Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= D1081_8
         (1660 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17506363|ref|NP_492303.1| cell division cycle 5-like (85.7 kD...   961   0.0
gi|39595616|emb|CAE67118.1| Hypothetical protein CBG12532 [Caeno...   878   0.0
gi|50745288|ref|XP_420058.1| PREDICTED: similar to KIAA0432 [Gal...   481   e-134
gi|20521049|dbj|BAA24862.2| KIAA0432 [Homo sapiens]                   481   e-134
gi|11067747|ref|NP_001244.1| CDC5-like; CDC5 (cell division cycl...   481   e-134
gi|16758290|ref|NP_445979.1| cell division cycle 5-like; CDC5 (c...   480   e-134
gi|22779899|ref|NP_690023.1| cell division cycle 5-like [Mus mus...   480   e-134
gi|50510485|dbj|BAD32228.1| mKIAA0432 protein [Mus musculus]          480   e-134
gi|31205987|ref|XP_311945.1| ENSANGP00000011065 [Anopheles gambi...   480   e-134
gi|41055178|ref|NP_957378.1| CDC5 cell division cycle 5-like [Da...   479   e-134
gi|38094588|ref|XP_135371.2| similar to Cell division cycle 5-li...   476   e-133
gi|19922992|ref|NP_612033.1| CG6905-PA [Drosophila melanogaster]...   471   e-131
gi|47224734|emb|CAG00328.1| unnamed protein product [Tetraodon n...   444   e-123
gi|38346500|emb|CAD40345.2| OSJNBa0020I02.14 [Oryza sativa (japo...   436   e-121
gi|1747310|dbj|BAA09598.1| Myb-like DNA binding protein [Arabido...   436   e-120
gi|15218276|ref|NP_172448.1| myb family transcription factor [Ar...   436   e-120
gi|41619098|gb|AAS10023.1| MYB transcription factor [Arabidopsis...   434   e-120
gi|18092653|gb|AAL59389.1| CDC5 protein [Zea mays]                    422   e-116
gi|50255441|gb|EAL18176.1| hypothetical protein CNBK1950 [Crypto...   394   e-108
gi|49108732|ref|XP_411632.1| hypothetical protein AN7495.2 [Aspe...   390   e-107
gi|15080686|dbj|BAB62527.1| CDC5 [Lentinula edodes]                   390   e-107
gi|32413601|ref|XP_327280.1| hypothetical protein [Neurospora cr...   389   e-106
gi|46136583|ref|XP_389983.1| hypothetical protein FG09807.1 [Gib...   386   e-106
gi|49076010|ref|XP_402026.1| hypothetical protein UM04411.1 [Ust...   381   e-104
gi|38109987|gb|EAA55775.1| hypothetical protein MG01426.4 [Magna...   374   e-102
gi|49118262|gb|AAH73270.1| Unknown (protein for IMAGE:5506478) [...   338   2e-91
gi|19114792|ref|NP_593880.1| cell division control protein 5; My...   333   1e-89
gi|50551167|ref|XP_503057.1| hypothetical protein [Yarrowia lipo...   332   2e-89
gi|49115339|gb|AAH73314.1| Unknown (protein for IMAGE:5511852) [...   311   3e-83
gi|23491057|gb|EAA22688.1| Myb2 protein [Plasmodium yoelii yoelii]    301   4e-80
gi|23508130|ref|NP_700800.1| Myb2 protein [Plasmodium falciparum...   299   2e-79
gi|46227321|gb|EAK88271.1| CDC5'CDC5 ortholog with 2 Myb domains...   276   1e-72
gi|50424501|ref|XP_460838.1| unnamed protein product [Debaryomyc...   250   6e-65
gi|4432963|dbj|BAA20885.1| Cdc5 [Homo sapiens]                        244   4e-63
gi|46445322|gb|EAL04591.1| hypothetical protein CaO19.12262 [Can...   222   2e-56
gi|6323869|ref|NP_013940.1| homolog of S. pombe cdc5+. c-Myb DNA...   212   2e-53
gi|50287407|ref|XP_446133.1| unnamed protein product [Candida gl...   211   4e-53
gi|50305131|ref|XP_452524.1| unnamed protein product [Kluyveromy...   196   1e-48
gi|45190946|ref|NP_985200.1| AER344Wp [Eremothecium gossypii] >g...   142   3e-32
gi|19073963|ref|NP_584569.1| hypothetical protein [Encephalitozo...   101   5e-20
gi|47125230|gb|AAH70808.1| Myb1 protein [Xenopus laevis]               86   3e-15
gi|6226654|sp|P52551|MYBB_XENLA Myb-related protein B (B-Myb) (M...    86   3e-15
gi|479393|pir||S33643 transforming protein B-myb - African clawe...    86   3e-15
gi|45384334|ref|NP_990649.1| v-myb myeloblastosis viral oncogene...    83   2e-14
gi|31980091|emb|CAD98760.1| MYB transcription factor R3 type [Po...    82   5e-14
gi|49619031|gb|AAT68100.1| b-myb [Danio rerio]                         81   7e-14
gi|16326133|dbj|BAB70510.1| Myb [Nicotiana tabacum]                    80   2e-13
gi|34860647|ref|XP_215922.2| similar to B-myb [Rattus norvegicus]      80   2e-13
gi|15234199|ref|NP_195071.1| myb family transcription factor (MY...    78   6e-13
gi|6678974|ref|NP_032678.1| myeloblastosis oncogene-like 2 [Mus ...    78   7e-13
gi|31980093|emb|CAD98761.1| MYB transcription factor R2R3 type [...    78   7e-13
gi|4505293|ref|NP_002457.1| MYB-related protein B; v-myb avian m...    78   7e-13
gi|30585111|gb|AAP36828.1| Homo sapiens v-myb myeloblastosis vir...    78   7e-13
gi|11358524|pir||T48253 myb-like protein - Arabidopsis thaliana ...    77   1e-12
gi|16326135|dbj|BAB70511.1| Myb [Nicotiana tabacum]                    77   1e-12
gi|18413894|ref|NP_568099.1| myb family transcription factor (MY...    77   1e-12
gi|15375301|gb|AAK54740.2| putative c-myb-like transcription fac...    77   1e-12
gi|6678972|ref|NP_032677.1| myeloblastosis oncogene-like 1 [Mus ...    76   2e-12
gi|34866249|ref|XP_232620.2| similar to transcriptional regulato...    76   2e-12
gi|41148718|ref|XP_034274.7| v-myb myeloblastosis viral oncogene...    76   2e-12
gi|28686|emb|CAA31656.1| unnamed protein product [Homo sapiens]        76   2e-12
gi|2506883|sp|P51960|MYBA_MOUSE Myb-related protein A (A-Myb)          76   2e-12
gi|2118433|pir||I49497 transforming protein A-myb - mouse >gnl|B...    76   2e-12
gi|21615545|emb|CAD36016.1| c-myb like protein [Sterkiella histr...    76   3e-12
gi|21615548|emb|CAD36018.1| c-myb like protein [Sterkiella histr...    76   3e-12
gi|730090|sp|Q08759|MYB_XENLA Myb protein >gnl|BL_ORD_ID|1458038...    75   4e-12
gi|34904272|ref|NP_913483.1| myb-like protein [Oryza sativa (jap...    75   4e-12
gi|37589316|gb|AAH59803.1| Cmyb protein [Danio rerio]                  75   4e-12
gi|7230673|gb|AAF43043.1| putative Myb-related domain [Papaver r...    75   4e-12
gi|18858447|ref|NP_571341.1| transcription factor cmyb [Danio re...    75   4e-12
gi|50546787|ref|XP_500863.1| hypothetical protein [Yarrowia lipo...    75   6e-12
gi|11358522|pir||T48510 MYB like protein - Arabidopsis thaliana ...    74   8e-12
gi|45384312|ref|NP_990637.1| c-myb proto-oncogene [Gallus gallus...    74   8e-12
gi|49075278|ref|XP_401716.1| hypothetical protein UM04101.1 [Ust...    74   8e-12
gi|7428542|pir||TVCHM transforming protein myb, splice form cont...    74   8e-12
gi|50252273|dbj|BAD28278.1| putative MYBY3 protein [Oryza sativa...    74   8e-12
gi|18416582|ref|NP_568249.1| myb family transcription factor (MY...    74   8e-12
gi|127591|sp|P01103|MYB_CHICK Myb proto-oncogene protein (C-myb)...    74   8e-12
gi|63628|emb|CAA32767.1| myb protein [Gallus gallus]                   74   1e-11
gi|47224242|emb|CAG09088.1| unnamed protein product [Tetraodon n...    74   1e-11
gi|10178146|dbj|BAB11591.1| unnamed protein product [Arabidopsis...    74   1e-11
gi|15375293|gb|AAK25747.2| putative transcription factor MYB115 ...    74   1e-11
gi|18421977|ref|NP_568581.1| myb family transcription factor (MY...    74   1e-11
gi|40714443|dbj|BAD06940.1| transcription factor C-MYB [Oryzias ...    74   1e-11
gi|34913174|ref|NP_917934.1| similar to transcription factor MYB...    74   1e-11
gi|47206165|emb|CAF92371.1| unnamed protein product [Tetraodon n...    74   1e-11
gi|34903242|ref|NP_912968.1| unnamed protein product [Oryza sati...    74   1e-11
gi|41619440|gb|AAS10103.1| MYB transcription factor [Arabidopsis...    73   2e-11
gi|107957|pir||S11198 transforming protein myb (clone Mbm-2) - h...    73   2e-11
gi|26353006|dbj|BAC40133.1| unnamed protein product [Mus musculus]     73   2e-11
gi|180660|gb|AAA52032.1| c-myb                                         73   2e-11
gi|1171090|sp|P46200|MYB_BOVIN Myb proto-oncogene protein (C-myb...    73   2e-11
gi|46361980|ref|NP_005366.2| v-myb myeloblastosis viral oncogene...    73   2e-11
gi|45502011|emb|CAE55172.1| v-myb myeloblastosis viral oncogene ...    73   2e-11
gi|1872200|gb|AAB49034.1| alternatively spliced product using ex...    73   2e-11
gi|45502015|emb|CAE55174.1| v-myb myeloblastosis viral oncogene ...    73   2e-11
gi|45504414|emb|CAF04484.1| c-myb13A_CDS [Homo sapiens]                73   2e-11
gi|26353626|dbj|BAC40443.1| unnamed protein product [Mus musculus]     73   2e-11
gi|40538782|ref|NP_778220.1| v-myb myeloblastosis viral oncogene...    73   2e-11
gi|45502017|emb|CAE55175.1| v-myb myeloblastosis viral oncogene ...    73   2e-11
gi|1872203|gb|AAB49037.1| alternatively spliced product using ex...    73   2e-11
gi|7428541|pir||TVHUMB transforming protein myb, splice form con...    73   2e-11
gi|1872204|gb|AAB49038.1| alternatively spliced product using ex...    73   2e-11
gi|1872201|gb|AAB49035.1| alternatively spliced product using ex...    73   2e-11
gi|19526459|ref|NP_034978.2| myeloblastosis proto-oncogene produ...    73   2e-11
gi|127594|sp|P06876|MYB_MOUSE Myb proto-oncogene protein (C-myb)...    73   2e-11
gi|29989|emb|CAA36371.1| unnamed protein product [Homo sapiens] ...    73   2e-11
gi|45382545|ref|NP_990563.1| v-myb myeloblastosis viral oncogene...    73   2e-11
gi|45502029|emb|CAE82649.1| v-myb myeloblastosis viral oncogene ...    73   2e-11
gi|1872202|gb|AAB49036.1| alternatively spliced product using ex...    73   2e-11
gi|18655633|pdb|1H88|C Chain C, Crystal Structure Of Ternary Pro...    73   2e-11
gi|68881|pir||TVMSMB transforming protein myb, normal form - mou...    73   2e-11
gi|1333884|emb|CAA26551.1| unnamed protein product [Mus musculus]      73   2e-11
gi|34451908|gb|AAQ72433.1| MYB family transcription factor [Goss...    72   3e-11
gi|2072499|gb|AAC47807.1| myb-related transcription factor [Stro...    72   3e-11
gi|49182289|gb|AAT57644.1| myb family transcription factor 109 [...    72   3e-11
gi|48057629|gb|AAT39952.1| putative MYB protein [Solanum demissum]     72   4e-11
gi|48209878|gb|AAT40484.1| putative Myb-like DNA-binding protein...    72   4e-11
gi|47227351|emb|CAF96900.1| unnamed protein product [Tetraodon n...    72   4e-11
gi|18401769|ref|NP_566597.1| myb family transcription factor (MY...    72   5e-11
gi|41619528|gb|AAS10122.1| MYB transcription factor [Arabidopsis...    72   5e-11
gi|15234013|ref|NP_193612.1| myb family transcription factor (MY...    72   5e-11
gi|30684782|ref|NP_850607.1| myb family transcription factor (MY...    72   5e-11
gi|8745325|gb|AAF78889.1| putative c-myb-like transcription fact...    72   5e-11
gi|21321780|gb|AAM47303.1| putative Myb/Myb-related protein [Ory...    71   7e-11
gi|15222362|ref|NP_177115.1| myb family transcription factor (MY...    71   9e-11
gi|11358543|pir||T51662 myb-related transcription factor MYB54 [...    71   9e-11
gi|15219462|ref|NP_177484.1| myb family transcription factor (MY...    71   9e-11
gi|38091116|emb|CAD71140.1| transcription factor myb109 [Gossypi...    71   9e-11
gi|127590|sp|P01104|MYB_AVIMB Transforming protein Myb >gnl|BL_O...    70   1e-10
gi|7428543|pir||QOYV transforming protein myb - avian myeloblast...    70   1e-10
gi|1945385|gb|AAC53141.1| A-myb protein [Mus musculus]                 70   1e-10
gi|7677132|gb|AAF67050.1| c-myb-like transcription factor [Secal...    70   1e-10
gi|34900756|ref|NP_911724.1| myb family transcription factor-lik...    70   1e-10
gi|3318707|pdb|1A5J|  Chicken B-Myb Dna Binding Domain, Repeat 2...    70   2e-10
gi|199938|gb|AAA39785.1| tumor-specific myb protein                    70   2e-10
gi|180656|gb|AAA52030.1| c-myb protein                                 70   2e-10
gi|33356951|pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3        70   2e-10
gi|999726|pdb|1MSE|C Chain C, C-Myb Dna-Binding Domain Complexed...    70   2e-10
gi|15233911|ref|NP_194999.1| myb family transcription factor [Ar...    70   2e-10
gi|18655643|pdb|1H8A|C Chain C, Crystal Structure Of Ternary Pro...    70   2e-10
gi|19526473|ref|NP_291075.1| myeloblastosis proto-oncogene produ...    70   2e-10
gi|211553|gb|AAA48696.1| c-myb oncogene product                        70   2e-10
gi|1197517|emb|CAA27724.1| myb proto-oncogene [Mus musculus]           70   2e-10
gi|42573243|ref|NP_974718.1| myb family transcription factor [Ar...    70   2e-10
gi|180658|gb|AAA52031.1| c-myb protein                                 70   2e-10
gi|15224693|ref|NP_180095.1| myb family transcription factor (MY...    70   2e-10
gi|1836090|gb|AAB46872.1| fusion gene [Mus sp.]                        70   2e-10
gi|6478940|gb|AAF14045.1| putative MYB family transcription fact...    69   3e-10
gi|14334582|gb|AAK59470.1| putative MYB family transcription fac...    69   3e-10
gi|15375286|gb|AAF25950.2| putative c-myb-like transcription fac...    69   3e-10
gi|18398487|ref|NP_566350.1| myb family transcription factor (MY...    69   3e-10
gi|21554916|gb|AAM63729.1| myb-like protein, putative [Arabidops...    69   3e-10
gi|15220910|ref|NP_173237.1| myb family transcription factor (MY...    69   3e-10
gi|25513679|pir||G86314 F2H15.17 protein - Arabidopsis thaliana ...    69   3e-10
gi|7939552|dbj|BAA95755.1| MYB transcription factor-like protein...    69   3e-10
gi|18395436|ref|NP_565291.1| myb family transcription factor (MY...    69   3e-10
gi|15375279|gb|AAD53099.2| putative transcription factor [Arabid...    69   3e-10
gi|48121180|ref|XP_393231.1| similar to Myb protein [Apis mellif...    69   3e-10
gi|7446165|pir||T00846 hypothetical protein T20F6.4 - Arabidopsi...    69   3e-10
gi|46117342|ref|XP_384689.1| hypothetical protein FG04513.1 [Gib...    69   3e-10
gi|6979341|gb|AAF34434.1| myb-like protein [Oryza sativa]              69   3e-10
gi|11358541|pir||T51660 myb-related transcription factor MYB52 [...    69   3e-10
gi|18406019|ref|NP_566841.1| myb family transcription factor (MY...    69   3e-10
gi|1709197|sp|Q05935|MYBA_XENLA Myb-related protein A (A-Myb) (X...    69   4e-10
gi|8574644|gb|AAF77638.1| putative c-myb-like transcription fact...    69   4e-10
gi|214600|gb|AAA49904.1| myb-related protein 2                         69   4e-10
gi|25403271|pir||D86394 protein T24P13.16 [imported] - Arabidops...    68   6e-10
gi|46438916|gb|EAK98240.1| hypothetical protein CaO19.3809 [Cand...    68   6e-10
gi|30678670|ref|NP_849276.1| myb family transcription factor [Ar...    68   6e-10
gi|18411365|ref|NP_567179.1| myb family transcription factor [Ar...    68   6e-10
gi|16326137|dbj|BAB70512.1| Myb [Nicotiana tabacum]                    68   6e-10
gi|18396049|ref|NP_564261.1| myb family transcription factor (MY...    68   6e-10
gi|34900330|ref|NP_911511.1| myb-like protein [Oryza sativa (jap...    68   6e-10
gi|25387535|pir||H86277 F14L17.12 protein - Arabidopsis thaliana...    68   6e-10
gi|18394106|ref|NP_563948.1| myb family transcription factor (MY...    68   6e-10
gi|32398806|emb|CAD98516.1| myb proto-oncogene protein, possible...    68   6e-10
gi|42407517|dbj|BAD10634.1| putative MYB transcription factor [O...    68   7e-10
gi|462671|sp|P34127|MYBH_DICDI Myb-like protein >gnl|BL_ORD_ID|1...    68   7e-10
gi|27979558|gb|AAL89810.1| Myb [Giardia intestinalis] >gnl|BL_OR...    68   7e-10
gi|25453366|gb|AAL25935.2| MYB [Giardia intestinalis]                  68   7e-10
gi|8745321|gb|AAF78887.1| putative c-myb-like transcription fact...    67   1e-09
gi|7438336|pir||T03825 myb protein homolog - rice >gnl|BL_ORD_ID...    67   1e-09
gi|33087073|gb|AAP92750.1| myb-related protein [Oryza sativa (ja...    67   1e-09
gi|18421897|ref|NP_568569.1| myb family transcription factor (MY...    67   1e-09
gi|47213968|emb|CAG00659.1| unnamed protein product [Tetraodon n...    67   1e-09
gi|18698672|gb|AAL78372.1| myb protein [Oryza sativa]                  67   1e-09
gi|45504723|gb|AAS66905.1| phantastica [Nicotiana tabacum]             67   1e-09
gi|22266667|dbj|BAC07540.1| myb-related transcription factor VlM...    67   2e-09
gi|47232542|dbj|BAD18977.1| myb-related transcription factor VvM...    67   2e-09
gi|22266661|dbj|BAC07537.1| myb-related transcription factor VlM...    67   2e-09
gi|48716240|dbj|BAD23776.1| putative myb protein [Oryza sativa (...    66   2e-09
gi|904102|gb|AAA70367.1| ORF span starts at bp 39; first start c...    66   2e-09
gi|17530961|ref|NP_511170.1| CG9045-PA [Drosophila melanogaster]...    66   2e-09
gi|68886|pir||TVFFMA transforming protein myb - fruit fly (Droso...    66   2e-09
gi|46228386|gb|EAK89285.1| SNAPc like transcription factor with ...    66   2e-09
gi|15375297|gb|AAK25750.2| putative transcription factor MYB118 ...    66   3e-09
gi|30688925|ref|NP_189416.2| myb family transcription factor (MY...    66   3e-09
gi|45357116|gb|AAS58517.1| MYB transcription factor [Arabidopsis...    66   3e-09
gi|15241488|ref|NP_196979.1| myb family transcription factor (MY...    66   3e-09
gi|32489825|emb|CAE04569.1| OSJNBb0039L24.8 [Oryza sativa (japon...    66   3e-09
gi|9972157|gb|AAG10600.1| MYB-related transcription factor PHAN1...    66   3e-09
gi|15375310|gb|AAK52088.2| putative transcription factor MYB64 [...    65   4e-09
gi|15238940|ref|NP_196666.1| myb family transcription factor [Ar...    65   4e-09
gi|47232546|dbj|BAD18979.1| myb-related transcription factor VvM...    65   4e-09
gi|50421829|ref|XP_459472.1| unnamed protein product [Debaryomyc...    65   5e-09
gi|47220464|emb|CAG03244.1| unnamed protein product [Tetraodon n...    65   6e-09
gi|47232544|dbj|BAD18978.1| myb-relared transcription factor VvM...    65   6e-09
gi|22266665|dbj|BAC07539.1| myb-related transcription factor VlM...    65   6e-09
gi|7489304|pir||T17027 MYB-related transcription factor - garden...    64   8e-09
gi|34913340|ref|NP_918017.1| Myb-like DNA-binding protein-like [...    64   8e-09
gi|9367652|emb|CAB97485.1| Glabrous 1 [Arabidopsis thaliana] >gn...    64   8e-09
gi|2129647|pir||S71285 myb-related protein, 33.2K - Arabidopsis ...    64   8e-09
gi|14719883|gb|AAG27463.2| myb-related transcription factor [Med...    64   8e-09
gi|20514371|gb|AAM23006.1| werewolf [Cucumis sativus]                  64   8e-09
gi|7446180|pir||T02989 myb-related protein 5 - rice >gnl|BL_ORD_...    64   8e-09
gi|30314006|gb|AAO49809.1| phantastica-like MYB protein [Eschsch...    64   1e-08
gi|438453|gb|AAC97388.1| GL1 mutant [Arabidopsis thaliana]             64   1e-08
gi|15529304|gb|AAL01216.1| glabrous 1 [Arabidopsis thaliana] >gn...    64   1e-08
gi|68888|pir||TVMUG1 trichome differentiation protein GL1 - Arab...    64   1e-08
gi|15529344|gb|AAL01236.1| glabrous 1 [Arabidopsis thaliana]           64   1e-08
gi|15232860|ref|NP_189430.1| trichome differentiation protein / ...    64   1e-08
gi|15529322|gb|AAL01225.1| glabrous 1 [Arabidopsis thaliana] >gn...    64   1e-08
gi|9367650|emb|CAB97484.1| Glabrous 1 [Arabidopsis thaliana] >gn...    64   1e-08
gi|15229664|ref|NP_190575.1| myb family transcription factor [Ar...    64   1e-08
gi|2832406|emb|CAA74604.1| R2R3-MYB transcription factor [Arabid...    64   1e-08
gi|30697680|ref|NP_851248.1| myb family transcription factor (MY...    64   1e-08
gi|15529362|gb|AAL01245.1| glabrous 1 [Arabidopsis lyrata]             64   1e-08
gi|15229055|ref|NP_190461.1| myb family transcription factor (MY...    64   1e-08
gi|7677136|gb|AAF67052.1| c-myb-like transcription factor [Adian...    64   1e-08
gi|2129648|pir||S71284 myb-related protein, 33.3K - Arabidopsis ...    64   1e-08
gi|15240708|ref|NP_201531.1| myb family transcription factor [Ar...    64   1e-08
gi|21592897|gb|AAM64847.1| myb-related protein, 33.3K [Arabidops...    64   1e-08
gi|15450393|gb|AAK96490.1| AT5g67300/K8K14_2 [Arabidopsis thalia...    64   1e-08
gi|15238028|ref|NP_197282.1| myb family transcription factor (MY...    64   1e-08
gi|9759057|dbj|BAB09579.1| Myb-like transcription factor-like pr...    64   1e-08
gi|13346178|gb|AAK19611.1| BNLGHi233 [Gossypium hirsutum]              64   1e-08
gi|7446164|pir||T01218 hypothetical protein F6N23.19 - Arabidops...    63   2e-08
gi|29251128|gb|EAA42612.1| GLP_487_58000_56558 [Giardia lamblia ...    63   2e-08
gi|14646866|gb|AAK71698.1| myb transcription factor homolog [Gia...    63   2e-08
gi|39589768|emb|CAE67003.1| Hypothetical protein CBG12402 [Caeno...    63   2e-08
gi|22266675|dbj|BAC07544.1| myb-related transcription factor VlM...    63   2e-08
gi|15224328|ref|NP_181299.1| myb family transcription factor (MY...    63   2e-08
gi|30024600|dbj|BAC75672.1| transcription factor MYB102 [Lotus c...    63   2e-08
gi|9954116|gb|AAG08961.1| tuber-specific and sucrose-responsive ...    63   2e-08
gi|9954114|gb|AAG08960.1| tuber-specific and sucrose-responsive ...    63   2e-08
gi|15228203|ref|NP_190344.1| myb family transcription factor (MY...    63   2e-08
gi|19548467|gb|AAL90657.1| P-type R2R3 Myb protein [Zea mays]          63   2e-08
gi|33146504|dbj|BAC79618.1| basal transcription factor SNAPc lar...    63   2e-08
gi|3941528|gb|AAC83640.1| putative transcription factor [Arabido...    63   2e-08
gi|14588604|dbj|BAB61618.1| transcription factor rough sheath 2 ...    63   2e-08
gi|15667539|dbj|BAB68270.1| transcription factor OsRS2 [Oryza sa...    63   2e-08
gi|15219650|ref|NP_176812.1| myb family transcription factor (MY...    62   3e-08
gi|18424163|ref|NP_568891.1| myb family transcription factor (MY...    62   3e-08
gi|7446176|pir||T04452 transforming protein myb homolog F4D11.70...    62   3e-08
gi|15042134|gb|AAK81916.1| CI protein [Tripsacum dactyloides]          62   3e-08
gi|9954112|gb|AAG08959.1| tuber-specific and sucrose-responsive ...    62   3e-08
gi|15235484|ref|NP_195443.1| myb family transcription factor (MY...    62   3e-08
gi|27529846|dbj|BAC53938.1| Myb-like protein [Nicotiana tabacum]       62   3e-08
gi|47680447|gb|AAT37168.1| transcription factor Myb2 [Triticum a...    62   4e-08
gi|15230123|ref|NP_189640.1| myb family transcription factor (MY...    62   4e-08
gi|32422291|ref|XP_331589.1| hypothetical protein [Neurospora cr...    62   4e-08
gi|28927688|gb|AAO62334.1| putative Myb-like DNA-binding protein...    62   4e-08
gi|4583431|gb|AAD25082.1| rough sheath2 protein [Zea mays] >gnl|...    62   4e-08
gi|41619496|gb|AAS10115.1| MYB transcription factor [Arabidopsis...    62   4e-08
gi|30697683|ref|NP_201053.2| myb family transcription factor (MY...    62   4e-08
gi|41619298|gb|AAS10070.1| MYB transcription factor [Arabidopsis...    62   4e-08
gi|15228182|ref|NP_191132.1| myb family transcription factor (MY...    62   4e-08
gi|6492385|dbj|BAA81733.2| GmMYB29A2 [Glycine max]                     62   4e-08
gi|5139806|dbj|BAA81732.1| GmMYB29A2 [Glycine max]                     62   4e-08
gi|5139802|dbj|BAA81730.1| GmMYB29A1 [Glycine max] >gnl|BL_ORD_I...    62   4e-08
gi|11358560|pir||T51680 myb-related transcription factor MYB75 [...    62   5e-08
gi|15230600|ref|NP_187888.1| myb family transcription factor (MY...    62   5e-08
gi|15242649|ref|NP_198849.1| myb family transcription factor [Ar...    62   5e-08
gi|5230656|gb|AAD40953.1| phantastica [Lycopersicon esculentum]        62   5e-08
gi|15223582|ref|NP_176057.1| myb family transcription factor (MY...    62   5e-08
gi|41619142|gb|AAS10033.1| MYB transcription factor [Arabidopsis...    62   5e-08
gi|34913750|ref|NP_918222.1| OSJNBa0051H17.23 [Oryza sativa (jap...    62   5e-08
gi|25456243|pir||T52590 probable transcription factor MYB96 [imp...    62   5e-08
gi|7673090|gb|AAF66730.1| An2 truncated protein [Petunia x hybrida]    61   7e-08
gi|49105151|ref|XP_411311.1| hypothetical protein AN7174.2 [Aspe...    61   7e-08
gi|41052590|dbj|BAD07932.1| putative myb-related protein [Oryza ...    61   7e-08
gi|82307|pir||JQ0956 myb-related protein 306 - garden snapdragon...    61   7e-08
gi|40643886|emb|CAD87010.1| MYB10 protein [Gerbera hybrid cv. 'T...    61   7e-08
gi|15219651|ref|NP_176813.1| myb family transcription factor, pu...    61   7e-08
gi|7673088|gb|AAF66729.1| An2 protein [Petunia integrifolia]           61   7e-08
gi|7446178|pir||T02985 myb-related protein 2 - rice >gnl|BL_ORD_...    61   9e-08
gi|9954118|gb|AAG08962.1| tuber-specific and sucrose-responsive ...    61   9e-08
gi|7673094|gb|AAF66732.1| An2 truncated protein [Petunia x hybrida]    61   9e-08
gi|7673096|gb|AAF66733.1| An2 truncated protein [Petunia axillaris]    61   9e-08
gi|15235149|ref|NP_194286.1| myb family transcription factor (MY...    61   9e-08
gi|25387539|pir||D85295 myb-like protein [imported] - Arabidopsi...    61   9e-08
gi|42408185|dbj|BAD09322.1| putative transcription factor Myb pr...    61   9e-08
gi|30024602|dbj|BAC75673.1| transcription factor MYB103 [Lotus c...    61   9e-08
gi|7446179|pir||T02987 myb-related protein 3 - rice >gnl|BL_ORD_...    61   9e-08
gi|32394464|gb|AAM93930.1| transforming protein myb [Griffithsia...    61   9e-08
gi|22327794|ref|NP_680426.1| myb family transcription factor (MY...    60   1e-07
gi|6491896|gb|AAF14064.1| MYB82 [Arabidopsis thaliana]                 60   1e-07
gi|33146546|dbj|BAC79723.1| putative myb protein [Oryza sativa (...    60   1e-07
gi|2129775|pir||S58283 myb-related protein Y13 - Arabidopsis tha...    60   1e-07
gi|34911526|ref|NP_917110.1| putative myb-related protein [Oryza...    60   1e-07
gi|22266673|dbj|BAC07543.1| myb-related transcription factor VlM...    60   1e-07
gi|15221336|ref|NP_177603.1| myb family transcription factor (cY...    60   1e-07
gi|5139814|dbj|BAA81736.1| GmMYB29B2 [Glycine max]                     60   1e-07
gi|15242947|ref|NP_200039.1| myb family transcription factor (MY...    60   1e-07
gi|282963|pir||S26604 myb-related protein Ph2 - garden petunia >...    60   1e-07
gi|15227806|ref|NP_179910.1| myb family transcription factor [Ar...    60   2e-07
gi|21593586|gb|AAM65553.1| putative MYB family transcription fac...    60   2e-07
gi|27802512|gb|AAO21378.1| R2R3 MYB protein MYB4 [Lolium perenne]      60   2e-07
gi|34908320|ref|NP_915507.1| putative MYB transcription factor [...    60   2e-07
gi|15218730|ref|NP_174726.1| myb family transcription factor [Ar...    60   2e-07
gi|46389897|dbj|BAD15518.1| putative tuber-specific and sucrose-...    60   2e-07
gi|19548409|gb|AAL90628.1| P-type R2R3 Myb protein [Sorghum bico...    60   2e-07
gi|2129776|pir||S58294 myb-related protein Y19 - Arabidopsis tha...    60   2e-07
gi|15529364|gb|AAL01246.1| glabrous 1 [Arabidopsis lyrata]             60   2e-07
gi|19548421|gb|AAL90634.1| P-type R2R3 Myb protein [Sorghum bico...    60   2e-07
gi|2832404|emb|CAA74603.1| R2R3-MYB transcription factor [Arabid...    60   2e-07
gi|15233968|ref|NP_195574.1| myb family transcription factor (MY...    60   2e-07
gi|4507107|ref|NP_003077.1| small nuclear RNA activating complex...    60   2e-07
gi|6552359|dbj|BAA88221.1| myb-related transcription factor LBM1...    60   2e-07
gi|15238535|ref|NP_198405.1| myb family transcription factor (MY...    60   2e-07
gi|45593281|gb|AAS68190.1| Myb transcription factor [Vitis vinif...    60   2e-07
gi|15229407|ref|NP_188966.1| myb family transcription factor (MY...    60   2e-07
gi|7673084|gb|AAF66727.1| An2 protein [Petunia x hybrida]              60   2e-07
gi|7673092|gb|AAF66731.1| An2 truncated protein [Petunia x hybrida]    59   3e-07
gi|19548449|gb|AAL90648.1| P-type R2R3 Myb protein [Zea mays]          59   3e-07
gi|19072734|gb|AAL84612.1| typical P-type R2R3 Myb protein [Zea ...    59   3e-07
gi|15239466|ref|NP_200897.1| receptor-like protein kinase (ATR1)...    59   3e-07
gi|6552389|dbj|BAA88224.1| myb-related transcription factor LBM4...    59   3e-07
gi|34902542|ref|NP_912617.1| putative transcription factor (myb)...    59   3e-07
gi|38707404|dbj|BAD04025.1| Myb protein [Oryza sativa (japonica ...    59   3e-07
gi|7673086|gb|AAF66728.1| An2 protein [Petunia integrifolia]           59   3e-07
gi|15238370|ref|NP_201326.1| myb family transcription factor (MY...    59   3e-07
gi|7438351|pir||T03974 anthocyanin biosynthesis regulatory prote...    59   3e-07
gi|15042120|gb|AAK81909.1| CI protein [Zea luxurians] >gnl|BL_OR...    59   3e-07
gi|15042122|gb|AAK81910.1| CI protein [Zea luxurians]                  59   3e-07
gi|28628949|gb|AAO49411.1| MYB2 [Dendrobium sp. XMW-2002-2]            59   3e-07
gi|34913210|ref|NP_917952.1| contains EST C28158(C60218)~myb-lik...    59   3e-07
gi|38707406|dbj|BAD04026.1| Myb protein [Oryza sativa (japonica ...    59   3e-07
gi|46981894|gb|AAT08017.1| anthocyanin biosynthesis regulatory p...    59   3e-07
gi|11273985|pir||T51632 myb-related transcription factor MYB4 [i...    59   3e-07
gi|7438347|pir||T01188 anthocyanin biosynthesis regulatory prote...    59   3e-07
gi|13346190|gb|AAK19617.1| GHMYB36 [Gossypium hirsutum]                59   3e-07
gi|7438349|pir||T03715 anthocyanin biosynthesis regulatory prote...    59   3e-07
gi|25989608|gb|AAN12274.1| PL transcription factor [Zea mays] >g...    59   3e-07
gi|45198815|ref|NP_985844.1| AFR297Wp [Eremothecium gossypii] >g...    59   3e-07
gi|49533779|gb|AAT66778.1| putative MYB related protein [Solanum...    59   3e-07
gi|15238116|ref|NP_196590.1| myb family transcription factor (MY...    59   3e-07
gi|47208914|emb|CAF93118.1| unnamed protein product [Tetraodon n...    59   3e-07
gi|7438350|pir||T03972 anthocyanin biosynthesis regulatory prote...    59   3e-07
gi|15219632|ref|NP_176811.1| myb family transcription factor (MY...    59   3e-07
gi|49123010|ref|XP_412514.1| hypothetical protein AN8377.2 [Aspe...    59   5e-07
gi|42408890|dbj|BAD10148.1| putative typical P-type R2R3 Myb pro...    59   5e-07
gi|50726439|dbj|BAD34048.1| myb-related transcription factor-lik...    59   5e-07
gi|33867693|gb|AAQ55181.1| anthocyanin 1 [Lycopersicon esculentum]     59   5e-07
gi|15236911|ref|NP_194423.1| myb family transcription factor (MY...    59   5e-07
gi|15229748|ref|NP_187751.1| myb family transcription factor (MY...    59   5e-07
gi|15042116|gb|AAK81907.1| CI protein [Zea mays subsp. parviglumis]    58   6e-07
gi|13492123|gb|AAK28090.1| transcriptional regulator 1 [Zea dipl...    58   6e-07
gi|13492139|gb|AAK28098.1| transcriptional regulator 1 [Zea dipl...    58   6e-07
gi|15042108|gb|AAK81903.1| CI protein [Zea mays subsp. parviglum...    58   6e-07
gi|30575840|gb|AAP32921.1| MYB1 [Boea crassifolia]                     58   6e-07
gi|127586|sp|P23592|MYBD_MAIZE Anthocyanin regulatory C1-I prote...    58   6e-07
gi|127585|sp|P10290|MYBC_MAIZE Anthocyanin regulatory C1 protein...    58   6e-07
gi|29569834|gb|AAO85386.1| myb-related protein c1-I-2K1 [Zea mays]     58   6e-07
gi|7438348|pir||T01189 anthocyanin biosynthesis regulatory prote...    58   6e-07
gi|19072764|gb|AAL84627.1| typical P-type R2R3 Myb protein [Oryz...    58   6e-07
gi|11273960|pir||T51645 myb-related transcription factor MYB30 [...    58   6e-07
gi|15228529|ref|NP_189533.1| myb family transcription factor (MY...    58   6e-07
gi|27125807|emb|CAD44619.1| MYB27 protein [Oryza sativa (japonic...    58   6e-07
gi|13346192|gb|AAK19618.1| GHMYB38 [Gossypium hirsutum]                58   6e-07
gi|15223917|ref|NP_172358.1| myb family transcription factor (MY...    58   6e-07
gi|11358548|pir||T51667 myb-related transcription factor MYB60 [...    58   6e-07
gi|38707434|dbj|BAD04040.1| Myb protein [Oryza glumipatula]            58   8e-07
gi|15239926|ref|NP_196228.1| myb family transcription factor (MY...    58   8e-07
gi|38707408|dbj|BAD04027.1| Myb protein [Oryza sativa (indica cu...    58   8e-07
gi|13492129|gb|AAK28093.1| transcriptional regulator 1 [Zea dipl...    58   8e-07
gi|41619464|gb|AAS10108.1| MYB transcription factor [Arabidopsis...    58   8e-07
gi|15239578|ref|NP_200234.1| myb family transcription factor (MY...    58   8e-07
gi|18421985|ref|NP_568582.1| myb family transcription factor (MY...    58   8e-07
gi|38707398|dbj|BAD04022.1| Myb protein [Oryza sativa (japonica ...    58   8e-07
gi|38707412|dbj|BAD04029.1| Myb protein [Oryza sativa (indica cu...    58   8e-07
gi|4138299|emb|CAA75509.1| transcriptional activator [Oryza sati...    58   8e-07
gi|38707418|dbj|BAD04032.1| Myb protein [Oryza rufipogon]              58   8e-07
gi|38707410|dbj|BAD04028.1| Myb protein [Oryza sativa (indica cu...    58   8e-07
gi|38707416|dbj|BAD04031.1| Myb protein [Oryza rufipogon]              58   8e-07
gi|30681268|ref|NP_850779.1| myb family transcription factor (MY...    58   8e-07
gi|27529840|dbj|BAC53935.1| hypothetical protein [Nicotiana taba...    58   8e-07
gi|30687964|ref|NP_564176.2| myb family transcription factor (MY...    58   8e-07
gi|11273984|pir||T51631 probable transcription factor MYB3 [impo...    58   8e-07
gi|34897900|ref|NP_910296.1| EST AU082058(C12976) corresponds to...    57   1e-06
gi|15227288|ref|NP_179263.1| myb family transcription factor [Ar...    57   1e-06
gi|15042126|gb|AAK81912.1| CI protein [Zea luxurians]                  57   1e-06
gi|20086315|gb|AAM08125.1| myb protein [Oryza sativa]                  57   1e-06
gi|13346186|gb|AAK19615.1| GHMYB10 [Gossypium hirsutum]                57   1e-06
gi|19074969|ref|NP_586475.1| similarity to Myb-related transcrip...    57   1e-06
gi|127579|sp|P20026|MYB1_HORVU Myb-related protein Hv1 >gnl|BL_O...    57   1e-06
gi|19072758|gb|AAL84624.1| typical P-type R2R3 Myb protein [Oryz...    57   1e-06
gi|27261820|ref|NP_758842.1| small nuclear RNA activating comple...    57   1e-06
gi|15231271|ref|NP_187963.1| myb family transcription factor [Ar...    57   1e-06
gi|34785254|gb|AAH57031.1| Snapc4 protein [Mus musculus]               57   1e-06
gi|18698674|gb|AAL78373.1| putative myb protein [Oryza sativa]         57   1e-06
gi|49388092|dbj|BAD25225.1| ATMYB4-like [Oryza sativa (japonica ...    57   1e-06
gi|19072768|gb|AAL84629.1| typical P-type R2R3 Myb protein [Oryz...    57   1e-06
gi|13492125|gb|AAK28091.1| transcriptional regulator 1 [Zea dipl...    57   1e-06
gi|15234262|ref|NP_192077.1| myb family transcription factor (MY...    57   1e-06
gi|15082210|gb|AAK84064.1| transcription factor MYB1 [Fragaria x...    57   1e-06
gi|34896174|ref|NP_909431.1| putative transcription factor (myb)...    57   1e-06
gi|7446159|pir||T09744 myb-related protein - upland cotton >gnl|...    57   1e-06
gi|14269351|gb|AAK58027.1| recombinant myb-like transcription fa...    57   1e-06
gi|14269339|gb|AAK58021.1| myb-like transcription factor Myb 3 [...    57   1e-06
gi|42407621|dbj|BAD08736.1| putative myb-related protein [Oryza ...    57   1e-06
gi|2597855|emb|CAA05357.1| Myb2 protein [Dictyostelium discoideum]     57   1e-06
gi|38707432|dbj|BAD04039.1| Myb protein [Oryza glaberrima]             57   1e-06
gi|19072762|gb|AAL84626.1| typical P-type R2R3 Myb protein [Oryz...    57   1e-06
gi|38707400|dbj|BAD04023.1| Myb protein [Oryza sativa (japonica ...    57   1e-06
gi|38707422|dbj|BAD04034.1| Myb protein [Oryza rufipogon]              57   1e-06
gi|18071376|gb|AAL58235.1| putative transcription factor [Oryza ...    57   1e-06
gi|28850285|gb|AAM45304.2| similar to Dictyostelium discoideum (...    57   1e-06
gi|15223463|ref|NP_176012.1| myb family transcription factor (MY...    57   1e-06
gi|34853083|ref|XP_342390.1| similar to RIKEN cDNA 5730436L13; s...    57   1e-06
gi|47847548|dbj|BAD21600.1| putative MYB transcription factor [O...    57   1e-06
gi|39725413|emb|CAE09057.1| MYB transcription factor [Eucalyptus...    57   1e-06
gi|34147924|gb|AAQ62540.1| R2R3-MYB transcription factor [Pinus ...    57   2e-06
gi|47680445|gb|AAT37167.1| transcription factor Myb1 [Triticum a...    57   2e-06
gi|14269349|gb|AAK58026.1| recombinant myb-like transcription fa...    57   2e-06
gi|50757183|ref|XP_415416.1| PREDICTED: similar to small nuclear...    57   2e-06
gi|30024598|dbj|BAC75671.1| transcription factor MYB101 [Lotus c...    57   2e-06
gi|15221129|ref|NP_177548.1| myb family transcription factor (MY...    57   2e-06
gi|15233066|ref|NP_191684.1| myb family transcription factor (MY...    57   2e-06
gi|45771829|emb|CAE75745.1| R2R3 MYB transcription factor [Capsi...    57   2e-06
gi|7438329|pir||T07398 myb-related transcription factor THM6 - t...    57   2e-06
gi|421983|pir||S35729 myb-related protein 2 - barley >gnl|BL_ORD...    57   2e-06
gi|19074352|ref|NP_585858.1| MYB-LIKE TRANSCRIPTION FACTOR [Ence...    57   2e-06
gi|40643884|emb|CAD87009.1| MYB9A protein [Gerbera hybrid cv. 'T...    57   2e-06
gi|28628947|gb|AAO49410.1| MYB1 [Dendrobium sp. XMW-2002-1]            56   2e-06
gi|17507085|ref|NP_492411.1| small nuclear RNA activating comple...    56   2e-06
gi|14249017|gb|AAK57699.1| myb-like transcription factor Myb 5 [...    56   2e-06
gi|14249019|gb|AAK57700.1| recombinant myb-like transcription fa...    56   2e-06
gi|5163184|gb|AAD40574.1| c-myb [Canis familiaris]                     56   2e-06
gi|15232609|ref|NP_187534.1| myb family transcription factor [Ar...    56   2e-06
gi|28628953|gb|AAO49413.1| MYB4 [Dendrobium sp. XMW-2002-4]            56   2e-06
gi|6552361|dbj|BAA88222.1| myb-related transcription factor LBM2...    56   2e-06
gi|42541169|gb|AAS19476.1| MYB2 [Tradescantia fluminensis]             56   2e-06
gi|19059|emb|CAA50223.1| MybHv33 [Hordeum vulgare subsp. vulgare]      56   2e-06
gi|547958|sp|P20027|MYB3_HORVU Myb-related protein Hv33 >gnl|BL_...    56   2e-06
gi|17507083|ref|NP_492412.1| small nuclear RNA activating comple...    56   2e-06
gi|9802570|gb|AAF99772.1| F22O13.30 [Arabidopsis thaliana]             56   2e-06
gi|23476299|gb|AAN28280.1| myb-like transcription factor 5 [Goss...    56   2e-06
gi|23476305|gb|AAN28283.1| myb-like transcription factor 5 [Goss...    56   2e-06
gi|11066265|gb|AAG28526.1| anther-specific myb-related protein 1...    56   2e-06
gi|14269335|gb|AAK58019.1| myb-like transcription factor Myb 3 [...    56   2e-06
gi|7438331|pir||T03827 myb protein homolog - rice >gnl|BL_ORD_ID...    56   2e-06
gi|38707430|dbj|BAD04038.1| Myb protein [Oryza rufipogon]              56   2e-06
gi|34896170|ref|NP_909429.1| hypothetical protein [Oryza sativa ...    56   2e-06
gi|28628961|gb|AAO49417.1| MYB8 [Dendrobium sp. XMW-2002-8]            56   2e-06
gi|7428545|pir||S58293 myb-related protein M4 - Arabidopsis thal...    56   2e-06
gi|2280530|dbj|BAA21619.1| ATMYB4 [Arabidopsis thaliana]               56   2e-06
gi|30690317|ref|NP_850879.1| myb family transcription factor (MY...    56   2e-06
gi|28812131|dbj|BAC64999.1| myb transcription factor (ATMYB4)-li...    56   3e-06
gi|50292901|ref|XP_448883.1| unnamed protein product [Candida gl...    56   3e-06
gi|13492147|gb|AAK28102.1| transcriptional regulator 1 [Zea dipl...    56   3e-06
gi|7438344|pir||T02984 myb-related protein 1 - rice >gnl|BL_ORD_...    56   3e-06
gi|15232334|ref|NP_191605.1| myb family transcription factor [Ar...    56   3e-06
gi|48926682|gb|AAT47471.1| putative myb protein [Oryza sativa (j...    56   3e-06
gi|38347068|emb|CAE05473.2| OSJNBa0006A01.9 [Oryza sativa (japon...    56   3e-06
gi|50311113|ref|XP_455580.1| unnamed protein product [Kluyveromy...    56   3e-06
gi|14269347|gb|AAK58025.1| recombinant myb-like transcription fa...    56   3e-06
gi|14269353|gb|AAK58028.1| recombinant myb-like transcription fa...    56   3e-06
gi|14269345|gb|AAK58024.1| recombinant myb-like transcription fa...    56   3e-06
gi|14269343|gb|AAK58023.1| recombinant myb-like transcription fa...    56   3e-06
gi|14269337|gb|AAK58020.1| myb-like transcription factor Myb 3 [...    56   3e-06
gi|28610112|gb|AAO48738.1| R2R3 Myb transcription factor MYB-IF2...    56   3e-06
gi|7438337|pir||T03850 myb-related protein myb1, TMV-inducible -...    56   3e-06
gi|34394006|dbj|BAC84030.1| myb protein [Oryza sativa (japonica ...    56   3e-06
gi|7438328|pir||T03828 myb protein - rice >gnl|BL_ORD_ID|306493 ...    56   3e-06
gi|18399724|ref|NP_566434.1| myb family transcription factor [Ar...    56   3e-06
gi|34910458|ref|NP_916576.1| putative transcription factor [Oryz...    56   3e-06
gi|45357092|gb|AAS58505.1| MYB transcription factor [Arabidopsis...    56   3e-06
gi|19072744|gb|AAL84617.1| typical P-type R2R3 Myb protein [Zea ...    56   3e-06
gi|282965|pir||S26606 myb-related protein 3 - garden petunia >gn...    55   4e-06
gi|32489528|emb|CAE04731.1| OSJNBa0043L24.19 [Oryza sativa (japo...    55   4e-06
gi|15223612|ref|NP_176068.1| myb family transcription factor (MY...    55   4e-06
gi|34901838|ref|NP_912265.1| putative myb-related protein [Oryza...    55   4e-06
gi|31339302|dbj|BAC77066.1| MYBC05 [Perilla frutescens var. crispa]    55   4e-06
gi|45239436|gb|AAS55703.1| MYB1 [Nicotiana benthamiana]                55   4e-06
gi|28628965|gb|AAO49419.1| MYB10 [Dendrobium sp. XMW-2002-10]          55   4e-06
gi|45190431|ref|NP_984685.1| AEL176Cp [Eremothecium gossypii] >g...    55   4e-06
gi|50405265|ref|YP_054357.1| Myb-related protein, putative [Para...    55   4e-06
gi|28610110|gb|AAO48737.1| R2R3 Myb transcription factor MYB-IF3...    55   4e-06
gi|30024604|dbj|BAC75674.1| transcription factor MYB101 [Glycine...    55   4e-06
gi|14269333|gb|AAK58018.1| myb-like transcription factor Myb 3 [...    55   4e-06
gi|82308|pir||JQ0960 myb-related protein 308 - garden snapdragon       55   4e-06
gi|7438339|pir||T09758 myb-related protein - upland cotton >gnl|...    55   5e-06
gi|14249015|gb|AAK57698.1| myb-like transcription factor Myb 5 [...    55   5e-06
gi|19548447|gb|AAL90647.1| P-type R2R3 Myb protein [Zea mays]          55   5e-06
gi|22329445|ref|NP_172425.2| myb family transcription factor (MY...    55   5e-06
gi|13346194|gb|AAK19619.1| GHMYB9 [Gossypium hirsutum]                 55   5e-06
gi|30686014|ref|NP_197179.2| myb family transcription factor (MY...    55   5e-06
gi|23476297|gb|AAN28279.1| myb-like transcription factor 3 [Goss...    55   5e-06


>gi|17506363|ref|NP_492303.1| cell division cycle 5-like (85.7 kD)
            (1J71) [Caenorhabditis elegans]
 gi|7498153|pir||T20320 hypothetical protein D1081.8 - Caenorhabditis
            elegans
 gi|3875326|emb|CAB00029.1| Hypothetical protein D1081.8
            [Caenorhabditis elegans]
 gi|3878165|emb|CAB00038.1| Hypothetical protein D1081.8
            [Caenorhabditis elegans]
          Length = 755

 Score =  961 bits (2485), Expect = 0.0
 Identities = 498/553 (90%), Positives = 498/553 (90%)
 Frame = +1

Query: 1    MVRVIIKGGVWKNTEDEILKAAIMKYGKNQWSRIASLLHRKSAKQCKARWFEWLDPGIKK 180
            MVRVIIKGGVWKNTEDEILKAAIMKYGKNQWSRIASLLHRKSAKQCKARWFEWLDPGIKK
Sbjct: 1    MVRVIIKGGVWKNTEDEILKAAIMKYGKNQWSRIASLLHRKSAKQCKARWFEWLDPGIKK 60

Query: 181  TEWSREEDEKLLHLAKLMPTQWRTIAPIVGRTSAQCLERYEHLLDEAQRKAEGLDEEATE 360
            TEWSREEDEKLLHLAKLMPTQWRTIAPIVGRTSAQCLERYEHLLDEAQRKAEGLDEEATE
Sbjct: 61   TEWSREEDEKLLHLAKLMPTQWRTIAPIVGRTSAQCLERYEHLLDEAQRKAEGLDEEATE 120

Query: 361  TRKLKPGEIDPTPETKPARXXXXXXXXXXXXXXSEARARLANTQGKKAKRKARERQLSDA 540
            TRKLKPGEIDPTPETKPAR              SEARARLANTQGKKAKRKARERQLSDA
Sbjct: 121  TRKLKPGEIDPTPETKPARPDPIDMDDDELEMLSEARARLANTQGKKAKRKARERQLSDA 180

Query: 541  RRLASLQKRREMRAAGLAFARKFKPKRNQIDYSEEIPFEKHVPAGFHNPSEDRYVVEDAN 720
            RRLASLQKRREMRAAGLAFARKFKPKRNQIDYSEEIPFEKHVPAGFHNPSEDRYVVEDAN
Sbjct: 181  RRLASLQKRREMRAAGLAFARKFKPKRNQIDYSEEIPFEKHVPAGFHNPSEDRYVVEDAN 240

Query: 721  QKAIEDHQKPXXXXXXXXXXXXXXXXXXXXXXQGEADAVFNIKEKKRSKLVLPEPQISDR 900
            QKAIEDHQKP                      QGEADAVFNIKEKKRSKLVLPEPQISDR
Sbjct: 241  QKAIEDHQKPRGREIEMEMRREDREKLKKRKEQGEADAVFNIKEKKRSKLVLPEPQISDR 300

Query: 901  ELEQIVKIGHASDSVRQYIDGTATSGLLTDYTESARANAVAARTMRTPMLKDTVQLELEN 1080
            ELEQIVKIGHASDSVRQYIDGTATSGLLTDYTESARANAVAARTMRTPMLKDTVQLELEN
Sbjct: 301  ELEQIVKIGHASDSVRQYIDGTATSGLLTDYTESARANAVAARTMRTPMLKDTVQLELEN 360

Query: 1081 LMALQNTESALKGGLNTPLHESELGKGVLPTPKVAATPNTVLHAIAATPGTQSQFPGSTP 1260
            LMALQNTESALKGGLNTPLHESELGKGVLPTPKVAATPNTVLHAIAATPGTQSQFPGSTP
Sbjct: 361  LMALQNTESALKGGLNTPLHESELGKGVLPTPKVAATPNTVLHAIAATPGTQSQFPGSTP 420

Query: 1261 GGFATPAGSVAATPFRDQMRINEEIAGSALEQKASLKRALASLPTPKNXXXXXXXXXXXX 1440
            GGFATPAGSVAATPFRDQMRINEEIAGSALEQKASLKRALASLPTPKN
Sbjct: 421  GGFATPAGSVAATPFRDQMRINEEIAGSALEQKASLKRALASLPTPKNDFEVVGPDDDEV 480

Query: 1441 XXXXXXXSNQDEDGWIEDASERAENKAKRNAENRVRNMKMRSQVIQRSLPKPTKVNEQAT 1620
                   SNQDEDGWIEDASERAENKAKRNAENRVRNMKMRSQVIQRSLPKPTKVNEQAT
Sbjct: 481  EGAVEDESNQDEDGWIEDASERAENKAKRNAENRVRNMKMRSQVIQRSLPKPTKVNEQAT 540

Query: 1621 RATNSSADDMVKA 1659
            RATNSSADDMVKA
Sbjct: 541  RATNSSADDMVKA 553


>gi|39595616|emb|CAE67118.1| Hypothetical protein CBG12532
            [Caenorhabditis briggsae]
          Length = 759

 Score =  878 bits (2268), Expect = 0.0
 Identities = 457/558 (81%), Positives = 478/558 (84%), Gaps = 6/558 (1%)
 Frame = +1

Query: 1    MVRVIIKGGVWKNTEDEILKAAIMKYGKNQWSRIASLLHRKSAKQCKARWFEWLDPGIKK 180
            MVRVIIKGGVWKNTEDEILKAAIMKYGKNQWSRIASLLHRKSAKQCKARWFEWLDPGIKK
Sbjct: 1    MVRVIIKGGVWKNTEDEILKAAIMKYGKNQWSRIASLLHRKSAKQCKARWFEWLDPGIKK 60

Query: 181  TEWSREEDEKLLHLAKLMPTQWRTIAPIVGRTSAQCLERYEHLLDEAQRKAEGLDEEATE 360
            TEWSREEDEKLLHLAKLMPTQWRTIAPIVGRTSAQCLERYEHLLDEAQRKAEGLDEEATE
Sbjct: 61   TEWSREEDEKLLHLAKLMPTQWRTIAPIVGRTSAQCLERYEHLLDEAQRKAEGLDEEATE 120

Query: 361  TRKLKPGEIDPTPETKPARXXXXXXXXXXXXXXSEARARLANTQGKKAKRKARERQLSDA 540
             RKLKPGEIDPTPETKPAR              SEARARLANTQGKKAKRKARERQLSDA
Sbjct: 121  ARKLKPGEIDPTPETKPARPDPIDMDDDELEMLSEARARLANTQGKKAKRKARERQLSDA 180

Query: 541  RRLASLQKRREMRAAGLAFARKFKPKRNQIDYSEEIPFEKHVPAGFHNPSEDRYVVEDAN 720
            RRLASLQKRREMRAAGLAFARKFKPKRNQIDYSEEIPFEKHVPAGFH+PSED+YVVEDAN
Sbjct: 181  RRLASLQKRREMRAAGLAFARKFKPKRNQIDYSEEIPFEKHVPAGFHDPSEDKYVVEDAN 240

Query: 721  QKAIEDHQKPXXXXXXXXXXXXXXXXXXXXXXQGEADAVFNIKEKKRSKLVLPEPQISDR 900
            Q+AI+DHQKP                      QGEADAVFNIKEKKRSKLVLPEPQISDR
Sbjct: 241  QRAIDDHQKPRGREIEMEMRREDREKLKKRKEQGEADAVFNIKEKKRSKLVLPEPQISDR 300

Query: 901  ELEQIVKIGHASDSVRQYIDGTATSGLLTDYTESARANAVAARTMRTPMLKDTVQLELEN 1080
            ELEQIVKIGHASDSVRQYID TATSGLLTDYTESARANAVAARTMRTPM KDT+Q+E+EN
Sbjct: 301  ELEQIVKIGHASDSVRQYIDDTATSGLLTDYTESARANAVAARTMRTPMPKDTIQMEIEN 360

Query: 1081 LMALQNTESALKGGLNTPLHESELGKGVLPTPKVAATPNTVLHAIAATPGTQSQFPGSTP 1260
            ++ALQNTES LKGG+NTPLHESELGKGVLPTPK+ ATPNTVLHAIAATPGTQSQ  G TP
Sbjct: 361  IIALQNTESVLKGGINTPLHESELGKGVLPTPKIVATPNTVLHAIAATPGTQSQI-GGTP 419

Query: 1261 GGFATPAGSVAATPFRDQMRINEEIAGSALEQKASLKRALASLPTPKNXXXXXXXXXXXX 1440
             GFATPAGSVAATPFRDQMRINEEI GSALEQKA+LKRALASLPTPKN
Sbjct: 420  -GFATPAGSVAATPFRDQMRINEEIGGSALEQKANLKRALASLPTPKNDFEIVGPDDDEV 478

Query: 1441 XXXXXXXSNQ-DEDGWIEDASERAENKAKRNAENRVRNMKMRSQVIQRSLPKPTKVNEQA 1617
                    N+ DE+GWIEDASERAE  AKRNA  R+RN+KMRSQV+QR LPKP+KVNE A
Sbjct: 479  EGTVGDDDNEKDEEGWIEDASERAEKHAKRNAAIRIRNLKMRSQVVQRDLPKPSKVNELA 538

Query: 1618 TRATNSS-----ADDMVK 1656
             R TN+S     ADD++K
Sbjct: 539  MRPTNASGDLPKADDLIK 556




[DB home][top]