4e-10
gi|6981692|ref|NP_036814.1| uncoupling protein 1; Uncoupling pro... 67 4e-10
gi|45361183|ref|NP_989179.1| hypothetical protein MGC75881 [Xeno... 67 4e-10
gi|6323818|ref|NP_013889.1| Hypothetical ORF; Ymr166cp [Saccharo... 67 4e-10
gi|12849571|dbj|BAB28397.1| unnamed protein product [Mus musculu... 67 6e-10
gi|6325278|ref|NP_015346.1| Mitochondrial transporter, acts both... 67 6e-10
gi|27673563|ref|XP_224969.1| similar to ornithine transporter [R... 67 6e-10
gi|16741519|gb|AAH16571.1| Slc25a13 protein [Mus musculus] 67 6e-10
gi|7497312|pir||T32897 hypothetical protein C42C1.10 - Caenorhab... 67 6e-10
gi|7657583|ref|NP_056644.1| solute carrier family 25 (mitochondr... 67 6e-10
gi|50730839|ref|XP_417040.1| PREDICTED: hypothetical protein XP_... 67 6e-10
gi|7110733|ref|NP_037299.1| uncoupling protein 3; Uncoupling pro... 67 6e-10
gi|17561410|ref|NP_505970.1| solute carrier (5M253) [Caenorhabdi... 67 6e-10
gi|26337655|dbj|BAC32513.1| unnamed protein product [Mus musculu... 67 6e-10
gi|30520231|ref|NP_848881.1| mitochondrial carrier family protei... 67 6e-10
gi|39595589|emb|CAE67090.1| Hypothetical protein CBG12501 [Caeno... 67 6e-10
gi|31238945|ref|XP_319886.1| ENSANGP00000010634 [Anopheles gambi... 67 6e-10
gi|50254564|gb|EAL17313.1| hypothetical protein CNBN1400 [Crypto... 67 7e-10
gi|50414715|gb|AAH77266.1| Unknown (protein for MGC:80014) [Xeno... 67 7e-10
gi|33114697|gb|AAP94991.1| uncoupling protein 3 [Dicrostonyx gro... 67 7e-10
gi|31240849|ref|XP_320838.1| ENSANGP00000017957 [Anopheles gambi... 67 7e-10
gi|50251364|dbj|BAD28391.1| mitochondrial substrate carrier prot... 67 7e-10
gi|50759536|ref|XP_417682.1| PREDICTED: similar to mitochondrial... 67 7e-10
gi|31206027|ref|XP_311965.1| ENSANGP00000011014 [Anopheles gambi... 67 7e-10
gi|47124656|gb|AAH70531.1| MGC78829 protein [Xenopus laevis] 67 7e-10
gi|11320972|gb|AAG33983.1| uncoupling protein 1 [Phodopus sungorus] 67 7e-10
gi|47227813|emb|CAG08976.1| unnamed protein product [Tetraodon n... 67 7e-10
gi|22331775|ref|NP_190962.2| mitochondrial substrate carrier fam... 67 7e-10
gi|38107122|gb|EAA53339.1| hypothetical protein MG07616.4 [Magna... 66 1e-09
gi|2522403|gb|AAC51785.1| uncoupling protein 3 [Homo sapiens] 66 1e-09
gi|2833329|sp|Q27238|ADT_ANOGA ADP,ATP carrier protein (ADP/ATP ... 66 1e-09
gi|31127297|gb|AAH52871.1| Carnitine/acylcarnitine translocase [... 66 1e-09
gi|41055086|ref|NP_956901.1| hypothetical protein MGC63578 [Dani... 66 1e-09
gi|50291791|ref|XP_448328.1| unnamed protein product [Candida gl... 66 1e-09
gi|4507807|ref|NP_003347.1| uncoupling protein 3 isoform UCP3L; ... 66 1e-09
gi|22002462|dbj|BAC06495.1| mitochondrial uncoupling protein [He... 66 1e-09
gi|47522914|ref|NP_999214.1| uncoupling protein 3 [Sus scrofa] >... 66 1e-09
gi|31217942|ref|XP_316535.1| ENSANGP00000009995 [Anopheles gambi... 66 1e-09
gi|4928052|gb|AAD33396.1| uncoupling protein 3 [Sus scrofa] 66 1e-09
gi|42742053|gb|AAS45212.1| mitochondrial uncoupling protein 3 [A... 66 1e-09
gi|15239754|ref|NP_199708.1| mitochondrial substrate carrier fam... 66 1e-09
gi|4836655|gb|AAD30505.1| ADP/ATP translocase [Ascaris suum] 66 1e-09
gi|50539780|ref|NP_001002360.1| zgc:92520 [Danio rerio] >gnl|BL_... 66 1e-09
gi|34854043|ref|XP_216078.2| similar to mitochondrial carrier fa... 66 1e-09
gi|21358457|ref|NP_651703.1| CG1907-PA [Drosophila melanogaster]... 66 1e-09
gi|50745467|ref|XP_420126.1| PREDICTED: similar to Mitochondrial... 66 1e-09
gi|10048462|ref|NP_065266.1| carnitine/acylcarnitine translocase... 66 1e-09
gi|16758854|ref|NP_446417.1| solute carrier family 25 (carnitine... 66 1e-09
gi|7657585|ref|NP_055067.1| solute carrier family 25 (mitochondr... 66 1e-09
gi|17540658|ref|NP_501198.1| solute carrier (4I239) [Caenorhabdi... 66 1e-09
gi|23574715|dbj|BAC20586.1| mitochondrial carnitine/acylcarnitin... 66 1e-09
gi|10503963|gb|AAG17977.1| unknown [Homo sapiens] >gnl|BL_ORD_ID... 66 1e-09
gi|50545217|ref|XP_500146.1| hypothetical protein [Yarrowia lipo... 66 1e-09
gi|11320976|gb|AAG33985.1| uncoupling protein 3 [Phodopus sungorus] 66 1e-09
gi|91090|pir||A31106 mitochondrial uncoupling protein - mouse 66 1e-09
gi|30409998|ref|NP_848473.1| RIKEN cDNA 1700034J06 [Mus musculus... 66 1e-09
gi|50732673|ref|XP_425987.1| PREDICTED: similar to Calcium-bindi... 66 1e-09
gi|30686563|ref|NP_850252.1| mitochondrial substrate carrier fam... 66 1e-09
gi|6678497|ref|NP_033489.1| uncoupling protein 1, mitochondrial;... 66 1e-09
gi|41055825|ref|NP_956458.1| similar to solute carrier family 25... 66 1e-09
gi|34784524|gb|AAH56737.1| Ucp2 protein [Danio rerio] >gnl|BL_OR... 66 1e-09
gi|18860079|ref|NP_573246.1| CG6492-PA [Drosophila melanogaster]... 65 2e-09
gi|47214965|emb|CAG10787.1| unnamed protein product [Tetraodon n... 65 2e-09
gi|31200401|ref|XP_309148.1| ENSANGP00000018542 [Anopheles gambi... 65 2e-09
gi|31207583|ref|XP_312758.1| ENSANGP00000020409 [Anopheles gambi... 65 2e-09
gi|50553306|ref|XP_504064.1| hypothetical protein [Yarrowia lipo... 65 2e-09
gi|49077738|ref|XP_402694.1| hypothetical protein UM05079.1 [Ust... 65 2e-09
gi|46433139|gb|EAK92591.1| hypothetical protein CaO19.7699 [Cand... 65 2e-09
gi|22266728|gb|AAM94902.1| ornithine transporter 2 [Homo sapiens] 65 2e-09
gi|50754473|ref|XP_414400.1| PREDICTED: similar to Slc25a20-prov... 65 2e-09
gi|345469|pir||S31935 ADP,ATP carrier protein - African malaria ... 65 2e-09
gi|21618784|gb|AAH31671.1| MGC34725 protein [Homo sapiens] 65 2e-09
gi|45190968|ref|NP_985222.1| AER366Wp [Eremothecium gossypii] >g... 65 2e-09
gi|22002963|emb|CAD43091.1| mitochondrial aspartate-glutamate ca... 65 2e-09
gi|31210353|ref|XP_314143.1| ENSANGP00000015740 [Anopheles gambi... 65 2e-09
gi|14195284|sp|Q9N2I9|UCP3_CANFA Mitochondrial uncoupling protei... 65 2e-09
gi|27735043|ref|NP_775908.1| hypothetical protein MGC34725 [Homo... 65 2e-09
gi|49096066|ref|XP_409493.1| hypothetical protein AN5356.2 [Aspe... 65 2e-09
gi|47156872|gb|AAT12275.1| plastidial ADP-glucose transporter [H... 65 2e-09
gi|27881739|gb|AAH44682.1| Ucp2-prov protein [Xenopus laevis] 65 2e-09
gi|7657581|ref|NP_055066.1| solute carrier family 25, member 13 ... 65 2e-09
gi|14195301|sp|Q9W720|UCP2_BRARE Mitochondrial uncoupling protei... 65 2e-09
gi|25408417|pir||B84773 probable mitochondrial carrier protein [... 65 2e-09
gi|28830044|gb|AAO52534.1| similar to Plasmodium falciparum (iso... 65 2e-09
gi|38372886|sp|Q9BXI2|ORT2_HUMAN Mitochondrial ornithine transpo... 65 2e-09
gi|34895726|ref|NP_909212.1| putative peroxisomal Ca-dependent s... 65 2e-09
gi|49250406|gb|AAH74600.1| Unknown (protein for MGC:69323) [Xeno... 65 2e-09
gi|39596351|emb|CAE69989.1| Hypothetical protein CBG16392 [Caeno... 65 2e-09
gi|3176760|gb|AAC18822.1| uncoupling protein 3 [Homo sapiens] 65 2e-09
gi|6523256|emb|CAB62206.1| aralar2 [Homo sapiens] 65 2e-09
gi|34874384|ref|XP_224361.2| similar to mitochondrial solute car... 65 2e-09
gi|6563262|gb|AAF17225.1| mitochondrial carrier family protein [... 65 3e-09
gi|28829745|gb|AAO52248.1| hypothetical protein [Dictyostelium d... 65 3e-09
gi|46125927|ref|XP_387517.1| hypothetical protein FG07341.1 [Gib... 65 3e-09
gi|231654|sp|P29518|BT1_MAIZE Brittle-1 protein, chloroplast pre... 65 3e-09
gi|46436144|gb|EAK95512.1| hypothetical protein CaO19.1393 [Cand... 65 3e-09
gi|46436245|gb|EAK95611.1| hypothetical protein CaO19.8971 [Cand... 65 3e-09
gi|21483338|gb|AAM52644.1| GH25190p [Drosophila melanogaster] 65 3e-09
gi|31044469|ref|NP_851845.1| solute carrier family 25, member 29... 65 3e-09
gi|34867789|ref|XP_234550.2| similar to chromosome 14 open readi... 65 3e-09
gi|49522572|gb|AAH75377.1| Unknown (protein for MGC:89095) [Xeno... 65 3e-09
gi|19920782|ref|NP_608976.1| CG9064-PA [Drosophila melanogaster]... 65 3e-09
gi|31340019|sp|Q8N8R3|CACL_HUMAN Mitchondrial carnitine/acylcarn... 65 3e-09
gi|28193150|emb|CAD62317.1| unnamed protein product [Homo sapiens] 65 3e-09
gi|31200033|ref|XP_308964.1| ENSANGP00000020278 [Anopheles gambi... 65 3e-09
gi|15236783|ref|NP_194966.1| mitochondrial substrate carrier fam... 65 3e-09
gi|50413055|ref|XP_457200.1| unnamed protein product [Debaryomyc... 64 4e-09
gi|1717948|sp|P10861|UCP1_BOVIN Mitochondrial brown fat uncoupli... 64 4e-09
gi|28261391|gb|AAO32817.1| ADP/ATP translocase [Bombyx mori] 64 4e-09
gi|27694786|gb|AAH43827.1| Slc25a20-prov protein [Xenopus laevis] 64 4e-09
gi|28828299|gb|AAO50963.1| similar to Mus musculus (Mouse). Calc... 64 4e-09
gi|38105462|gb|EAA51884.1| hypothetical protein MG03479.4 [Magna... 64 4e-09
gi|24663275|ref|NP_729802.1| CG32103-PB [Drosophila melanogaster... 64 4e-09
gi|28269709|gb|AAO32818.2| ADP/ATP translocase [Anopheles gambiae] 64 4e-09
gi|46124377|ref|XP_386742.1| conserved hypothetical protein [Gib... 64 4e-09
gi|6523177|emb|CAB62169.1| ARALAR 1 protein [Drosophila melanoga... 64 4e-09
gi|24663279|ref|NP_729803.1| CG32103-PC [Drosophila melanogaster... 64 4e-09
gi|46125507|ref|XP_387307.1| hypothetical protein FG07131.1 [Gib... 64 4e-09
gi|11067279|gb|AAG28807.1| unknown protein [Arabidopsis thaliana] 64 4e-09
gi|15341990|gb|AAH13194.1| Hypothetical protein FLJ20551 [Homo s... 64 4e-09
gi|34905862|ref|NP_914278.1| P0458E05.7 [Oryza sativa (japonica ... 64 4e-09
gi|50549725|ref|XP_502333.1| hypothetical protein [Yarrowia lipo... 64 4e-09
gi|18490466|gb|AAH22637.1| Slc25a24 protein [Mus musculus] 64 4e-09
gi|49131161|ref|XP_413018.1| hypothetical protein AN8881.2 [Aspe... 64 4e-09
gi|50423171|ref|XP_460166.1| unnamed protein product [Debaryomyc... 64 4e-09
gi|1351354|sp|P04575|UCP1_MESAU Mitochondrial brown fat uncoupli... 64 4e-09
gi|45360847|ref|NP_989099.1| carnitine/acylcarnitine translocase... 64 5e-09
gi|1857278|gb|AAB48411.1| uncoupling protein-2 [Homo sapiens] 64 5e-09
gi|46126995|ref|XP_388051.1| conserved hypothetical protein [Gib... 64 5e-09
gi|32415047|ref|XP_328003.1| hypothetical protein ( (AL451012) r... 64 5e-09
gi|38102594|gb|EAA49414.1| hypothetical protein MG01072.4 [Magna... 64 5e-09
gi|32419024|ref|XP_329990.1| AMINO ACID TRANSPORTER ARG-13 [Neur... 64 5e-09
gi|47228316|emb|CAG07711.1| unnamed protein product [Tetraodon n... 64 5e-09
gi|34881277|ref|XP_228559.2| similar to hypothetical protein MGC... 64 5e-09
gi|45551937|ref|NP_732519.2| CG4241-PB [Drosophila melanogaster]... 64 5e-09
gi|21340400|gb|AAM49148.1| uncoupling protein 1 [Dicrostonyx gro... 64 5e-09
gi|39593926|emb|CAE62219.1| Hypothetical protein CBG06270 [Caeno... 64 5e-09
gi|24648424|ref|NP_650891.1| CG4241-PA [Drosophila melanogaster]... 64 5e-09
gi|32407213|ref|XP_324194.1| hypothetical protein [Neurospora cr... 64 6e-09
gi|19115553|ref|NP_594641.1| agpet8 protein. [Schizosaccharomyce... 64 6e-09
gi|7522500|pir||T39385 probable mitochondrial carrier protein - ... 64 6e-09
gi|19112744|ref|NP_595952.1| putative mitochondrial carrier prot... 64 6e-09
gi|7008151|gb|AAF34905.1| uncoupling protein 1 [Macaca mulatta] 64 6e-09
gi|32419435|ref|XP_330161.1| hypothetical protein ( (AL389891) c... 64 6e-09
gi|9294686|dbj|BAB03052.1| mitochondrial carrier protein-like [A... 64 6e-09
gi|7487567|pir||T00435 probable mitochondrial carrier protein [i... 64 6e-09
gi|13879465|gb|AAH06711.1| Solute carrier family 25 (mitochondri... 64 6e-09
gi|24651389|ref|NP_651795.2| CG2139-PA [Drosophila melanogaster]... 64 6e-09
gi|18395659|ref|NP_564233.1| mitochondrial substrate carrier fam... 64 6e-09
gi|11359536|pir||T50990 hypothetical protein B7F18.90 [imported]... 64 6e-09
gi|18407372|ref|NP_566102.1| mitochondrial substrate carrier fam... 64 6e-09
gi|24651387|ref|NP_733364.1| CG2139-PC [Drosophila melanogaster]... 64 6e-09
gi|31202109|ref|XP_310002.1| ENSANGP00000015067 [Anopheles gambi... 64 6e-09
gi|18402984|ref|NP_566683.1| mitochondrial substrate carrier fam... 64 6e-09
gi|45191020|ref|NP_985274.1| AER419Wp [Eremothecium gossypii] >g... 64 6e-09
gi|45198664|ref|NP_985693.1| AFR146Wp [Eremothecium gossypii] >g... 64 6e-09
gi|9758516|dbj|BAB08924.1| carnitine/acylcarnitine translocase-l... 64 6e-09
gi|45552009|ref|NP_733366.2| CG2139-PB [Drosophila melanogaster]... 64 6e-09
gi|23574792|dbj|BAC20608.1| solute carrier family 25 member 13 [... 64 6e-09
gi|50256975|gb|EAL19693.1| hypothetical protein CNBG3210 [Crypto... 63 8e-09
gi|15238315|ref|NP_201302.1| mitochondrial substrate carrier fam... 63 8e-09
gi|6746567|gb|AAF27626.1| hydrogenosomal membrane protein 31 pre... 63 8e-09
gi|18422718|ref|NP_568670.1| mitochondrial carnitine/acyl carrie... 63 8e-09
gi|19114749|ref|NP_593837.1| mitochondrial carrier protein [Schi... 63 8e-09
gi|14195285|sp|Q9N2J1|UCP2_CANFA Mitochondrial uncoupling protei... 63 8e-09
gi|42544113|gb|AAR30171.1| mitochondrial uncoupling protein 2 [D... 63 8e-09
gi|5851675|emb|CAB55356.1| carnitine/acylcarnitine translocase [... 63 8e-09
gi|50730921|ref|XP_417080.1| PREDICTED: similar to Mitochondrial... 63 8e-09
gi|45185795|ref|NP_983511.1| ACR109Wp [Eremothecium gossypii] >g... 63 8e-09
gi|49098358|ref|XP_410639.1| hypothetical protein AN6502.2 [Aspe... 63 8e-09
gi|38969885|gb|AAH63207.1| LOC394840 protein [Xenopus tropicalis] 63 8e-09
gi|46436154|gb|EAK95522.1| hypothetical protein CaO19.1403 [Cand... 63 8e-09
gi|27754081|ref|NP_080531.2| solute carrier family 25 (mitochond... 63 8e-09
gi|33413916|gb|AAP45779.1| uncoupling protein 2 [Sminthopsis mac... 63 8e-09
gi|14195302|sp|Q9W725|UCP2_CYPCA Mitochondrial uncoupling protei... 63 8e-09
gi|38098654|gb|AAR10978.1| mitochondrial uncoupling protein 2 [L... 63 8e-09
>gi|17539650|ref|NP_502087.1| phosphate carrier protein,
mitochondrial precursor (36.7 kD) (4L912)
[Caenorhabditis elegans]
gi|730051|sp|P40614|MPCP_CAEEL Phosphate carrier protein,
mitochondrial precursor (PTP)
gi|7511515|pir||T19105 phosphate carrier protein - Caenorhabditis
elegans
gi|472906|emb|CAA53719.1| phosphate carrier protein [Caenorhabditis
elegans]
gi|3874156|emb|CAA97430.1| Hypothetical protein F01G4.6
[Caenorhabditis elegans]
gi|3875464|emb|CAA92769.1| Hypothetical protein F01G4.6
[Caenorhabditis elegans]
Length = 340
Score = 583 bits (1502), Expect = e-165
Identities = 288/288 (100%), Positives = 288/288 (100%)
Frame = -3
Query: 927 GQVEFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRTTIAEE 748
GQVEFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRTTIAEE
Sbjct: 33 GQVEFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRTTIAEE 92
Query: 747 GARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLAASASAEF 568
GARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLAASASAEF
Sbjct: 93 GARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLAASASAEF 152
Query: 567 FADILLAPMEATKVRIQTSPGAPPTLRGCAPMIYKAEGLTGFYKGLPPLWMRQIPYTMMK 388
FADILLAPMEATKVRIQTSPGAPPTLRGCAPMIYKAEGLTGFYKGLPPLWMRQIPYTMMK
Sbjct: 153 FADILLAPMEATKVRIQTSPGAPPTLRGCAPMIYKAEGLTGFYKGLPPLWMRQIPYTMMK 212
Query: 387 FACFEKTVEALYQYVVPKPRAECSKAEQLVVTFVAGYIAGVFCAIVSHPADTVVSKLNQD 208
FACFEKTVEALYQYVVPKPRAECSKAEQLVVTFVAGYIAGVFCAIVSHPADTVVSKLNQD
Sbjct: 213 FACFEKTVEALYQYVVPKPRAECSKAEQLVVTFVAGYIAGVFCAIVSHPADTVVSKLNQD 272
Query: 207 SQATAGGILKKLGFAGVWKGLVPRIIMIGTLTALQWFIYDSVKVALNL 64
SQATAGGILKKLGFAGVWKGLVPRIIMIGTLTALQWFIYDSVKVALNL
Sbjct: 273 SQATAGGILKKLGFAGVWKGLVPRIIMIGTLTALQWFIYDSVKVALNL 320