Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= D1046_3
(810 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539504|ref|NP_501552.1| agpet8 (29.0 kD) (4J697) [Caenorhab... 535 e-151
gi|39586413|emb|CAE74071.1| Hypothetical protein CBG21724 [Caeno... 489 e-137
gi|31208625|ref|XP_313279.1| ENSANGP00000011068 [Anopheles gambi... 230 3e-59
gi|27754081|ref|NP_080531.2| solute carrier family 25 (mitochond... 229 5e-59
gi|19115553|ref|NP_594641.1| agpet8 protein. [Schizosaccharomyce... 228 9e-59
gi|49250406|gb|AAH74600.1| Unknown (protein for MGC:69323) [Xeno... 228 2e-58
gi|41351486|emb|CAE45652.1| S-adenosylmethionine carrier protein... 224 2e-57
gi|50754517|ref|XP_414419.1| PREDICTED: similar to S-adenosylmet... 218 9e-56
gi|38102571|gb|EAA49393.1| hypothetical protein MG01051.4 [Magna... 214 2e-54
gi|6324325|ref|NP_014395.1| S-adenosylmethionine transporter of ... 213 5e-54
gi|50289063|ref|XP_446961.1| unnamed protein product [Candida gl... 212 7e-54
gi|24650120|ref|NP_651415.1| CG4743-PA [Drosophila melanogaster]... 211 1e-53
gi|50549063|ref|XP_502002.1| hypothetical protein [Yarrowia lipo... 209 4e-53
gi|45184810|ref|NP_982528.1| AAL014Cp [Eremothecium gossypii] >g... 209 6e-53
gi|46117020|ref|XP_384528.1| hypothetical protein FG04352.1 [Gib... 208 1e-52
gi|50306613|ref|XP_453280.1| unnamed protein product [Kluyveromy... 206 6e-52
gi|50426841|ref|XP_462018.1| unnamed protein product [Debaryomyc... 205 8e-52
gi|32415055|ref|XP_328007.1| hypothetical protein ( (AL355930) r... 205 1e-51
gi|46442238|gb|EAL01529.1| hypothetical protein CaO19.7082 [Cand... 203 3e-51
gi|49075766|ref|XP_401926.1| hypothetical protein UM04311.1 [Ust... 203 3e-51
gi|50256826|gb|EAL19544.1| hypothetical protein CNBG1730 [Crypto... 201 2e-50
gi|34857703|ref|XP_342727.1| similar to RIKEN cDNA 4930433D19 [R... 200 3e-50
gi|49084042|ref|XP_404252.1| hypothetical protein AN0115.2 [Aspe... 184 2e-45
gi|34328629|gb|AAN75316.1| HsPet8 [Eremothecium sinecaudum] 157 2e-37
gi|40385865|ref|NP_775742.2| solute carrier family 25, member 26... 157 2e-37
gi|47777469|gb|AAT38102.1| putative mitochondrial carrier protei... 149 5e-35
gi|18420458|ref|NP_568060.1| mitochondrial substrate carrier fam... 148 1e-34
gi|34394981|dbj|BAC84529.1| mitochondrial aspartate-glutamate ca... 145 8e-34
gi|18399114|ref|NP_564436.1| mitochondrial substrate carrier fam... 143 4e-33
gi|15238301|ref|NP_199028.1| mitochondrial substrate carrier fam... 137 4e-31
gi|46122469|ref|XP_385788.1| hypothetical protein FG05612.1 [Gib... 132 1e-29
gi|50251364|dbj|BAD28391.1| mitochondrial substrate carrier prot... 130 4e-29
gi|34905862|ref|NP_914278.1| P0458E05.7 [Oryza sativa (japonica ... 127 4e-28
gi|32421511|ref|XP_331199.1| hypothetical protein [Neurospora cr... 126 5e-28
gi|27803005|emb|CAD60708.1| unnamed protein product [Podospora a... 125 8e-28
gi|23509092|ref|NP_701760.1| mitochondrial carrier protein, puta... 124 2e-27
gi|19111931|ref|NP_595139.1| mitochondrial carrier protein; puta... 124 2e-27
gi|7486053|pir||T09362 hypothetical protein F23K16.90 - Arabidop... 121 2e-26
gi|49068770|ref|XP_398674.1| hypothetical protein UM01059.1 [Ust... 121 2e-26
gi|31215685|ref|XP_316075.1| ENSANGP00000022876 [Anopheles gambi... 120 3e-26
gi|50293227|ref|XP_449025.1| unnamed protein product [Candida gl... 120 5e-26
gi|38105554|gb|EAA51969.1| hypothetical protein MG03564.4 [Magna... 117 3e-25
gi|32416310|ref|XP_328633.1| hypothetical protein [Neurospora cr... 115 8e-25
gi|28828299|gb|AAO50963.1| similar to Mus musculus (Mouse). Calc... 115 8e-25
gi|6322905|ref|NP_012978.1| Mitochondrial iron transporter of th... 114 2e-24
gi|49092732|ref|XP_407827.1| hypothetical protein AN3690.2 [Aspe... 113 4e-24
gi|50759536|ref|XP_417682.1| PREDICTED: similar to mitochondrial... 113 6e-24
gi|50547439|ref|XP_501189.1| hypothetical protein [Yarrowia lipo... 111 2e-23
gi|32398816|emb|CAD98526.1| mitochondrial carrier protein, possi... 111 2e-23
gi|45198325|ref|NP_985354.1| AFL196Wp [Eremothecium gossypii] >g... 111 2e-23
gi|25406950|pir||A86205 hypothetical protein [imported] - Arabid... 111 2e-23
gi|21357737|ref|NP_651600.1| CG4963-PA [Drosophila melanogaster]... 110 3e-23
gi|15222270|ref|NP_172184.1| mitochondrial substrate carrier fam... 110 4e-23
gi|39582673|emb|CAE73777.1| Hypothetical protein CBG21322 [Caeno... 110 4e-23
gi|17158033|ref|NP_080607.2| mitochondrial solute carrier protei... 110 4e-23
gi|6323818|ref|NP_013889.1| Hypothetical ORF; Ymr166cp [Saccharo... 110 5e-23
gi|50292295|ref|XP_448580.1| unnamed protein product [Candida gl... 110 5e-23
gi|15227718|ref|NP_180577.1| mitochondrial substrate carrier fam... 110 5e-23
gi|21553549|gb|AAM62642.1| putative mitochondrial carrier protei... 109 6e-23
gi|3994|emb|CAA39830.1| MRS3 protein [Saccharomyces cerevisiae] 108 1e-22
gi|6322328|ref|NP_012402.1| Mitochondrial iron transporter of th... 108 1e-22
gi|50287747|ref|XP_446303.1| unnamed protein product [Candida gl... 108 2e-22
gi|19075818|ref|NP_588318.1| putative mitochondrial carrier prot... 106 5e-22
gi|38106116|gb|EAA52466.1| hypothetical protein MG05158.4 [Magna... 106 7e-22
gi|50307047|ref|XP_453501.1| unnamed protein product [Kluyveromy... 106 7e-22
gi|22034628|gb|AAL13117.1| putative inner membrane solute transp... 106 7e-22
gi|45185946|ref|NP_983662.1| ACR260Wp [Eremothecium gossypii] >g... 105 9e-22
gi|21309945|gb|AAM46110.1| MRS3/4 [Mus musculus] 105 2e-21
gi|30686563|ref|NP_850252.1| mitochondrial substrate carrier fam... 105 2e-21
gi|21553115|ref|NP_660138.1| solute carrier family 25, member 28... 105 2e-21
gi|17554998|ref|NP_498094.1| solute carrier family 25 member 15 ... 104 2e-21
gi|3991|emb|CAA29582.1| unnamed protein product [Saccharomyces c... 104 3e-21
gi|26449572|dbj|BAC41912.1| putative mitochondrial carrier prote... 103 4e-21
gi|28527696|ref|XP_207112.2| similar to Mitochondrial glutamate ... 103 6e-21
gi|3378495|emb|CAA07568.1| Mitochondrial carrier protein [Ribes ... 103 6e-21
gi|28703800|gb|AAH47312.1| SLC25A28 protein [Homo sapiens] 101 2e-20
gi|12666720|emb|CAC27996.1| mitochondrial RNA splicing protein 3... 101 2e-20
gi|47223331|emb|CAF98715.1| unnamed protein product [Tetraodon n... 100 4e-20
gi|46434016|gb|EAK93438.1| hypothetical protein CaO19.4159 [Cand... 100 4e-20
gi|8132784|gb|AAF73387.1| unknown [Drosophila melanogaster] 100 4e-20
gi|25408417|pir||B84773 probable mitochondrial carrier protein [... 100 5e-20
gi|50427783|ref|XP_462504.1| unnamed protein product [Debaryomyc... 100 5e-20
gi|50291791|ref|XP_448328.1| unnamed protein product [Candida gl... 100 6e-20
gi|48096652|ref|XP_392496.1| similar to ENSANGP00000018542 [Apis... 100 6e-20
gi|7706150|ref|NP_057696.1| mitochondrial solute carrier protein... 99 8e-20
gi|20140239|sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier... 99 1e-19
gi|34874384|ref|XP_224361.2| similar to mitochondrial solute car... 99 1e-19
gi|50310411|ref|XP_455225.1| unnamed protein product [Kluyveromy... 98 2e-19
gi|6322555|ref|NP_012629.1| Mitochondrial succinate-fumarate tra... 98 2e-19
gi|396595|emb|CAA80973.1| ACR1-protein [Saccharomyces cerevisiae] 98 2e-19
gi|50556378|ref|XP_505597.1| hypothetical protein [Yarrowia lipo... 97 4e-19
gi|25406327|pir||G96770 hypothetical protein F1O17.9 [imported] ... 97 4e-19
gi|19115195|ref|NP_594283.1| mitochondial carrier protein; putat... 96 7e-19
gi|30699000|ref|NP_177564.2| mitochondrial substrate carrier fam... 96 9e-19
gi|50419171|ref|XP_458108.1| unnamed protein product [Debaryomyc... 96 1e-18
gi|13899342|ref|NP_113669.1| solute carrier; mitochondrial gluta... 95 2e-18
gi|21326111|gb|AAM47577.1| putative mitochondrial carrier protei... 95 2e-18
gi|48105455|ref|XP_393015.1| similar to hypothetical protein CaO... 95 2e-18
gi|30690327|ref|NP_850452.1| mitochondrial substrate carrier fam... 95 2e-18
gi|15225292|ref|NP_180204.1| mitochondrial substrate carrier fam... 95 2e-18
gi|30690323|ref|NP_850451.1| mitochondrial substrate carrier fam... 94 3e-18
gi|48476342|ref|NP_077008.2| solute carrier family 25 (mitochond... 94 3e-18
gi|16549529|dbj|BAB70825.1| unnamed protein product [Homo sapiens] 94 3e-18
gi|31200401|ref|XP_309148.1| ENSANGP00000018542 [Anopheles gambi... 94 5e-18
gi|50309281|ref|XP_454647.1| unnamed protein product [Kluyveromy... 94 5e-18
gi|6325278|ref|NP_015346.1| Mitochondrial transporter, acts both... 93 6e-18
gi|13124050|sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial c... 93 6e-18
gi|46437608|gb|EAK96951.1| hypothetical protein CaO19.9724 [Cand... 93 6e-18
gi|19310377|gb|AAL84928.1| At2g46320/F11C10.1 [Arabidopsis thali... 93 6e-18
gi|12849571|dbj|BAB28397.1| unnamed protein product [Mus musculu... 93 8e-18
gi|7657583|ref|NP_056644.1| solute carrier family 25 (mitochondr... 93 8e-18
gi|21361103|ref|NP_003696.2| solute carrier family 25 (mitochond... 93 8e-18
gi|34863024|ref|XP_215249.2| similar to putative mitochondrial s... 93 8e-18
gi|16741519|gb|AAH16571.1| Slc25a13 protein [Mus musculus] 93 8e-18
gi|45187824|ref|NP_984047.1| ADL049Wp [Eremothecium gossypii] >g... 93 8e-18
gi|50732673|ref|XP_425987.1| PREDICTED: similar to Calcium-bindi... 92 1e-17
gi|46125507|ref|XP_387307.1| hypothetical protein FG07131.1 [Gib... 92 1e-17
gi|47086479|ref|NP_997947.1| solute carrier family 25 (mitochond... 92 1e-17
gi|47085863|ref|NP_998284.1| zgc:64212 [Danio rerio] >gnl|BL_ORD... 92 1e-17
gi|25152781|ref|NP_510638.2| solute carrier family 25 member 21 ... 92 1e-17
gi|27369581|ref|NP_766024.1| solute carrier family 25 (mitochond... 92 1e-17
gi|38194914|gb|AAR13302.1| mitochondrial carrier protein [Phaseo... 92 2e-17
gi|49274632|ref|NP_080153.2| RIKEN cDNA 2310067G05 [Mus musculus... 92 2e-17
gi|32412508|ref|XP_326734.1| hypothetical protein ( (AL513442) p... 92 2e-17
gi|12833101|dbj|BAB22390.1| unnamed protein product [Mus musculus] 92 2e-17
gi|50309099|ref|XP_454555.1| unnamed protein product [Kluyveromy... 92 2e-17
gi|37748220|gb|AAH59349.1| MGC69168 protein [Xenopus laevis] 91 2e-17
gi|50539780|ref|NP_001002360.1| zgc:92520 [Danio rerio] >gnl|BL_... 91 2e-17
gi|50259074|gb|EAL21751.1| hypothetical protein CNBC4530 [Crypto... 91 2e-17
gi|49118246|gb|AAH73249.1| Unknown (protein for MGC:80594) [Xeno... 91 3e-17
gi|1518458|gb|AAB19037.1| mitochondrial solute carrier 91 3e-17
gi|39593620|emb|CAE61912.1| Hypothetical protein CBG05908 [Caeno... 91 3e-17
gi|12061241|gb|AAG45489.1| 36I5.1 [Oryza sativa (japonica cultiv... 91 4e-17
gi|50427569|ref|XP_462397.1| unnamed protein product [Debaryomyc... 91 4e-17
gi|7657581|ref|NP_055066.1| solute carrier family 25, member 13 ... 91 4e-17
gi|22002963|emb|CAD43091.1| mitochondrial aspartate-glutamate ca... 91 4e-17
gi|12278522|gb|AAG48999.1| putative mitochondrial carrier protei... 90 5e-17
gi|6523256|emb|CAB62206.1| aralar2 [Homo sapiens] 90 7e-17
gi|24651387|ref|NP_733364.1| CG2139-PC [Drosophila melanogaster]... 90 7e-17
gi|18496651|gb|AAL74183.1| putative mitochondrial carrier protei... 90 7e-17
gi|45200786|ref|NP_986356.1| AGL311Cp [Eremothecium gossypii] >g... 90 7e-17
gi|24651389|ref|NP_651795.2| CG2139-PA [Drosophila melanogaster]... 90 7e-17
gi|6523177|emb|CAB62169.1| ARALAR 1 protein [Drosophila melanoga... 90 7e-17
gi|45552009|ref|NP_733366.2| CG2139-PB [Drosophila melanogaster]... 90 7e-17
gi|38111079|gb|EAA56711.1| hypothetical protein MG07066.4 [Magna... 89 9e-17
gi|47215306|emb|CAG01611.1| unnamed protein product [Tetraodon n... 89 1e-16
gi|46443782|gb|EAL03061.1| hypothetical protein CaO19.3931 [Cand... 89 1e-16
gi|17536687|ref|NP_496447.1| mitochondrial solute carrier (34.1 ... 89 1e-16
gi|39593597|emb|CAE61889.1| Hypothetical protein CBG05880 [Caeno... 89 1e-16
gi|17539560|ref|NP_501223.1| mitochondrial carrier protein famil... 89 1e-16
gi|19113980|ref|NP_593068.1| putative mitochondrial carrier [Sch... 89 1e-16
gi|46123689|ref|XP_386398.1| hypothetical protein FG06222.1 [Gib... 88 2e-16
gi|10503963|gb|AAG17977.1| unknown [Homo sapiens] >gnl|BL_ORD_ID... 88 2e-16
gi|21358315|ref|NP_649731.1| CG2616-PA [Drosophila melanogaster]... 88 2e-16
gi|23574792|dbj|BAC20608.1| solute carrier family 25 member 13 [... 88 2e-16
gi|7657585|ref|NP_055067.1| solute carrier family 25 (mitochondr... 88 2e-16
gi|48734648|gb|AAH72270.1| Unknown (protein for IMAGE:4408521) [... 87 3e-16
gi|45198649|ref|NP_985678.1| AFR131Cp [Eremothecium gossypii] >g... 87 3e-16
gi|27673563|ref|XP_224969.1| similar to ornithine transporter [R... 87 4e-16
gi|32417012|ref|XP_328984.1| hypothetical protein [Neurospora cr... 86 7e-16
gi|50258204|gb|EAL20898.1| hypothetical protein CNBE2590 [Crypto... 86 7e-16
gi|15231083|ref|NP_188659.1| mitochondrial substrate carrier fam... 86 7e-16
gi|50730921|ref|XP_417080.1| PREDICTED: similar to Mitochondrial... 86 7e-16
gi|21537282|gb|AAM61623.1| mitochondrial carrier protein, putati... 86 7e-16
gi|6754952|ref|NP_035147.1| solute carrier family 25 (mitochondr... 86 9e-16
gi|50422175|ref|XP_459650.1| unnamed protein product [Debaryomyc... 86 9e-16
gi|28830044|gb|AAO52534.1| similar to Plasmodium falciparum (iso... 86 9e-16
gi|50256740|gb|EAL19460.1| hypothetical protein CNBG4070 [Crypto... 86 1e-15
gi|49899706|gb|AAH76734.1| Unknown (protein for MGC:81365) [Xeno... 86 1e-15
gi|46094065|ref|NP_061331.2| mitochondrial carrier family protei... 86 1e-15
gi|19114979|ref|NP_594067.1| putative mitochondrial carrier prot... 86 1e-15
gi|39596351|emb|CAE69989.1| Hypothetical protein CBG16392 [Caeno... 85 2e-15
gi|26337655|dbj|BAC32513.1| unnamed protein product [Mus musculu... 85 2e-15
gi|30520231|ref|NP_848881.1| mitochondrial carrier family protei... 85 2e-15
gi|31216089|ref|XP_316164.1| ENSANGP00000020391 [Anopheles gambi... 85 2e-15
gi|25408981|pir||D84901 hypothetical protein At2g46320 [imported... 85 2e-15
gi|18417093|ref|NP_567790.1| mitochondrial substrate carrier fam... 84 3e-15
gi|38106744|gb|EAA53013.1| hypothetical protein MG06141.4 [Magna... 84 3e-15
gi|50294652|ref|XP_449737.1| unnamed protein product [Candida gl... 84 4e-15
gi|49129632|ref|XP_412922.1| hypothetical protein AN8785.2 [Aspe... 84 4e-15
gi|50419543|ref|XP_458298.1| unnamed protein product [Debaryomyc... 84 4e-15
gi|7511491|pir||T29640 mitochondrial carrier protein DIF-1 homol... 84 4e-15
gi|50553226|ref|XP_504023.1| hypothetical protein [Yarrowia lipo... 84 5e-15
gi|17540658|ref|NP_501198.1| solute carrier (4I239) [Caenorhabdi... 84 5e-15
gi|40253478|dbj|BAD05428.1| putative mitochondrial carrier prote... 84 5e-15
gi|46444126|gb|EAL03403.1| hypothetical protein CaO19.4966 [Cand... 83 6e-15
gi|39597270|emb|CAE59498.1| Hypothetical protein CBG02884 [Caeno... 83 6e-15
gi|46431307|gb|EAK90893.1| hypothetical protein CaO19.3518 [Cand... 83 6e-15
gi|50750910|ref|XP_422180.1| PREDICTED: similar to Solute carrie... 83 6e-15
gi|49079674|ref|XP_403456.1| hypothetical protein UM05841.1 [Ust... 83 8e-15
gi|18417739|ref|NP_568317.1| mitochondrial substrate carrier fam... 83 8e-15
gi|21553961|gb|AAM63042.1| putative mitochondrial carrier protei... 83 8e-15
gi|32564671|ref|NP_497836.2| mitochondrial substrate carrier (40... 82 1e-14
gi|24638958|ref|NP_569856.2| CG5254-PA [Drosophila melanogaster]... 82 1e-14
gi|7496088|pir||T19322 hypothetical protein C16C10.1 - Caenorhab... 82 1e-14
gi|6563262|gb|AAF17225.1| mitochondrial carrier family protein [... 82 1e-14
gi|41053634|ref|NP_956780.1| hypothetical protein MGC63736 [Dani... 82 1e-14
gi|29367537|gb|AAO72624.1| putative mitochondrial carrier protei... 82 1e-14
gi|47222529|emb|CAG02894.1| unnamed protein product [Tetraodon n... 82 1e-14
gi|45361479|ref|NP_989316.1| hypothetical protein MGC76123 [Xeno... 82 1e-14
gi|50554747|ref|XP_504782.1| hypothetical protein [Yarrowia lipo... 82 1e-14
gi|34894824|ref|NP_908737.1| P0554D10.15 [Oryza sativa (japonica... 82 2e-14
gi|39597158|emb|CAE59385.1| Hypothetical protein CBG02742 [Caeno... 82 2e-14
gi|46124377|ref|XP_386742.1| conserved hypothetical protein [Gib... 82 2e-14
gi|6324796|ref|NP_014865.1| Mitochondrial inner membrane transpo... 82 2e-14
gi|37537070|ref|NP_922837.1| putative carnitine/acylcarnitine tr... 82 2e-14
gi|47216667|emb|CAG04865.1| unnamed protein product [Tetraodon n... 82 2e-14
gi|27694792|gb|AAH43834.1| Mcsc-pending-prov protein [Xenopus la... 82 2e-14
gi|1518456|gb|AAB19036.1| mitochondrial solute carrier 81 2e-14
gi|50748440|ref|XP_421247.1| PREDICTED: similar to solute carrie... 81 2e-14
gi|13994341|ref|NP_114153.1| solute carrier family 25 member 2; ... 81 2e-14
gi|18395659|ref|NP_564233.1| mitochondrial substrate carrier fam... 81 2e-14
gi|46125927|ref|XP_387517.1| hypothetical protein FG07341.1 [Gib... 81 2e-14
gi|46437495|gb|EAK96840.1| hypothetical protein CaO19.417 [Candi... 81 2e-14
gi|31242839|ref|XP_321850.1| ENSANGP00000020264 [Anopheles gambi... 81 2e-14
gi|49522572|gb|AAH75377.1| Unknown (protein for MGC:89095) [Xeno... 81 3e-14
gi|34854043|ref|XP_216078.2| similar to mitochondrial carrier fa... 81 3e-14
gi|19115123|ref|NP_594211.1| mitochondrial carrier protein; yeas... 81 3e-14
gi|26331858|dbj|BAC29659.1| unnamed protein product [Mus musculu... 81 3e-14
gi|27682801|ref|XP_226032.1| similar to mutant ornithine transpo... 81 3e-14
gi|49077502|ref|XP_402603.1| hypothetical protein UM04988.1 [Ust... 81 3e-14
gi|19920986|ref|NP_609270.1| CG9582-PA [Drosophila melanogaster]... 81 3e-14
gi|42408519|dbj|BAD09698.1| putative mitochondrial energy transf... 80 4e-14
gi|47225418|emb|CAG11901.1| unnamed protein product [Tetraodon n... 80 4e-14
gi|34895726|ref|NP_909212.1| putative peroxisomal Ca-dependent s... 80 4e-14
gi|15228163|ref|NP_191123.1| mitochondrial substrate carrier fam... 80 4e-14
gi|27371299|gb|AAH41303.1| Slc25a1-prov protein [Xenopus laevis] 80 4e-14
gi|27369824|ref|NP_766165.1| solute carrier family 25 (mitochond... 80 4e-14
gi|17554004|ref|NP_497274.1| solute carrier family 25 member 13 ... 80 4e-14
gi|13449279|ref|NP_085134.1| solute carrier family 25 (mitochond... 80 4e-14
gi|49115574|gb|AAH73476.1| Unknown (protein for MGC:80993) [Xeno... 80 5e-14
gi|39592080|emb|CAE75300.1| Hypothetical protein CBG23270 [Caeno... 80 5e-14
gi|34873898|ref|XP_340915.1| similar to RIKEN cDNA 3010027G13 [R... 80 5e-14
gi|45361631|ref|NP_989391.1| hypothetical protein MGC76218 [Xeno... 80 5e-14
gi|50259089|gb|EAL21766.1| hypothetical protein CNBC4680 [Crypto... 80 5e-14
gi|50811138|ref|XP_424684.1| PREDICTED: similar to mitochondrial... 80 5e-14
gi|17137310|ref|NP_477221.1| CG3057-PA [Drosophila melanogaster]... 80 7e-14
gi|46390391|dbj|BAD15855.1| putative Mcsc-pending-prov protein [... 80 7e-14
gi|17536171|ref|NP_496236.1| mitochondrial carrier protein c2 (4... 80 7e-14
gi|47226681|emb|CAG07840.1| unnamed protein product [Tetraodon n... 80 7e-14
gi|46115020|ref|XP_383528.1| hypothetical protein FG03352.1 [Gib... 80 7e-14
gi|37537072|ref|NP_922838.1| putative carnitine/acylcarnitine tr... 79 9e-14
gi|47458041|ref|NP_998816.1| solute carrier family 25 member 24 ... 79 9e-14
gi|46249805|gb|AAH68561.1| Solute carrier family 25 member 24, i... 79 9e-14
gi|21594326|gb|AAM65995.1| mitochondrial carrier-like protein [A... 79 9e-14
gi|45710075|gb|AAH14519.1| Solute carrier family 25 member 24, i... 79 9e-14
gi|38083666|ref|XP_111757.2| mutant ornithine transporter 2 [Mus... 79 9e-14
gi|33598954|ref|NP_037518.2| solute carrier family 25 member 24 ... 79 9e-14
gi|38106979|gb|EAA53212.1| hypothetical protein MG07489.4 [Magna... 79 9e-14
gi|11360341|pir||T50686 peroxisomal Ca-dependent solute carrier ... 79 9e-14
gi|50749663|ref|XP_421702.1| PREDICTED: similar to Solute carrie... 79 9e-14
gi|17561410|ref|NP_505970.1| solute carrier (5M253) [Caenorhabdi... 79 9e-14
gi|31202109|ref|XP_310002.1| ENSANGP00000015067 [Anopheles gambi... 79 9e-14
gi|38372886|sp|Q9BXI2|ORT2_HUMAN Mitochondrial ornithine transpo... 79 1e-13
gi|45201479|ref|NP_987049.1| AGR383Wp [Eremothecium gossypii] >g... 79 1e-13
gi|4325249|gb|AAD17310.1| solute carrier protein [Gracilaria gra... 79 1e-13
gi|46136699|ref|XP_390041.1| conserved hypothetical protein [Gib... 79 1e-13
gi|9758516|dbj|BAB08924.1| carnitine/acylcarnitine translocase-l... 79 1e-13
gi|50549725|ref|XP_502333.1| hypothetical protein [Yarrowia lipo... 79 1e-13
gi|22331775|ref|NP_190962.2| mitochondrial substrate carrier fam... 79 1e-13
gi|15341990|gb|AAH13194.1| Hypothetical protein FLJ20551 [Homo s... 79 1e-13
gi|50414715|gb|AAH77266.1| Unknown (protein for MGC:80014) [Xeno... 79 2e-13
gi|22266728|gb|AAM94902.1| ornithine transporter 2 [Homo sapiens] 79 2e-13
gi|7688677|gb|AAF67479.1| mitochondrial solute carrier [Homo sap... 79 2e-13
gi|47228502|emb|CAG05322.1| unnamed protein product [Tetraodon n... 79 2e-13
gi|21554682|gb|AAM63657.1| Ca-dependent solute carrier-like prot... 79 2e-13
gi|49075982|ref|XP_402014.1| hypothetical protein UM04399.1 [Ust... 79 2e-13
gi|27369998|ref|NP_766273.1| calcium-binding transporter; solute... 79 2e-13
gi|33286910|gb|AAH55369.1| Calcium-binding transporter [Mus musc... 79 2e-13
gi|13386046|ref|NP_080818.1| similar to human CGI-69 protein [Mu... 79 2e-13
gi|19424330|ref|NP_598298.1| solute carrier family 25 (mitochond... 79 2e-13
gi|19115332|ref|NP_594420.1| putative tricarboxylate transport p... 79 2e-13
gi|41053632|ref|NP_957153.1| hypothetical protein MGC77760 [Dani... 79 2e-13
gi|47218080|emb|CAG09952.1| unnamed protein product [Tetraodon n... 79 2e-13
gi|19114749|ref|NP_593837.1| mitochondrial carrier protein [Schi... 78 2e-13
gi|15239622|ref|NP_197992.1| mitochondrial substrate carrier fam... 78 2e-13
gi|11277067|pir||T45934 hypothetical protein F5K20.240 - Arabido... 78 2e-13
gi|47223864|emb|CAG06041.1| unnamed protein product [Tetraodon n... 78 2e-13
gi|7486721|pir||T01839 hypothetical protein F9D12.12 - Arabidops... 78 2e-13
gi|47086085|ref|NP_998422.1| zgc:77454 [Danio rerio] >gnl|BL_ORD... 78 2e-13
gi|47214965|emb|CAG10787.1| unnamed protein product [Tetraodon n... 78 2e-13
gi|8394297|ref|NP_059003.1| solute carrier family 25, member 1 p... 78 3e-13
gi|50554631|ref|XP_504724.1| hypothetical protein [Yarrowia lipo... 77 3e-13
gi|38107122|gb|EAA53339.1| hypothetical protein MG07616.4 [Magna... 77 3e-13
gi|12854235|dbj|BAB29969.1| unnamed protein product [Mus musculu... 77 3e-13
gi|32407871|ref|XP_324432.1| hypothetical protein [Neurospora cr... 77 3e-13
gi|39979123|emb|CAE85498.1| probable succinate-fumarate transpor... 77 4e-13
gi|47227640|emb|CAG09637.1| unnamed protein product [Tetraodon n... 77 4e-13
gi|21357261|ref|NP_648501.1| CG7314-PB [Drosophila melanogaster]... 77 4e-13
gi|11067279|gb|AAG28807.1| unknown protein [Arabidopsis thaliana] 77 4e-13
gi|18422718|ref|NP_568670.1| mitochondrial carnitine/acyl carrie... 77 4e-13
gi|32418256|ref|XP_329606.1| hypothetical protein [Neurospora cr... 77 4e-13
gi|32566691|ref|NP_872134.1| mitochondrial substrate carrier (39... 77 6e-13
gi|39581897|emb|CAE72859.1| Hypothetical protein CBG20158 [Caeno... 77 6e-13
gi|15233381|ref|NP_192883.1| mitochondrial substrate carrier fam... 77 6e-13
gi|49100028|ref|XP_410827.1| hypothetical protein AN6690.2 [Aspe... 77 6e-13
gi|21728406|ref|NP_663710.1| mitochondrial Ca2+-dependent solute... 77 6e-13
gi|50551655|ref|XP_503302.1| hypothetical protein [Yarrowia lipo... 77 6e-13
gi|50306801|ref|XP_453376.1| unnamed protein product [Kluyveromy... 77 6e-13
gi|34866642|ref|XP_217295.2| similar to hypothetical protein MGC... 77 6e-13
gi|17558962|ref|NP_506621.1| mitochondrial substrate carrier (34... 77 6e-13
gi|45187609|ref|NP_983832.1| ADL264Cp [Eremothecium gossypii] >g... 76 7e-13
gi|23943838|ref|NP_694790.1| solute carrier family 25, member 1;... 76 7e-13
gi|8923520|ref|NP_060345.1| hypothetical protein FLJ20551 [Homo ... 76 7e-13
gi|47211393|emb|CAF90629.1| unnamed protein product [Tetraodon n... 76 1e-12
gi|1944534|emb|CAA73099.1| colt [Drosophila melanogaster] 76 1e-12
gi|31127297|gb|AAH52871.1| Carnitine/acylcarnitine translocase [... 76 1e-12
gi|38648731|gb|AAH63272.1| MGC68968 protein [Xenopus laevis] 76 1e-12
gi|49388534|dbj|BAD25656.1| putative mitochondrial solute carrie... 76 1e-12
gi|33417112|gb|AAH56033.1| MGC68982 protein [Xenopus laevis] 76 1e-12
gi|15236140|ref|NP_194348.1| mitochondrial substrate carrier fam... 76 1e-12
gi|15241360|ref|NP_199918.1| mitochondrial substrate carrier fam... 76 1e-12
gi|38104109|gb|EAA50724.1| hypothetical protein MG04483.4 [Magna... 76 1e-12
gi|26340134|dbj|BAC33730.1| unnamed protein product [Mus musculu... 75 1e-12
gi|18043565|gb|AAH19978.1| Slc25a25 protein [Mus musculus] >gnl|... 75 1e-12
gi|44890495|gb|AAH66998.1| Slc25a25 protein [Mus musculus] 75 1e-12
gi|27694811|gb|AAH43993.1| LOC398474 protein [Xenopus laevis] 75 1e-12
gi|50254386|gb|EAL17139.1| hypothetical protein CNBN2310 [Crypto... 75 1e-12
gi|12007321|gb|AAG45135.1| RIM [Dictyostelium discoideum] 75 1e-12
gi|31560754|ref|NP_666230.2| mitochondrial Ca2+-dependent solute... 75 1e-12
gi|31236871|ref|XP_319491.1| ENSANGP00000020204 [Anopheles gambi... 75 1e-12
gi|28972868|dbj|BAC65850.1| mKIAA1896 protein [Mus musculus] 75 1e-12
gi|47087357|ref|NP_998573.1| zgc:56592 [Danio rerio] >gnl|BL_ORD... 75 2e-12
gi|31203391|ref|XP_310644.1| ENSANGP00000007451 [Anopheles gambi... 75 2e-12
gi|21450145|ref|NP_659042.1| cDNA sequence BC010801 [Mus musculu... 75 2e-12
gi|6325123|ref|NP_015191.1| Mitochondrial inner membrane transpo... 75 2e-12
gi|4138581|emb|CAA67107.1| mitochondrial energy transfer protein... 75 2e-12
gi|50254564|gb|EAL17313.1| hypothetical protein CNBN1400 [Crypto... 75 2e-12
gi|49092678|ref|XP_407800.1| hypothetical protein AN3663.2 [Aspe... 75 2e-12
gi|31217942|ref|XP_316535.1| ENSANGP00000009995 [Anopheles gambi... 75 2e-12
gi|34860155|ref|XP_227597.2| similar to calcium-binding transpor... 75 2e-12
gi|48290295|emb|CAF04496.1| small calcium-binding mitochondrial ... 74 3e-12
gi|47109344|emb|CAF04060.1| mitochondrial ATP-Mg/Pi carrier [Hom... 74 3e-12
gi|27807191|ref|NP_777081.1| solute carrier family 25 (mitochond... 74 3e-12
gi|38197071|gb|AAH05163.2| SLC25A25 protein [Homo sapiens] 74 3e-12
gi|48290299|emb|CAF04498.1| small calcium-binding mitochondrial ... 74 3e-12
gi|28571665|ref|NP_731657.2| CG12201-PB [Drosophila melanogaster... 74 3e-12
gi|32409529|ref|XP_325245.1| hypothetical protein [Neurospora cr... 74 3e-12
gi|39930485|ref|NP_443133.1| solute carrier family 25 (mitochond... 74 3e-12
gi|48290293|emb|CAF04495.1| small calcium-binding mitochondrial ... 74 3e-12
gi|21309943|gb|AAM46109.1| MRS3/4 [Mus musculus] 74 3e-12
gi|15620851|dbj|BAB67789.1| KIAA1896 protein [Homo sapiens] 74 3e-12
gi|32414381|ref|XP_327670.1| hypothetical protein [Neurospora cr... 74 4e-12
gi|47219011|emb|CAG02049.1| unnamed protein product [Tetraodon n... 74 4e-12
gi|50732900|ref|XP_418818.1| PREDICTED: similar to Hypothetical ... 74 4e-12
gi|7493804|pir||T18253 probable mitochondrial carrier protein - ... 74 4e-12
gi|28571261|ref|NP_788934.1| CG33075-PA [Drosophila melanogaster... 74 4e-12
gi|49085830|ref|XP_405007.1| hypothetical protein AN0870.2 [Aspe... 74 4e-12
gi|50290903|ref|XP_447884.1| unnamed protein product [Candida gl... 74 4e-12
gi|19920862|ref|NP_609093.1| CG3476-PA [Drosophila melanogaster]... 74 4e-12
gi|50757414|ref|XP_415513.1| PREDICTED: similar to mitochondrial... 74 5e-12
gi|31238945|ref|XP_319886.1| ENSANGP00000010634 [Anopheles gambi... 74 5e-12
gi|15220023|ref|NP_178108.1| mitochondrial substrate carrier fam... 74 5e-12
gi|46440024|gb|EAK99335.1| hypothetical protein CaO19.2599 [Cand... 74 5e-12
gi|41055086|ref|NP_956901.1| hypothetical protein MGC63578 [Dani... 74 5e-12
gi|45185795|ref|NP_983511.1| ACR109Wp [Eremothecium gossypii] >g... 74 5e-12
gi|49070364|ref|XP_399471.1| hypothetical protein UM01856.1 [Ust... 74 5e-12
gi|49071382|ref|XP_399980.1| hypothetical protein UM02365.1 [Ust... 73 6e-12
gi|10048462|ref|NP_065266.1| carnitine/acylcarnitine translocase... 73 6e-12
gi|49250879|gb|AAH74507.1| Unknown (protein for MGC:69342) [Xeno... 73 6e-12
gi|7512351|pir||G01789 citrate transporter protein - human >gnl|... 73 6e-12
gi|46128223|ref|XP_388665.1| hypothetical protein FG08489.1 [Gib... 73 6e-12
gi|21389315|ref|NP_005975.1| solute carrier family 25 (mitochond... 73 6e-12
gi|47224840|emb|CAG06410.1| unnamed protein product [Tetraodon n... 73 6e-12
gi|50554819|ref|XP_504818.1| hypothetical protein [Yarrowia lipo... 73 6e-12
gi|50259957|gb|EAL22623.1| hypothetical protein CNBB2550 [Crypto... 73 6e-12
gi|1785635|emb|CAA65633.1| mitochondrial citrate transport prote... 73 6e-12
gi|13445630|gb|AAK26321.1| mutant ornithine transporter 2 [Mus m... 73 6e-12
gi|47224526|emb|CAG08776.1| unnamed protein product [Tetraodon n... 73 6e-12
gi|50425615|ref|XP_461404.1| unnamed protein product [Debaryomyc... 73 6e-12
gi|24663279|ref|NP_729803.1| CG32103-PC [Drosophila melanogaster... 73 8e-12
gi|33086456|gb|AAP92540.1| Ab1-114 [Rattus norvegicus] 73 8e-12
gi|39589858|emb|CAE60856.1| Hypothetical protein CBG04567 [Caeno... 73 8e-12
gi|34882294|ref|XP_217311.2| similar to hypothetical protein MGC... 73 8e-12
gi|49077802|ref|XP_402720.1| hypothetical protein UM05105.1 [Ust... 73 8e-12
gi|50308695|ref|XP_454351.1| unnamed protein product [Kluyveromy... 73 8e-12
gi|50254527|gb|EAL17276.1| hypothetical protein CNBN1030 [Crypto... 73 8e-12
gi|21483338|gb|AAM52644.1| GH25190p [Drosophila melanogaster] 73 8e-12
gi|20864410|ref|XP_134226.1| RIKEN cDNA 2900084M01 [Mus musculus... 73 8e-12
gi|34877651|ref|XP_224736.2| similar to CG4241-PA [Rattus norveg... 73 8e-12
gi|24663275|ref|NP_729802.1| CG32103-PB [Drosophila melanogaster... 73 8e-12
gi|21593041|gb|AAM64990.1| putative carnitine/acylcarnitine tran... 72 1e-11
gi|46109418|ref|XP_381767.1| conserved hypothetical protein [Gib... 72 1e-11
gi|50552474|ref|XP_503647.1| hypothetical protein [Yarrowia lipo... 72 1e-11
gi|34902034|ref|NP_912363.1| putative peroxisomal Ca-dependent s... 72 1e-11
gi|50540402|ref|NP_001002667.1| zgc:92447 [Danio rerio] >gnl|BL_... 72 1e-11
gi|11359936|pir||T43493 hypothetical protein DKFZp434C119.1 - hu... 72 1e-11
gi|20137934|sp|Q9BZJ4|CG69_HUMAN Mitochondrial carrier protein C... 72 1e-11
gi|46435410|gb|EAK94792.1| hypothetical protein CaO19.4447 [Cand... 72 1e-11
gi|18606248|gb|AAH23172.1| Slc25a28 protein [Mus musculus] 72 1e-11
gi|49109931|ref|XP_411706.1| hypothetical protein AN7569.2 [Aspe... 72 2e-11
gi|50256975|gb|EAL19693.1| hypothetical protein CNBG3210 [Crypto... 72 2e-11
gi|34907168|ref|NP_914931.1| putative mitochondrial carrier prot... 72 2e-11
gi|7706306|ref|NP_057100.1| CGI-69 protein [Homo sapiens] >gnl|B... 72 2e-11
gi|28551967|emb|CAD55563.1| putative calcium binding transporter... 72 2e-11
gi|50756207|ref|XP_415059.1| PREDICTED: similar to Hypothetical ... 72 2e-11
gi|31240529|ref|XP_320678.1| ENSANGP00000020014 [Anopheles gambi... 72 2e-11
gi|39588024|emb|CAE57255.1| Hypothetical protein CBG00135 [Caeno... 72 2e-11
gi|24648424|ref|NP_650891.1| CG4241-PA [Drosophila melanogaster]... 72 2e-11
gi|47220738|emb|CAG11807.1| unnamed protein product [Tetraodon n... 72 2e-11
gi|12804493|gb|AAH01656.1| SLC25A23 protein [Homo sapiens] 72 2e-11
gi|31206027|ref|XP_311965.1| ENSANGP00000011014 [Anopheles gambi... 72 2e-11
gi|47156872|gb|AAT12275.1| plastidial ADP-glucose transporter [H... 71 2e-11
gi|42563311|ref|NP_565171.3| mitochondrial substrate carrier fam... 71 2e-11
gi|25406546|pir||B96811 hypothetical protein T11I11.12 [imported... 71 2e-11
gi|46436245|gb|EAK95611.1| hypothetical protein CaO19.8971 [Cand... 71 2e-11
gi|50260360|gb|EAL23019.1| hypothetical protein CNBA7860 [Crypto... 71 2e-11
gi|47228617|emb|CAG07349.1| unnamed protein product [Tetraodon n... 71 2e-11
gi|29742699|ref|XP_209204.2| hypothetical protein MGC26694 [Homo... 71 2e-11
gi|4557403|ref|NP_000378.1| carnitine/acylcarnitine translocase;... 71 3e-11
gi|23574715|dbj|BAC20586.1| mitochondrial carnitine/acylcarnitin... 71 3e-11
gi|49072264|ref|XP_400421.1| hypothetical protein UM02806.1 [Ust... 71 3e-11
gi|46436144|gb|EAK95512.1| hypothetical protein CaO19.1393 [Cand... 71 3e-11
gi|49097528|ref|XP_410224.1| hypothetical protein AN6087.2 [Aspe... 71 3e-11
gi|45237193|ref|NP_055470.1| KIAA0446 gene product [Homo sapiens... 71 3e-11
gi|6634035|dbj|BAA32291.2| KIAA0446 protein [Homo sapiens] 71 3e-11
gi|34882292|ref|XP_217310.2| similar to putative calcium binding... 71 3e-11
gi|45551937|ref|NP_732519.2| CG4241-PB [Drosophila melanogaster]... 71 3e-11
gi|39596651|emb|CAE63270.1| Hypothetical protein CBG07647 [Caeno... 71 3e-11
gi|47218543|emb|CAF98075.1| unnamed protein product [Tetraodon n... 70 4e-11
gi|49079746|ref|XP_403484.1| hypothetical protein UM05869.1 [Ust... 70 4e-11
gi|39593720|emb|CAE62012.1| Hypothetical protein CBG06020 [Caeno... 70 4e-11
gi|50308145|ref|XP_454073.1| unnamed protein product [Kluyveromy... 70 4e-11
gi|31226914|ref|XP_317791.1| ENSANGP00000018102 [Anopheles gambi... 70 4e-11
gi|47229664|emb|CAG06860.1| unnamed protein product [Tetraodon n... 70 4e-11
gi|28277020|gb|AAH45598.1| MGC26694 protein [Homo sapiens] 70 4e-11
gi|49086846|ref|XP_405436.1| hypothetical protein AN1299.2 [Aspe... 70 4e-11
gi|50754473|ref|XP_414400.1| PREDICTED: similar to Slc25a20-prov... 70 5e-11
gi|32417256|ref|XP_329106.1| hypothetical protein [Neurospora cr... 70 5e-11
gi|50310009|ref|XP_455018.1| unnamed protein product [Kluyveromy... 70 5e-11
gi|34858131|ref|XP_345232.1| similar to CG5805-PA [Rattus norveg... 70 5e-11
gi|19923634|ref|NP_112489.2| solute carrier family 25, member 28... 70 5e-11
gi|31127064|gb|AAH52771.1| Unknown (protein for MGC:56884) [Mus ... 70 7e-11
gi|22760110|dbj|BAC11071.1| unnamed protein product [Homo sapiens] 70 7e-11
gi|5851675|emb|CAB55356.1| carnitine/acylcarnitine translocase [... 70 7e-11
gi|38105462|gb|EAA51884.1| hypothetical protein MG03479.4 [Magna... 70 7e-11
gi|24370471|emb|CAC70152.1| putative mitochondrial carrier prote... 70 7e-11
gi|50547779|ref|XP_501359.1| hypothetical protein [Yarrowia lipo... 70 7e-11
gi|30520099|ref|NP_848811.1| RIKEN cDNA B430110G05 gene [Mus mus... 70 7e-11
gi|46126995|ref|XP_388051.1| conserved hypothetical protein [Gib... 70 7e-11
gi|15030091|gb|AAH11293.1| 5730438N18Rik protein [Mus musculus] 70 7e-11
gi|50748698|ref|XP_421367.1| PREDICTED: similar to AI132487 prot... 70 7e-11
gi|38108353|gb|EAA54385.1| hypothetical protein MG02370.4 [Magna... 70 7e-11
gi|231654|sp|P29518|BT1_MAIZE Brittle-1 protein, chloroplast pre... 70 7e-11
gi|34394749|dbj|BAC84113.1| putative mitochondrial carrier prote... 69 9e-11
gi|38104928|gb|EAA51424.1| hypothetical protein MG09441.4 [Magna... 69 9e-11
gi|32405390|ref|XP_323308.1| hypothetical protein [Neurospora cr... 69 9e-11
gi|24646146|ref|NP_650134.1| CG18347-PA [Drosophila melanogaster... 69 9e-11
gi|46390080|dbj|BAD15497.1| putative Brittle-1 protein, chloropl... 69 9e-11
gi|34866087|ref|XP_235359.2| similar to mitochondrial folate tra... 69 9e-11
gi|50774500|ref|XP_427233.1| PREDICTED: similar to MGC68968 prot... 69 1e-10
gi|7770165|gb|AAF69618.1| PRO2163 [Homo sapiens] 69 1e-10
gi|27694786|gb|AAH43827.1| Slc25a20-prov protein [Xenopus laevis] 69 1e-10
gi|41053768|ref|NP_956550.1| hypothetical protein MGC55610 [Dani... 69 1e-10
gi|45360847|ref|NP_989099.1| carnitine/acylcarnitine translocase... 69 1e-10
gi|16769102|gb|AAL28770.1| LD16544p [Drosophila melanogaster] 69 1e-10
gi|24641052|ref|NP_572639.2| CG1628-PB [Drosophila melanogaster]... 69 1e-10
gi|30425020|ref|NP_780542.1| RIKEN cDNA 4933406J04 [Mus musculus... 69 1e-10
gi|2393737|gb|AAB70112.1| unknown [Homo sapiens] 69 1e-10
gi|50752052|ref|XP_422631.1| PREDICTED: similar to Hypothetical ... 69 1e-10
gi|47216429|emb|CAG01980.1| unnamed protein product [Tetraodon n... 69 1e-10
gi|39596407|emb|CAE63025.1| Hypothetical protein CBG07280 [Caeno... 69 2e-10
gi|38100630|gb|EAA47731.1| hypothetical protein MG02974.4 [Magna... 69 2e-10
gi|50729450|ref|XP_416521.1| PREDICTED: similar to mitochondrial... 69 2e-10
gi|17539650|ref|NP_502087.1| phosphate carrier protein, mitochon... 69 2e-10
gi|14150082|ref|NP_115691.1| mitochondrial carrier protein MGC43... 69 2e-10
gi|13385736|ref|NP_080508.1| solute carrier family 25, member 30... 69 2e-10
gi|50552638|ref|XP_503729.1| hypothetical protein [Yarrowia lipo... 69 2e-10
gi|47228784|emb|CAG07516.1| unnamed protein product [Tetraodon n... 68 2e-10
gi|39585532|emb|CAE65292.1| Hypothetical protein CBG10209 [Caeno... 68 2e-10
gi|6321696|ref|NP_011773.1| Hypothetical ORF; Mtm1p [Saccharomyc... 68 2e-10
gi|18410193|ref|NP_565048.1| mitochondrial substrate carrier fam... 68 2e-10
gi|50289649|ref|XP_447256.1| unnamed protein product [Candida gl... 68 2e-10
gi|27482410|ref|XP_170736.2| similar to hypothetical protein [Ho... 68 2e-10
gi|6319669|ref|NP_009751.1| Protein of the mitochondrial carrier... 68 2e-10
gi|32414139|ref|XP_327549.1| hypothetical protein [Neurospora cr... 68 3e-10
gi|42569598|ref|NP_180938.2| mitochondrial substrate carrier fam... 68 3e-10
gi|37534064|ref|NP_921334.1| putative Tricarboxylate transport p... 68 3e-10
gi|47221229|emb|CAG13165.1| unnamed protein product [Tetraodon n... 68 3e-10
gi|41200918|ref|XP_370619.1| similar to mitochondrial carrier pr... 68 3e-10
gi|19112744|ref|NP_595952.1| putative mitochondrial carrier prot... 68 3e-10
gi|34872487|ref|XP_216577.2| similar to 5730438N18Rik protein [R... 68 3e-10
gi|49096066|ref|XP_409493.1| hypothetical protein AN5356.2 [Aspe... 68 3e-10
gi|17944417|gb|AAL48099.1| RE73432p [Drosophila melanogaster] 68 3e-10
gi|7522500|pir||T39385 probable mitochondrial carrier protein - ... 68 3e-10
gi|16758854|ref|NP_446417.1| solute carrier family 25 (carnitine... 67 3e-10
gi|15559393|gb|AAH14064.1| Hypothetical protein FLJ10618 [Homo s... 67 3e-10
gi|18407372|ref|NP_566102.1| mitochondrial substrate carrier fam... 67 3e-10
gi|31204213|ref|XP_311055.1| ENSANGP00000019850 [Anopheles gambi... 67 3e-10
gi|18490466|gb|AAH22637.1| Slc25a24 protein [Mus musculus] 67 5e-10
gi|18402984|ref|NP_566683.1| mitochondrial substrate carrier fam... 67 5e-10
gi|17532293|ref|NP_494870.1| mitochondrial substrate carrier fam... 67 5e-10
gi|31210049|ref|XP_313991.1| ENSANGP00000009911 [Anopheles gambi... 67 5e-10
gi|39590729|emb|CAE65099.1| Hypothetical protein CBG09959 [Caeno... 67 5e-10
gi|9294686|dbj|BAB03052.1| mitochondrial carrier protein-like [A... 67 5e-10
gi|50730839|ref|XP_417040.1| PREDICTED: hypothetical protein XP_... 67 5e-10
gi|39595156|emb|CAE60193.1| Hypothetical protein CBG03753 [Caeno... 67 5e-10
gi|19920528|ref|NP_608615.1| CG18317-PA [Drosophila melanogaster... 67 5e-10
gi|49092274|ref|XP_407598.1| hypothetical protein AN3461.2 [Aspe... 67 5e-10
gi|45198664|ref|NP_985693.1| AFR146Wp [Eremothecium gossypii] >g... 67 6e-10
>gi|17539504|ref|NP_501552.1| agpet8 (29.0 kD) (4J697)
[Caenorhabditis elegans]
gi|7498115|pir||T20290 hypothetical protein D1046.3 -
Caenorhabditis elegans
gi|3875300|emb|CAA92291.1| Hypothetical protein D1046.3
[Caenorhabditis elegans]
Length = 269
Score = 535 bits (1379), Expect = e-151
Identities = 269/269 (100%), Positives = 269/269 (100%)
Frame = +1
Query: 1 MPSEEGSVVRWLVCGATAGLAVDIGLYPLDTIKSRMQSKQGFIAAGGFKDIYRGMISVLV 180
MPSEEGSVVRWLVCGATAGLAVDIGLYPLDTIKSRMQSKQGFIAAGGFKDIYRGMISVLV
Sbjct: 1 MPSEEGSVVRWLVCGATAGLAVDIGLYPLDTIKSRMQSKQGFIAAGGFKDIYRGMISVLV 60
Query: 181 GSAPGAAIFFLTYKYINGQMKQVIEERNALVDAVSASLAEIAACAVRVPTELCKQRGQVN 360
GSAPGAAIFFLTYKYINGQMKQVIEERNALVDAVSASLAEIAACAVRVPTELCKQRGQVN
Sbjct: 61 GSAPGAAIFFLTYKYINGQMKQVIEERNALVDAVSASLAEIAACAVRVPTELCKQRGQVN 120
Query: 361 KNERLTLICKEIMETKGIRGFYRGYGSTVAREIPFSIIQFPIWEALKRAVANKKESGRCS 540
KNERLTLICKEIMETKGIRGFYRGYGSTVAREIPFSIIQFPIWEALKRAVANKKESGRCS
Sbjct: 121 KNERLTLICKEIMETKGIRGFYRGYGSTVAREIPFSIIQFPIWEALKRAVANKKESGRCS 180
Query: 541 PLEGAACGSVAGFIAAGLTTPLDVAKTRIMLTKNGPAPGILSTLKEVYTSNGVRGLYSGV 720
PLEGAACGSVAGFIAAGLTTPLDVAKTRIMLTKNGPAPGILSTLKEVYTSNGVRGLYSGV
Sbjct: 181 PLEGAACGSVAGFIAAGLTTPLDVAKTRIMLTKNGPAPGILSTLKEVYTSNGVRGLYSGV 240
Query: 721 VPRVMWISGGGFVFFGAYETAMHFTKFLD 807
VPRVMWISGGGFVFFGAYETAMHFTKFLD
Sbjct: 241 VPRVMWISGGGFVFFGAYETAMHFTKFLD 269