Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= D2024_7
(816 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539512|ref|NP_501149.1| kf-pending protein (30.1 kD) (4I9) ... 522 e-147
gi|39593551|emb|CAE61843.1| Hypothetical protein CBG05817 [Caeno... 284 2e-75
gi|17543424|ref|NP_502605.1| kf-pending protein like (4O277) [Ca... 161 2e-38
gi|21746157|ref|NP_082103.1| kynurenine formamidase; fFormylkynu... 100 3e-20
gi|19353845|gb|AAH24452.1| Ammd protein [Mus musculus] 100 3e-20
gi|28175779|gb|AAH43309.1| Ammd protein [Mus musculus] 100 3e-20
gi|39587652|emb|CAE58590.1| Hypothetical protein CBG01757 [Caeno... 94 5e-18
gi|50745391|ref|XP_420090.1| PREDICTED: similar to Ammd protein ... 78 2e-13
gi|39587653|emb|CAE58591.1| Hypothetical protein CBG01758 [Caeno... 77 3e-13
gi|31197795|ref|XP_307845.1| ENSANGP00000018611 [Anopheles gambi... 71 2e-11
gi|27378470|ref|NP_769999.1| bll3359 [Bradyrhizobium japonicum U... 64 3e-09
gi|32398353|emb|CAD61042.1| putative esterase [Arthrobacter ilicis] 64 4e-09
gi|13474757|ref|NP_106326.1| hypothetical protein mll5717 [Mesor... 64 4e-09
gi|15706384|dbj|BAB68337.1| esterase [Acinetobacter sp. no. 6] 62 2e-08
gi|46102692|ref|XP_380226.1| hypothetical protein FG00050.1 [Gib... 60 6e-08
gi|15807999|ref|NP_285663.1| conserved hypothetical protein [Dei... 60 7e-08
gi|27379268|ref|NP_770797.1| blr4157 [Bradyrhizobium japonicum U... 58 2e-07
gi|39936052|ref|NP_948328.1| conserved hypothetical protein [Rho... 58 3e-07
gi|23123958|ref|ZP_00105982.1| COG0657: Esterase/lipase [Nostoc ... 58 3e-07
gi|13470818|ref|NP_102387.1| hypothetical protein mll0618 [Mesor... 56 1e-06
gi|50084328|ref|YP_045838.1| esterase [Acinetobacter sp. ADP1] >... 55 1e-06
gi|48848898|ref|ZP_00303142.1| COG0657: Esterase/lipase [Novosph... 55 2e-06
gi|42661051|ref|XP_375492.1| similar to Ammd protein [Homo sapiens] 54 5e-06
gi|39935746|ref|NP_948022.1| conserved hypothetical protein [Rho... 52 2e-05
gi|15673289|ref|NP_267463.1| hypothetical protein L141530 [Lacto... 50 4e-05
gi|46191984|ref|ZP_00007522.2| COG0657: Esterase/lipase [Rhodoba... 49 1e-04
gi|42522251|ref|NP_967631.1| similar to lipase LipA [Bdellovibri... 49 1e-04
gi|48850199|ref|ZP_00304441.1| COG0657: Esterase/lipase [Novosph... 48 3e-04
gi|46364643|ref|ZP_00227236.1| COG0657: Esterase/lipase [Kineoco... 47 4e-04
gi|16262591|ref|NP_435384.1| conserved hypothetical protein [Sin... 47 5e-04
gi|13473080|ref|NP_104647.1| contains similarity to lipase/ester... 47 5e-04
gi|18309289|ref|NP_561223.1| probable lipase [Clostridium perfri... 47 5e-04
gi|48768704|ref|ZP_00273052.1| COG0657: Esterase/lipase [Ralston... 46 8e-04
gi|46311539|ref|ZP_00212144.1| COG0657: Esterase/lipase [Burkhol... 46 8e-04
gi|50548117|ref|XP_501528.1| hypothetical protein [Yarrowia lipo... 46 0.001
gi|19920830|ref|NP_609036.1| CG9542-PA [Drosophila melanogaster]... 46 0.001
gi|48826365|ref|ZP_00287575.1| COG0657: Esterase/lipase [Enteroc... 45 0.001
gi|48782200|ref|ZP_00278752.1| COG0657: Esterase/lipase [Burkhol... 45 0.001
gi|12862421|dbj|BAB32459.1| hypothetical protein [Pseudomonas sp... 45 0.001
gi|49066906|ref|XP_397743.1| hypothetical protein UM00128.1 [Ust... 45 0.002
gi|21304466|gb|AAM45391.1| esterase [Propionibacterium freudenre... 44 0.004
gi|33591534|ref|NP_879178.1| putative esterase [Bordetella pertu... 43 0.007
gi|15805847|ref|NP_294545.1| lipase, putative [Deinococcus radio... 43 0.007
gi|46131710|ref|ZP_00170075.2| COG0657: Esterase/lipase [Ralston... 43 0.009
gi|50552079|ref|XP_503514.1| hypothetical protein [Yarrowia lipo... 43 0.009
gi|33598455|ref|NP_886098.1| putative esterase [Bordetella parap... 42 0.012
gi|29377640|ref|NP_816794.1| lipase, putative [Enterococcus faec... 42 0.012
gi|22972687|ref|ZP_00019551.1| hypothetical protein [Chloroflexu... 42 0.012
gi|11356536|pir||T43794 probable lipase lipA [imported] - Clostr... 42 0.016
gi|21593215|gb|AAM65164.1| unknown [Arabidopsis thaliana] 42 0.016
gi|18309161|ref|NP_561095.1| probable lipase [Clostridium perfri... 42 0.016
gi|46313685|ref|ZP_00214274.1| COG0657: Esterase/lipase [Burkhol... 42 0.021
gi|15237267|ref|NP_197112.1| expressed protein [Arabidopsis thal... 42 0.021
gi|48865712|ref|ZP_00319571.1| COG0657: Esterase/lipase [Oenococ... 42 0.021
gi|46140081|ref|XP_391731.1| hypothetical protein FG11555.1 [Gib... 41 0.027
gi|21282346|ref|NP_645434.1| ORFID:MW0617~hypothetical protein, ... 41 0.027
gi|15923645|ref|NP_371179.1| hypothetical protein SAV0655 [Staph... 41 0.027
gi|15926332|ref|NP_373865.1| hypothetical protein, similar to li... 41 0.027
gi|46317645|ref|ZP_00218223.1| COG0657: Esterase/lipase [Burkhol... 41 0.027
gi|21222059|ref|NP_627838.1| putative lipase/esterase [Streptomy... 41 0.035
gi|48771433|ref|ZP_00275775.1| COG0657: Esterase/lipase [Ralston... 40 0.060
gi|39593489|emb|CAE61781.1| Hypothetical protein CBG05741 [Caeno... 40 0.078
gi|47226582|emb|CAG08598.1| unnamed protein product [Tetraodon n... 39 0.10
gi|37526179|ref|NP_929523.1| hypothetical protein [Photorhabdus ... 39 0.10
gi|22326830|ref|NP_197090.2| expressed protein [Arabidopsis thal... 39 0.13
gi|42573379|ref|NP_974786.1| expressed protein [Arabidopsis thal... 39 0.13
gi|29469240|gb|AAO65353.1| LanU-like protein [Streptomyces muray... 39 0.13
gi|46128383|ref|XP_388745.1| hypothetical protein FG08569.1 [Gib... 39 0.13
gi|49482883|ref|YP_040107.1| putative esterase [Staphylococcus a... 39 0.13
gi|46366936|ref|ZP_00192244.3| COG0657: Esterase/lipase [Kineoco... 39 0.13
gi|46317588|ref|ZP_00218166.1| COG0657: Esterase/lipase [Burkhol... 39 0.17
gi|16080103|ref|NP_390929.1| ytpA [Bacillus subtilis subsp. subt... 39 0.17
gi|48865929|ref|ZP_00319787.1| COG0657: Esterase/lipase [Oenococ... 38 0.23
gi|33603458|ref|NP_891018.1| putative lipase [Bordetella bronchi... 38 0.23
gi|12584120|gb|AAG59804.1| esterase [Sphingomonas elodea] 38 0.23
gi|45530956|ref|ZP_00182044.1| COG0657: Esterase/lipase [Exiguob... 38 0.30
gi|50843749|ref|YP_056976.1| lipase/esterase [Propionibacterium ... 38 0.30
gi|2290998|gb|AAC46268.1| unknown [Bordetella pertussis] 38 0.30
gi|50420253|ref|XP_458659.1| unnamed protein product [Debaryomyc... 38 0.30
gi|33591396|ref|NP_879040.1| putative lipase [Bordetella pertuss... 38 0.30
gi|32411053|ref|XP_326007.1| hypothetical protein [Neurospora cr... 37 0.39
gi|27467342|ref|NP_763979.1| lipase LipA [Staphylococcus epiderm... 37 0.39
gi|46127629|ref|XP_388368.1| hypothetical protein FG08192.1 [Gib... 37 0.39
gi|48862168|ref|ZP_00316065.1| COG0657: Esterase/lipase [Microbu... 37 0.39
gi|9965294|gb|AAG10029.1| acetyl-hydrolase [Acinetobacter sp. SE... 37 0.39
gi|18409077|ref|NP_564936.1| expressed protein [Arabidopsis thal... 37 0.39
gi|28211180|ref|NP_782124.1| lipase [Clostridium tetani E88] >gn... 37 0.51
gi|33598514|ref|NP_886157.1| putative lipase [Bordetella paraper... 37 0.51
gi|47900282|gb|AAT39150.1| unknown protein [Oryza sativa (japoni... 37 0.51
gi|32474891|ref|NP_867885.1| probable lipase/esterase [Pirellula... 37 0.51
gi|23002822|ref|ZP_00046495.1| COG0657: Esterase/lipase [Lactoba... 37 0.66
gi|5509944|dbj|BAA82510.1| esterase HDE [petroleum-degrading bac... 37 0.66
gi|46913596|emb|CAG20382.1| hypothetical Lysophospholipase [Phot... 37 0.66
gi|50421021|ref|XP_459053.1| unnamed protein product [Debaryomyc... 37 0.66
gi|42519440|ref|NP_965370.1| hypothetical protein LJ1566 [Lactob... 36 0.87
gi|23129200|ref|ZP_00111033.1| COG1073: Hydrolases of the alpha/... 36 0.87
gi|28373559|pdb|1LZL|A Chain A, Bacterial Heroin Esterase 36 0.87
gi|28373558|pdb|1LZK|A Chain A, Bacterial Heroin Esterase Comple... 36 0.87
gi|48785928|ref|ZP_00282137.1| COG0657: Esterase/lipase [Burkhol... 36 0.87
gi|2088525|gb|AAC45283.1| heroin esterase [Rhodococcus sp.] 36 0.87
gi|46125515|ref|XP_387311.1| hypothetical protein FG07135.1 [Gib... 36 1.1
gi|42519652|ref|NP_965582.1| hypothetical protein LJ0673 [Lactob... 36 1.1
gi|25169026|emb|CAD47862.1| putative lipase (esterase) [Arthroba... 36 1.1
gi|23002674|ref|ZP_00046348.1| COG0657: Esterase/lipase [Lactoba... 35 1.5
gi|49088678|ref|XP_406135.1| hypothetical protein AN1998.2 [Aspe... 35 1.5
gi|48784122|ref|ZP_00280503.1| COG0657: Esterase/lipase [Burkhol... 35 1.5
gi|48729209|ref|ZP_00262960.1| COG0657: Esterase/lipase [Pseudom... 35 1.5
gi|27382617|ref|NP_774146.1| bll7506 [Bradyrhizobium japonicum U... 35 1.5
gi|49096484|ref|XP_409702.1| hypothetical protein AN5565.2 [Aspe... 35 1.9
gi|15231993|ref|NP_187509.1| DNAJ heat shock N-terminal domain-c... 35 1.9
gi|32472501|ref|NP_865495.1| probable lipase/esterase [Pirellula... 35 2.5
gi|18495821|emb|CAD10803.1| putative steroid monooxygenase / est... 35 2.5
gi|19553499|ref|NP_601501.1| carboxylesterase type B [Corynebact... 35 2.5
gi|18369806|dbj|BAB84098.1| carbo protein [Drosophila ananassae] 35 2.5
gi|17548029|ref|NP_521431.1| PUTATIVE LIPASE PROTEIN [Ralstonia ... 35 2.5
gi|39596104|emb|CAE69740.1| Hypothetical protein CBG16012 [Caeno... 35 2.5
gi|33599416|ref|NP_886976.1| putative acetyl esterase [Bordetell... 34 3.3
gi|33591521|ref|NP_879165.1| putative acetyl esterase [Bordetell... 34 3.3
gi|32477903|ref|NP_870897.1| probable lipase/esterase [Pirellula... 34 3.3
gi|29348509|ref|NP_812012.1| lipase, putative esterase [Bacteroi... 34 3.3
gi|50256302|gb|EAL19027.1| hypothetical protein CNBH1290 [Crypto... 34 3.3
gi|46436640|gb|EAK95999.1| hypothetical protein CaO19.7237 [Cand... 34 3.3
gi|48764418|ref|ZP_00268970.1| COG0657: Esterase/lipase [Rhodosp... 34 3.3
gi|48847957|ref|ZP_00302205.1| COG0657: Esterase/lipase [Novosph... 34 3.3
gi|38346007|emb|CAD40110.2| OSJNBa0035O13.9 [Oryza sativa (japon... 34 3.3
gi|39583832|emb|CAE74905.1| Hypothetical protein CBG22774 [Caeno... 34 4.3
gi|17567059|ref|NP_509437.1| arylacetamide deacetylase family me... 34 4.3
gi|46192797|ref|ZP_00207441.1| COG1653: ABC-type sugar transport... 34 4.3
gi|23126293|ref|ZP_00108194.1| COG0657: Esterase/lipase [Nostoc ... 34 4.3
gi|48848032|ref|ZP_00302279.1| COG0657: Esterase/lipase [Novosph... 34 4.3
gi|32400918|gb|AAP80677.1| esterase [Lactobacillus casei] 34 4.3
gi|12084996|ref|NP_073398.1| 13L protein [Yaba-like disease viru... 34 4.3
gi|15889129|ref|NP_354810.1| AGR_C_3351p [Agrobacterium tumefaci... 34 4.3
gi|22125022|ref|NP_668445.1| hypothetical protein y1118 [Yersini... 33 5.6
gi|16123011|ref|NP_406324.1| conserved hypothetical protein [Yer... 33 5.6
gi|46435097|gb|EAK94487.1| hypothetical protein CaO19.782 [Candi... 33 5.6
gi|32403530|ref|XP_322378.1| hypothetical protein [Neurospora cr... 33 5.6
gi|33595134|ref|NP_882777.1| putative acetyl esterase [Bordetell... 33 5.6
gi|48783183|ref|ZP_00279645.1| COG0657: Esterase/lipase [Burkhol... 33 5.6
gi|17540028|ref|NP_501702.1| arylacetamide deacetylase family me... 33 5.6
gi|29831074|ref|NP_825708.1| hypothetical protein SAV4531 [Strep... 33 5.6
gi|15241725|ref|NP_201024.1| expressed protein [Arabidopsis thal... 33 5.6
gi|29465750|gb|AAM14415.1| putative odorant-degrading enzyme [An... 33 5.6
gi|23470820|ref|ZP_00126152.1| COG0657: Esterase/lipase [Pseudom... 33 7.3
gi|48788187|ref|ZP_00284166.1| COG0657: Esterase/lipase [Burkhol... 33 7.3
gi|48763274|ref|ZP_00267829.1| COG0657: Esterase/lipase [Rhodosp... 33 7.3
gi|6320636|ref|NP_010716.1| Hypothetical ORF; Ydr428cp [Saccharo... 33 7.3
gi|39588433|emb|CAE72784.1| Hypothetical protein CBG20044 [Caeno... 33 9.6
gi|46315215|ref|ZP_00215798.1| COG0657: Esterase/lipase [Burkhol... 33 9.6
gi|17864083|gb|AAL47055.1| lipase [Bacillus sphaericus] 33 9.6
>gi|17539512|ref|NP_501149.1| kf-pending protein (30.1 kD) (4I9)
[Caenorhabditis elegans]
gi|7498190|pir||T34202 hypothetical protein D2024.2 -
Caenorhabditis elegans
gi|1086620|gb|AAA82290.1| Hypothetical protein D2024.2
[Caenorhabditis elegans]
Length = 271
Score = 522 bits (1344), Expect = e-147
Identities = 258/271 (95%), Positives = 258/271 (95%)
Frame = +1
Query: 1 MNEMTLLYSPSCWVPGKNRDEVMNDFFAGIKNAFEALKNDEKIPRKENVAYGMEENQKVD 180
MNEMTLLYSPSCWVPGKNRDEVMNDFFAGIKNAFEALKNDEKIPRKENVAYGMEENQKVD
Sbjct: 1 MNEMTLLYSPSCWVPGKNRDEVMNDFFAGIKNAFEALKNDEKIPRKENVAYGMEENQKVD 60
Query: 181 IWGDASDKLLIFIHGGYWAAGTRKDCLTPARCALNNEYAFASVGYGLSTEGRTLTETVED 360
IWGDASDKLLIFIHGGYWAAGTRKDCLTPARCALNNEYAFASVGYGLSTEGRTLTETVED
Sbjct: 61 IWGDASDKLLIFIHGGYWAAGTRKDCLTPARCALNNEYAFASVGYGLSTEGRTLTETVED 120
Query: 361 VVNGVDFILKLYPNVSNVLVGGHSAGAHLAMNAVARLRNPRIRGLLLFSGCYFLEELIGT 540
VVNGVDFILKLYPNVSNVLVGGHSAGAHLAMNAVARLRNPRIRGLLLFSGCYFLEELIGT
Sbjct: 121 VVNGVDFILKLYPNVSNVLVGGHSAGAHLAMNAVARLRNPRIRGLLLFSGCYFLEELIGT 180
Query: 541 EIGTDINLTTDQAKLNSCXXXXXXXXXXXXXVILGLQEAPKLIEQNRDFVAQQGQSRIEE 720
EIGTDINLTTDQAKLNSC VILGLQEAPKLIEQNRDFVAQQGQSRIEE
Sbjct: 181 EIGTDINLTTDQAKLNSCDLSKLDGLKLDSLVILGLQEAPKLIEQNRDFVAQQGQSRIEE 240
Query: 721 FPNSGHYTIMTNLLNHTSGEYLAMEKFLKNF 813
FPNSGHYTIMTNLLNHTSGEYLAMEKFLKNF
Sbjct: 241 FPNSGHYTIMTNLLNHTSGEYLAMEKFLKNF 271