Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C56E6_2
         (801 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|25149700|ref|NP_495318.2| small GTP-binding proteins rab-like...   516   e-145
gi|7498026|pir||T15860 hypothetical protein C56E6.2 - Caenorhabd...   400   e-140
gi|39597111|emb|CAE59338.1| Hypothetical protein CBG02683 [Caeno...   449   e-125
gi|1619865|gb|AAB16978.1| rab-like [Caenorhabditis elegans]           220   3e-56
gi|50311935|ref|XP_455999.1| unnamed protein product [Kluyveromy...   137   3e-31
gi|15236081|ref|NP_195699.1| Ras-related GTP-binding family prot...   136   5e-31
gi|45201353|ref|NP_986923.1| AGR257Cp [Eremothecium gossypii] >g...   136   6e-31
gi|50292103|ref|XP_448484.1| unnamed protein product [Candida gl...   135   1e-30
gi|49456921|emb|CAG46781.1| RAB6A [Homo sapiens]                      133   4e-30
gi|46434549|gb|EAK93955.1| hypothetical protein CaO19.714 [Candi...   133   4e-30
gi|47225306|emb|CAG09806.1| unnamed protein product [Tetraodon n...   132   7e-30
gi|46111195|ref|XP_382655.1| conserved hypothetical protein [Gib...   132   7e-30
gi|28302338|gb|AAH46683.1| Rab6-prov protein [Xenopus laevis]         132   9e-30
gi|49257610|gb|AAH74238.1| Unknown (protein for MGC:83971) [Xeno...   132   9e-30
gi|47228262|emb|CAG07657.1| unnamed protein product [Tetraodon n...   132   9e-30
gi|6759651|gb|AAF27978.1| GTP binding protein; Rab6 [Plasmodium ...   132   1e-29
gi|23481886|gb|EAA18032.1| Rab6 [Plasmodium yoelii yoelii]            132   1e-29
gi|17570073|ref|NP_510790.1| RAB family member (23.4 kD) (rab-6....   131   1e-29
gi|39596053|emb|CAE69689.1| Hypothetical protein CBG15944 [Caeno...   131   1e-29
gi|17512290|gb|AAH19118.1| Rab6 protein [Mus musculus]                131   1e-29
gi|19923231|ref|NP_002860.2| RAB6A, member RAS oncogene family i...   131   1e-29
gi|7706675|ref|NP_057661.1| RAB6B, member RAS oncogene family; s...   131   1e-29
gi|1575675|gb|AAC47440.1| rab6 [Plasmodium falciparum]                131   2e-29
gi|47222578|emb|CAG02943.1| unnamed protein product [Tetraodon n...   131   2e-29
gi|1628428|emb|CAA63555.1| GTPase; RAB6 [Plasmodium falciparum 3D7]   131   2e-29
gi|13195674|ref|NP_077249.1| RAB6, member RAS oncogene family [M...   130   3e-29
gi|15224916|ref|NP_181989.1| Ras-related GTP-binding protein, pu...   130   3e-29
gi|38679888|ref|NP_942599.1| RAB6A, member RAS oncogene family i...   130   3e-29
gi|17137220|ref|NP_477172.1| CG6601-PA [Drosophila melanogaster]...   130   3e-29
gi|31227879|ref|XP_317957.1| ENSANGP00000020507 [Anopheles gambi...   130   3e-29
gi|48766845|gb|AAT46563.1| Rab [Marsupenaeus japonicus]               130   3e-29
gi|6323291|ref|NP_013363.1| Ras-like GTP binding protein involve...   130   3e-29
gi|19114161|ref|NP_593249.1| gtp-binding protein ryh1 [Schizosac...   130   3e-29
gi|18266415|gb|AAL67567.1| small GTP binding protein rab6 [Babes...   130   4e-29
gi|48096836|ref|XP_392533.1| similar to ENSANGP00000020507 [Apis...   130   4e-29
gi|46434574|gb|EAK93979.1| hypothetical protein CaO19.8333 [Cand...   130   4e-29
gi|45361477|ref|NP_989315.1| hypothetical protein MGC76176 [Xeno...   130   4e-29
gi|38103716|gb|EAA50384.1| hypothetical protein MG04143.4 [Magna...   130   4e-29
gi|6984166|gb|AAF34783.1| RAB6 protein [Toxoplasma gondii]            128   1e-28
gi|10120632|pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium ...   128   1e-28
gi|7438385|pir||T03627 GTP-binding protein Rab6 - common tobacco...   127   2e-28
gi|11274352|pir||T50814 GTP-binding protein - Arabidopsis thalia...   127   2e-28
gi|17553774|ref|NP_498993.1| RAB family member (23.3 kD) (rab-6....   127   3e-28
gi|39585054|emb|CAE62705.1| Hypothetical protein CBG06854 [Caeno...   127   3e-28
gi|15227173|ref|NP_179816.1| Ras-related GTP-binding protein, pu...   127   3e-28
gi|49080386|ref|XP_403719.1| hypothetical protein UM06104.1 [Ust...   127   4e-28
gi|31216369|ref|XP_316217.1| ENSANGP00000005948 [Anopheles gambi...   126   5e-28
gi|34901804|ref|NP_912248.1| GTP-binding protein Rab6 [Oryza sat...   126   6e-28
gi|50547479|ref|XP_501209.1| hypothetical protein [Yarrowia lipo...   126   6e-28
gi|50422037|ref|XP_459580.1| unnamed protein product [Debaryomyc...   125   1e-27
gi|30923578|gb|EAA46055.1| CG17515-PB [Drosophila melanogaster]       124   2e-27
gi|50254827|gb|EAL17571.1| hypothetical protein CNBM0510 [Crypto...   124   3e-27
gi|6322866|ref|NP_012939.1| rab5-like GTPase involved in vacuola...   124   3e-27
gi|33944327|ref|XP_340311.1| small GTP binding protein RAB6, put...   123   4e-27
gi|29841343|gb|AAP06375.1| similar to NM_130025 putative small G...   123   5e-27
gi|21429138|gb|AAM50288.1| RE42508p [Drosophila melanogaster]         122   7e-27
gi|50306401|ref|XP_453174.1| unnamed protein product [Kluyveromy...   122   7e-27
gi|50288533|ref|XP_446696.1| unnamed protein product [Candida gl...   122   7e-27
gi|730510|sp|P40392|RIC1_ORYSA Ras-related protein RIC1 >gnl|BL_...   122   9e-27
gi|15238317|ref|NP_201304.1| Ras-related GTP-binding protein, pu...   122   9e-27
gi|23619155|ref|NP_705117.1| small GTPase Rab11 [Plasmodium falc...   122   9e-27
gi|13537443|dbj|BAB40676.1| small GTPase RabG [Entamoeba histoly...   122   9e-27
gi|47087033|ref|NP_998530.1| zgc:63637 [Danio rerio] >gnl|BL_ORD...   122   1e-26
gi|34914060|ref|NP_918377.1| putative RIC1_ORYSA RAS-RELATED PRO...   121   2e-26
gi|13537447|dbj|BAB40678.1| small GTPase Rab11B [Entamoeba histo...   121   2e-26
gi|37546274|ref|XP_293398.2| similar to DNA segment, Chr 9, Brig...   120   3e-26
gi|29647488|dbj|BAC75417.1| putative GTP-binding protein(RAB11G)...   120   3e-26
gi|31745716|gb|AAP57202.1| Rab11 [Toxoplasma gondii]                  120   3e-26
gi|22597170|gb|AAN03472.1| GTP-binding protein [Glycine max]          120   3e-26
gi|14149799|ref|NP_115520.1| RAB6C, member RAS oncogene family [...   120   3e-26
gi|50731391|ref|XP_417254.1| PREDICTED: similar to RAB6A, member...   120   3e-26
gi|30583895|gb|AAP36196.1| Homo sapiens RAB22A, member RAS oncog...   120   4e-26
gi|15242483|ref|NP_199387.1| Ras-related GTP-binding protein, pu...   120   4e-26
gi|19114819|ref|NP_593907.1| endocytic rab protein [Schizosaccha...   120   4e-26
gi|10636479|emb|CAC10538.1| GTP-binding protein RAB22A [Homo sap...   120   4e-26
gi|3256092|emb|CAA80473.1| Rab22a protein [Canis familiaris]          120   4e-26
gi|18568105|gb|AAL75941.1| RAB22 [Homo sapiens]                       120   4e-26
gi|10190714|ref|NP_065724.1| RAS-related protein RAB-22A; GTP-bi...   120   4e-26
gi|15232477|ref|NP_188124.1| Ras-related GTP-binding family prot...   120   4e-26
gi|45387853|ref|NP_991282.1| RAB22A, member RAS oncogene family ...   120   4e-26
gi|32398899|emb|CAD98364.1| small GTP binding protein rab1a, pro...   119   6e-26
gi|1370160|emb|CAA98186.1| RAB11J [Lotus corniculatus var. japon...   119   8e-26
gi|34913324|ref|NP_918009.1| putative Rab GTP-binding protein Ra...   119   8e-26
gi|303750|dbj|BAA02116.1| GTP-binding protein [Pisum sativum] >g...   119   1e-25
gi|37791225|gb|AAR03593.1| Rab5 [Leishmania donovani]                 119   1e-25
gi|21426817|ref|NP_077756.1| RAB22A, member RAS oncogene family;...   119   1e-25
gi|541979|pir||S41431 GTP-binding protein, ras-like - fava bean ...   119   1e-25
gi|3024504|sp|Q40521|R11B_TOBAC Ras-related protein Rab11B >gnl|...   119   1e-25
gi|7438404|pir||T03626 GTP-binding protein Rab11e - common tobac...   118   1e-25
gi|49333370|gb|AAT64010.1| putative GTP-binding protein [Gossypi...   118   1e-25
gi|2623643|gb|AAB86480.1| GTP-binding protein [Entamoeba histoly...   118   1e-25
gi|47900325|gb|AAT39172.1| putative GTP-binding protein [Oryza s...   118   1e-25
gi|47220716|emb|CAG11785.1| unnamed protein product [Tetraodon n...   118   1e-25
gi|6808528|gb|AAF28422.1| Rab6-like protein [Homo sapiens]            118   1e-25
gi|20071543|gb|AAH26915.1| Rab6 protein [Mus musculus]                118   2e-25
gi|45184648|ref|NP_982366.1| AAL176Cp [Eremothecium gossypii] >g...   118   2e-25
gi|49333384|gb|AAT64023.1| putative GTP-binding protein [Gossypi...   118   2e-25
gi|9663385|emb|CAB95235.2| probable RAB5B [Leishmania major] >gn...   118   2e-25
gi|15218719|ref|NP_174177.1| Ras-related GTP-binding protein, pu...   117   2e-25
gi|34860889|ref|XP_345480.1| similar to RAB22, member RAS oncoge...   117   2e-25
gi|5714658|gb|AAD48018.1| Rab GTP-binding protein Rab11a [Gossyp...   117   2e-25
gi|18447915|dbj|BAB84323.1| ras-related protein RAB8-2 [Nicotian...   117   2e-25
gi|15225121|ref|NP_180726.1| Ras-related GTP-binding protein, pu...   117   2e-25
gi|1710019|sp|P51154|R22A_CANFA Ras-related protein Rab-22A (Rab...   117   2e-25
gi|730512|sp|P40393|RIC2_ORYSA Ras-related protein RIC2 >gnl|BL_...   117   2e-25
gi|13195452|gb|AAK15703.1| GTP-binding protein [Oryza sativa]         117   2e-25
gi|50758941|ref|XP_417490.1| PREDICTED: similar to Rab22a protei...   117   2e-25
gi|11992279|gb|AAG42497.1| small GTP-binding protein RAB5B [Oryz...   117   3e-25
gi|13537441|dbj|BAB40675.1| small GTPase RabF [Entamoeba histoly...   117   3e-25
gi|18447917|dbj|BAB84324.1| ras-related protein RAB8-3 [Nicotian...   117   3e-25
gi|21536533|gb|AAM60865.1| Rab-type small GTP-binding protein-li...   117   3e-25
gi|2808638|emb|CAA04701.1| small GTP-binding protein [Daucus car...   117   3e-25
gi|9368508|emb|CAB98162.1| RAB5-like protein [Leishmania major]       117   3e-25
gi|46577691|sp|P35285|R22A_MOUSE Ras-related protein Rab-22A (Ra...   117   3e-25
gi|34859460|ref|XP_344926.1| similar to RAB6, member RAS oncogen...   117   4e-25
gi|18997099|gb|AAL83291.1| Rab7-like protein [Leishmania brazili...   116   5e-25
gi|34909538|ref|NP_916116.1| putative GTP-binding protein [Oryza...   116   5e-25
gi|15238115|ref|NP_199563.1| Ras-related GTP-binding protein, pu...   116   5e-25
gi|7643790|gb|AAF65510.1| small GTP-binding protein [Capsicum an...   116   5e-25
gi|23613148|ref|NP_703470.1| GTPase, putative [Plasmodium falcip...   116   5e-25
gi|15341954|gb|AAH13170.1| RAB17, member RAS oncogene family [Mu...   116   5e-25
gi|6679585|ref|NP_033024.1| RAB17, member RAS oncogene family [M...   116   5e-25
gi|542218|pir||A47733 GTP-binding protein ypt5 - fission yeast  ...   116   6e-25
gi|1362066|pir||S57471 GTP-binding protein GTP6 - garden pea >gn...   116   6e-25
gi|12844668|dbj|BAB26452.1| unnamed protein product [Mus musculus]    116   6e-25
gi|50511479|gb|AAT77401.1| putative GTP-binding protein [Oryza s...   116   6e-25
gi|33146687|dbj|BAC80082.1| putative ethylene-responsive small G...   116   6e-25
gi|5931625|dbj|BAA84717.1| rab5B [Oryza sativa (japonica cultiva...   115   8e-25
gi|18410144|ref|NP_567008.1| Rab GTPase (ARA6) [Arabidopsis thal...   115   8e-25
gi|2708641|gb|AAB92559.1| GTPase rab11b [Dictyostelium discoideum]    115   8e-25
gi|7438434|pir||T06736 GTP-binding protein F28P10.180 - Arabidop...   115   8e-25
gi|18447921|dbj|BAB84326.1| ras-related protein RAB8-5 [Nicotian...   115   8e-25
gi|23479748|gb|EAA16491.1| putative GTPase [Plasmodium yoelii yo...   115   8e-25
gi|1370198|emb|CAA98176.1| RAB8E [Lotus corniculatus var. japoni...   115   8e-25
gi|46559001|emb|CAG27070.1| small GTPase [Medicago sativa]            115   1e-24
gi|541978|pir||S41430 GTP-binding protein, ras-like (clone vfa-y...   115   1e-24
gi|18447913|dbj|BAB84322.1| ras-related protein RAB8-1 [Nicotian...   115   1e-24
gi|479442|pir||S33900 GTP-binding protein ypt2 - tomato >gnl|BL_...   115   1e-24
gi|1053067|gb|AAA80680.1| small GTP-binding protein                   115   1e-24
gi|1370180|emb|CAA98167.1| RAB5B [Lotus corniculatus var. japoni...   115   1e-24
gi|37545057|ref|XP_113967.2| similar to Rab12 protein [Homo sapi...   115   1e-24
gi|42561732|ref|NP_563750.2| Ras-related protein (ARA-1) (ARA) /...   115   1e-24
gi|114085|sp|P19892|ARA1_ARATH Ras-related protein ARA-1 >gnl|BL...   115   1e-24
gi|1710015|sp|P51152|RB12_CANFA Ras-related protein Rab-12 >gnl|...   115   1e-24
gi|15242773|ref|NP_195972.1| Ras-related GTP-binding protein, pu...   115   1e-24
gi|47222415|emb|CAG12935.1| unnamed protein product [Tetraodon n...   115   1e-24
gi|47223044|emb|CAG07131.1| unnamed protein product [Tetraodon n...   115   1e-24
gi|2500073|sp|Q39571|YPT1_CHLRE GTP-binding protein YPTC1 >gnl|B...   114   2e-24
gi|15239462|ref|NP_200894.1| Ras-related GTP-binding protein, pu...   114   2e-24
gi|464532|sp|P34143|RABC_DICDI Ras-related protein RabC >gnl|BL_...   114   2e-24
gi|7438428|pir||T06443 GTP-binding protein - garden pea >gnl|BL_...   114   2e-24
gi|50540198|ref|NP_001002566.1| zgc:92757 [Danio rerio] >gnl|BL_...   114   2e-24
gi|5902803|sp|P28188|ARA5_ARATH Ras-related protein ARA-5 >gnl|B...   114   2e-24
gi|50256143|gb|EAL18870.1| hypothetical protein CNBI1310 [Crypto...   114   2e-24
gi|17380746|gb|AAL36203.1| putative RAS-related protein ARA-1 [A...   114   2e-24
gi|217841|dbj|BAA00832.1| small GTP-binding protein [Arabidopsis...   114   2e-24
gi|21592670|gb|AAM64619.1| putative Ras-like GTP-binding protein...   114   2e-24
gi|1076457|pir||S52024 GTP-binding protein bra - rape >gnl|BL_OR...   114   2e-24
gi|1370154|emb|CAA98183.1| RAB11G [Lotus corniculatus var. japon...   114   2e-24
gi|15217622|ref|NP_171715.1| Ras-related protein (ARA-5) / small...   114   2e-24
gi|29841162|gb|AAP06175.1| similar to NM_002868 RAB5B, member RA...   114   2e-24
gi|29124128|gb|AAO65869.1| ethylene-responsive small GTP-binding...   114   2e-24
gi|15224226|ref|NP_181842.1| Ras-related protein (ARA-4) / small...   114   2e-24
gi|81634|pir||PS0279 GTP-binding protein ara-5 - Arabidopsis tha...   114   2e-24
gi|33416792|gb|AAH56058.1| Rab5-prov protein [Xenopus laevis]         114   2e-24
gi|7438400|pir||T12437 small GTP-binding protein - common ice pl...   114   3e-24
gi|1370166|emb|CAA98160.1| RAB1C [Lotus corniculatus var. japoni...   114   3e-24
gi|5714660|gb|AAD48019.1| Rab GTP-binding protein Rab11b [Gossyp...   114   3e-24
gi|17737369|ref|NP_523419.1| CG17060-PA [Drosophila melanogaster...   114   3e-24
gi|19114579|ref|NP_593667.1| YPT1-related rab subfamily protein ...   114   3e-24
gi|42733994|gb|AAM33191.3| similar to Dictyostelium discoideum (...   114   3e-24
gi|7438431|pir||T06446 GTP-binding protein - garden pea >gnl|BL_...   114   3e-24
gi|50418070|gb|AAH77537.1| Unknown (protein for IMAGE:6864608) [...   114   3e-24
gi|14423577|gb|AAK62471.1| small GTP-binding protein Rab8 [Entam...   113   4e-24
gi|6983543|emb|CAB75350.1| LmRab7 GTP-binding protein [Leishmani...   113   4e-24
gi|15232784|ref|NP_187601.1| Ras-related GTP-binding protein, pu...   113   4e-24
gi|50411080|ref|XP_457015.1| unnamed protein product [Debaryomyc...   113   4e-24
gi|4758984|ref|NP_004654.1| Ras-related protein Rab-11A; RAB 11A...   113   4e-24
gi|2118482|pir||I38703 ras-related small GTP binding protein Rab...   113   4e-24
gi|15231847|ref|NP_190929.1| Ras-related GTP-binding protein, pu...   113   4e-24
gi|41393545|ref|NP_004574.2| RAB5C, member RAS oncogene family i...   113   4e-24
gi|12057010|emb|CAC19792.1| RAB5A protein [Oryza sativa]              113   4e-24
gi|2118462|pir||S52646 GTP-binding protein gmr2 - soybean             113   4e-24
gi|37747686|gb|AAH60015.1| MGC68629 protein [Xenopus laevis]          113   4e-24
gi|1370164|emb|CAA98159.1| RAB1B [Lotus corniculatus var. japoni...   113   4e-24
gi|30584069|gb|AAP36283.1| Homo sapiens RAB11A, member RAS oncog...   113   4e-24
gi|31243023|ref|XP_321946.1| ENSANGP00000013866 [Anopheles gambi...   113   4e-24
gi|50753230|ref|XP_413914.1| PREDICTED: similar to RAB11a, membe...   113   4e-24
gi|38175435|dbj|BAC83185.2| putative ras-related protein [Oryza ...   113   4e-24
gi|464523|sp|P34139|RB1A_DICDI Ras-related protein Rab1A >gnl|BL...   113   5e-24
gi|34862219|ref|XP_213824.2| similar to RAB5B, member RAS oncoge...   113   5e-24
gi|30580479|sp|Q8WQ53|RB21_GEOCY Ras-related protein Rab-21 >gnl...   113   5e-24
gi|82803|pir||S04590 GTP-binding protein ypt1 - fission yeast  (...   113   5e-24
gi|38258917|sp|P35278|RB5C_MOUSE Ras-related protein Rab-5C >gnl...   113   5e-24
gi|15238542|ref|NP_200792.1| Ras-related GTP-binding family prot...   113   5e-24
gi|15231322|ref|NP_190192.1| Ras-related protein (ARA-3) / small...   113   5e-24
gi|27689505|ref|XP_213463.1| similar to Rab5c protein [Rattus no...   113   5e-24
gi|20072723|gb|AAH27378.1| Rab5c protein [Mus musculus]               113   5e-24
gi|401686|sp|P31584|YPT1_VOLCA GTP-binding protein yptV1 >gnl|BL...   113   5e-24
gi|19112997|ref|NP_596205.1| ypt1-related protein 1 [Schizosacch...   113   5e-24
gi|1613773|gb|AAB16753.1| Rab1                                        113   5e-24
gi|12052816|emb|CAB66580.1| hypothetical protein [Homo sapiens] ...   113   5e-24
gi|49522606|gb|AAH75323.1| Unknown (protein for MGC:88997) [Xeno...   113   5e-24
gi|13537429|dbj|BAB40669.1| small GTPase Rab1 [Entamoeba histoly...   112   7e-24
gi|1845598|gb|AAB47925.1| Rab3 [Loligo pealei]                        112   7e-24
gi|29791696|gb|AAH50558.1| RAB5B, member RAS oncogene family [Ho...   112   7e-24
gi|5669640|gb|AAD46405.1| ethylene-responsive small GTP-binding ...   112   7e-24
gi|40538929|gb|AAR87186.1| putative small GTP-binding protein [O...   112   7e-24
gi|14140133|emb|CAC39050.1| putative GTP-binding protein [Oryza ...   112   7e-24
gi|13774086|gb|AAK38149.1| small GTP-binding protein [Oryza sativa]   112   7e-24
gi|33991655|gb|AAH56422.1| RAB5B protein [Homo sapiens]               112   7e-24
gi|7438389|pir||T12097 GTP-binding protein, ras-like (clone vfa-...   112   7e-24
gi|23613161|ref|NP_703483.1| Rab1 protein [Plasmodium falciparum...   112   7e-24
gi|4585808|emb|CAB40900.1| putative Rab1A protein [Plasmodium fa...   112   7e-24
gi|50424201|ref|XP_460687.1| unnamed protein product [Debaryomyc...   112   7e-24
gi|40807042|gb|AAH65298.1| Unknown (protein for IMAGE:6146668) [...   112   7e-24
gi|3024528|sp|Q39434|RAB2_BETVU Ras-related protein Rab2BV >gnl|...   112   7e-24
gi|15231462|ref|NP_187397.1| Ras-related GTP-binding family prot...   112   7e-24
gi|11967981|ref|NP_071894.1| RAB17, member RAS oncogene family [...   112   7e-24
gi|48146681|emb|CAG33563.1| RAB17 [Homo sapiens]                      112   7e-24
gi|31324876|gb|AAP48704.1| rab11-2 [Limulus polyphemus]               112   7e-24
gi|4506371|ref|NP_002859.1| RAB5B, member RAS oncogene family [H...   112   7e-24
gi|25304086|gb|AAH40143.1| Similar to RAB5B, member RAS oncogene...   112   7e-24
gi|15238392|ref|NP_201330.1| Ras-related GTP-binding family prot...   112   9e-24
gi|50760924|ref|XP_418183.1| PREDICTED: similar to GTP-binding p...   112   9e-24
gi|17559534|ref|NP_507083.1| GTP-binding protein like (5Q673) [C...   112   9e-24
gi|22597172|gb|AAN03473.1| small GTP-binding protein [Glycine max]    112   9e-24
gi|4586580|dbj|BAA76422.1| rab-type small GTP-binding protein [C...   112   9e-24
gi|1710027|sp|P51147|RB5C_CANFA Ras-related protein Rab-5C >gnl|...   112   9e-24
gi|421942|pir||S34253 GTP-binding protein, ras-related - common ...   112   9e-24
gi|466172|sp|Q05737|YPT2_MAIZE GTP-binding protein YPTM2 >gnl|BL...   112   9e-24
gi|15221005|ref|NP_173258.1| Ras-related GTP-binding family prot...   112   9e-24
gi|23490566|gb|EAA22313.1| Rab1 protein [Plasmodium yoelii yoelii]    112   9e-24
gi|25012906|gb|AAN71540.1| RH21315p [Drosophila melanogaster]         112   9e-24
gi|9719734|gb|AAF97836.1| Contains similarity to ras-related GTP...   112   9e-24
gi|38194437|gb|AAR13228.1| Rab family GTPase Rab8 [Fucus distichus]   112   1e-23
gi|1370152|emb|CAA98182.1| RAB11F [Lotus corniculatus var. japon...   112   1e-23
gi|3334326|sp|O14462|SEC4_CANAL Ras-related protein SEC4 >gnl|BL...   112   1e-23
gi|303732|dbj|BAA02117.1| GTP-binding protein [Pisum sativum] >g...   112   1e-23
gi|21553627|gb|AAM62720.1| putative RAS superfamily GTP-binding ...   112   1e-23
gi|25150215|ref|NP_491199.2| RAB family member (24.0 kD) (rab-8)...   112   1e-23
gi|131847|sp|P22127|RB10_DISOM Ras-related protein Rab-10 (ORA1)...   112   1e-23
gi|1279542|emb|CAA95859.1| small GTPase [Mangifera indica]            112   1e-23
gi|46485881|gb|AAS98506.1| putative GTP-binding protein Rab11 [O...   112   1e-23
gi|17864296|ref|NP_524713.1| CG3870-PA [Drosophila melanogaster]...   111   2e-23
gi|47219617|emb|CAG02662.1| unnamed protein product [Tetraodon n...   111   2e-23
gi|23484033|gb|EAA19507.1| small GTPase rab11-related [Plasmodiu...   111   2e-23
gi|50540176|ref|NP_001002555.1| zgc:92772 [Danio rerio] >gnl|BL_...   111   2e-23
gi|14249144|ref|NP_116006.1| RAB11B, member RAS oncogene family ...   111   2e-23
gi|49456343|emb|CAG46492.1| RAB11B [Homo sapiens]                     111   2e-23
gi|47216427|emb|CAG01978.1| unnamed protein product [Tetraodon n...   111   2e-23
gi|1381678|gb|AAB97115.1| small GTP-binding protein [Glycine max]     111   2e-23
gi|131849|sp|P22129|R11B_DISOM Ras-related protein Rab-11B (ORA3...   111   2e-23
gi|6679583|ref|NP_033023.1| RAB11B, member RAS oncogene family [...   111   2e-23
gi|7438433|pir||T06448 GTP-binding protein - garden pea >gnl|BL_...   111   2e-23
gi|49671143|gb|AAH75268.1| Unknown (protein for MGC:88884) [Xeno...   111   2e-23
gi|48095308|ref|XP_392276.1| similar to CG7605-PA [Apis mellifera]    111   2e-23
gi|50582491|dbj|BAD32700.1| Rab3 [Loligo pealei]                      111   2e-23
gi|15219955|ref|NP_173136.1| Ras-related GTP-binding protein, pu...   111   2e-23
gi|7108528|gb|AAF36458.1| small GTPase [Mus musculus]                 111   2e-23
gi|39586275|emb|CAE66686.1| Hypothetical protein CBG12025 [Caeno...   111   2e-23
gi|17737663|ref|NP_524172.1| CG8287-PA [Drosophila melanogaster]...   111   2e-23
gi|1370196|emb|CAA98175.1| RAB8D [Lotus corniculatus var. japoni...   111   2e-23
gi|15234020|ref|NP_193615.1| Ras-related GTP-binding family prot...   111   2e-23
gi|15233873|ref|NP_193578.1| Ras-related GTP-binding protein, pu...   111   2e-23
gi|12311680|emb|CAC24475.1| GTP binding protein [Cichorium intyb...   111   2e-23
gi|3024527|sp|Q39433|RAB1_BETVU Ras-related protein RAB1BV >gnl|...   111   2e-23
gi|46250314|gb|AAH68736.1| MGC81204 protein [Xenopus laevis]          111   2e-23
gi|9988838|gb|AAG10794.1| Rab5 [Toxoplasma gondii]                    111   2e-23
gi|32409189|ref|XP_325075.1| hypothetical protein [Neurospora cr...   111   2e-23
gi|13096181|pdb|1HUQ|A Chain A, 1.8a Crystal Structure Of The Mo...   111   2e-23
gi|48716902|dbj|BAD23597.1| putative GTP-binding protein [Oryza ...   111   2e-23
gi|1053063|gb|AAA80678.1| small GTP-binding protein                   111   2e-23
gi|1076545|pir||S49225 guanine nucleotide regulatory protein - f...   111   2e-23
gi|49168452|emb|CAG38721.1| RAB5B [Homo sapiens]                      111   2e-23
gi|1362065|pir||S57462 GTP-binding protein GTP11 - garden pea >g...   111   2e-23
gi|50732756|ref|XP_418748.1| PREDICTED: similar to GTP-binding p...   111   2e-23
gi|92339|pir||S06147 GTP-binding protein rab1B - rat >gnl|BL_ORD...   110   3e-23
gi|2500076|sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT...   110   3e-23
gi|49168476|emb|CAG38733.1| RAB11B [Homo sapiens]                     110   3e-23
gi|13537437|dbj|BAB40673.1| small GTPase Rab5 [Entamoeba histoly...   110   3e-23
gi|5764095|gb|AAD51132.1| small GTP-binding protein rab1 [Theile...   110   3e-23
gi|46436619|gb|EAK95978.1| hypothetical protein CaO19.7216 [Cand...   110   3e-23
gi|50306647|ref|XP_453297.1| unnamed protein product [Kluyveromy...   110   3e-23
gi|21555752|gb|AAM63927.1| guanine nucleotide regulatory protein...   110   3e-23
gi|34908298|ref|NP_915496.1| Ras-related GTP-binding protein [Or...   110   3e-23
gi|1370168|emb|CAA98161.1| RAB1D [Lotus corniculatus var. japoni...   110   3e-23
gi|499068|emb|CAA54506.1| GTPase [Glycine max]                        110   3e-23
gi|7710086|ref|NP_057885.1| RAB10, member RAS oncogene family [M...   110   3e-23
gi|12311684|emb|CAC24477.1| GTP binding protein [Cichorium intyb...   110   3e-23
gi|50557054|ref|XP_505935.1| hypothetical protein [Yarrowia lipo...   110   3e-23
gi|1370194|emb|CAA98174.1| RAB8C [Lotus corniculatus var. japoni...   110   3e-23
gi|23613426|ref|NP_703270.1| P. falciparum GTP binding protein R...   110   3e-23
gi|17066210|emb|CAD12439.1| Rab5c GTPase [Plasmodium falciparum ...   110   3e-23
gi|3024552|sp|Q40723|RGP2_ORYSA Ras-related protein RGP2 (GTP-bi...   110   3e-23
gi|34897394|ref|NP_910043.1| Ras-related GTP-binding protein [Or...   110   3e-23
gi|39588485|emb|CAE58008.1| Hypothetical protein CBG01077 [Caeno...   110   3e-23
gi|17558550|ref|NP_503397.1| RAB family member (22.5 kD) (rab-1)...   110   3e-23
gi|7438394|pir||T14405 small GTP-binding protein rab-1 - turnip ...   110   3e-23
gi|3024529|sp|Q40195|R11E_LOTJA Ras-related protein Rab11E >gnl|...   110   3e-23
gi|4758986|ref|NP_004209.1| RAB11B, member RAS oncogene family; ...   110   3e-23
gi|47550807|ref|NP_999935.1| zgc:55760 [Danio rerio] >gnl|BL_ORD...   110   3e-23
gi|19173399|ref|NP_597202.1| RAS-RELATED PROTEIN RAB5 [Encephali...   110   3e-23
gi|49074658|ref|XP_401448.1| YPT1_NEUCR GTP-binding protein ypt1...   110   3e-23
gi|50286745|ref|XP_445802.1| unnamed protein product [Candida gl...   110   3e-23
gi|7438420|pir||T03637 GTP-binding protein mgp2 - maize >gnl|BL_...   110   3e-23
gi|400977|sp|P31583|RHN1_NICPL Ras-related protein RHN1 >gnl|BL_...   110   3e-23
gi|131804|sp|P24409|RB10_CANFA Ras-related protein Rab-10 >gnl|B...   110   3e-23
gi|15222396|ref|NP_172221.1| Ras-related GTP-binding protein, pu...   110   3e-23
gi|46326983|gb|AAS88430.1| ethylene-responsive small GTP-binding...   110   3e-23
gi|15217568|ref|NP_172434.1| Ras-related GTP-binding protein, pu...   110   3e-23
gi|3024500|sp|Q40191|R11A_LOTJA Ras-related protein Rab11A >gnl|...   110   5e-23
gi|42543202|pdb|1OIV|A Chain A, X-Ray Structure Of The Small G P...   110   5e-23
gi|560504|emb|CAA82710.1| guanine nucleotide regulatory protein ...   110   5e-23
gi|1370156|emb|CAA98184.1| RAB11H [Lotus corniculatus var. japon...   110   5e-23
gi|27370881|gb|AAH41250.1| Rab11b-prov protein [Xenopus laevis]       110   5e-23
gi|16758202|ref|NP_445911.1| RAB27B, member RAS oncogene family ...   110   5e-23
gi|49093036|ref|XP_407979.1| conserved hypothetical protein [Asp...   110   5e-23
gi|34906164|ref|NP_914429.1| putative GTP-binding protein [Oryza...   110   5e-23
gi|38109427|gb|EAA55305.1| hypothetical protein MG06962.4 [Magna...   110   5e-23
gi|49081160|ref|XP_404018.1| hypothetical protein UM06403.1 [Ust...   110   5e-23
gi|41393159|ref|NP_958909.1| RAB5C, member RAS oncogene family [...   110   5e-23
gi|7498104|pir||T33855 hypothetical protein D1037.4 - Caenorhabd...   110   5e-23
gi|25294107|pir||JC7589 Sec4p homolog - yeast (Pichia pastoris) ...   110   5e-23
gi|3025293|sp|Q39572|YPT6_CHLRE Ras-related protein YPTC6 >gnl|B...   110   5e-23
gi|1370170|emb|CAA98162.1| RAB1E [Lotus corniculatus var. japoni...   110   5e-23
gi|15226182|ref|NP_180943.1| Ras-related GTP-binding protein, pu...   110   5e-23
gi|12843097|dbj|BAB25858.1| unnamed protein product [Mus musculus]    110   5e-23
gi|421941|pir||S33160 GTP-binding protein, ras-related - common ...   110   5e-23
gi|12311682|emb|CAC24476.1| GTP binding protein [Cichorium intyb...   110   5e-23
gi|17137216|ref|NP_477170.1| CG5771-PB [Drosophila melanogaster]...   110   5e-23
gi|1362067|pir||S57478 GTP-binding protein GTP13 - garden pea >g...   110   5e-23
gi|47211161|emb|CAF92536.1| unnamed protein product [Tetraodon n...   109   6e-23
gi|4895063|gb|AAD32707.1| GTP-binding protein [Trypanosoma cruzi]     109   6e-23
gi|47210398|emb|CAF91320.1| unnamed protein product [Tetraodon n...   109   6e-23
gi|49069954|ref|XP_399266.1| hypothetical protein UM01651.1 [Ust...   109   6e-23
gi|17559536|ref|NP_507084.1| predicted CDS, GTP-binding protein ...   109   6e-23
gi|33695095|ref|NP_057215.2| ras-related GTP-binding protein RAB...   109   6e-23
gi|549809|sp|P36861|YPT2_VOLCA GTP-binding protein yptV2 >gnl|BL...   109   6e-23
gi|37788825|gb|AAP51290.1| Rab11-1a [Limulus polyphemus] >gnl|BL...   109   6e-23
gi|7438432|pir||T06447 GTP-binding protein - garden pea >gnl|BL_...   109   6e-23
gi|31227871|ref|XP_317956.1| ENSANGP00000022790 [Anopheles gambi...   109   8e-23
gi|27709432|ref|XP_229035.1| similar to Ras-related protein Rab-...   109   8e-23
gi|131803|sp|P10536|RB1B_RAT Ras-related protein Rab-1B >gnl|BL_...   109   8e-23
gi|11558649|emb|CAC17833.1| secretion related GTPase (SrgB) [Asp...   109   8e-23
gi|21313162|ref|NP_083852.1| RIKEN cDNA 1110011F09 [Mus musculus...   109   8e-23
gi|464524|sp|Q05974|RAB1_LYMST Ras-related protein Rab-1A >gnl|B...   109   8e-23
gi|3024505|sp|Q40522|R11D_TOBAC Ras-related protein Rab11D >gnl|...   109   8e-23
gi|7438373|pir||S72515 GTP-binding protein RAB1 - garden petunia...   109   8e-23
gi|48141271|ref|XP_397201.1| similar to ENSANGP00000011129 [Apis...   109   8e-23
gi|50258123|gb|EAL20817.1| hypothetical protein CNBE1790 [Crypto...   109   8e-23
gi|15219515|ref|NP_177505.1| Ras-related GTP-binding family prot...   109   8e-23
gi|23619341|ref|NP_705303.1| GTP-binding protein, putative [Plas...   109   8e-23
gi|50290439|ref|XP_447651.1| unnamed protein product [Candida gl...   109   8e-23
gi|47219207|emb|CAG11225.1| unnamed protein product [Tetraodon n...   109   8e-23
gi|45185452|ref|NP_983169.1| ABR220Wp [Eremothecium gossypii] >g...   109   8e-23
gi|23508648|ref|NP_701317.1| rab6 [Plasmodium falciparum 3D7] >g...   109   8e-23
gi|3024501|sp|Q40193|R11C_LOTJA Ras-related protein Rab11C >gnl|...   109   8e-23
gi|1370190|emb|CAA98172.1| RAB8A [Lotus corniculatus var. japoni...   109   8e-23
gi|24306110|gb|AAN52527.1| GTP-binding protein [Pichia angusta] ...   109   8e-23
gi|134236|sp|P20791|SAS2_DICDI GTP-binding protein SAS2 >gnl|BL_...   109   8e-23
gi|466171|sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 >gnl|BL_...   109   8e-23
gi|50553762|ref|XP_504292.1| YlRYL1 [Yarrowia lipolytica] >gnl|B...   109   8e-23
gi|32418088|ref|XP_329522.1| GTP-BINDING PROTEIN YPT1 [Neurospor...   109   8e-23
gi|38102602|gb|EAA49421.1| hypothetical protein MG01079.4 [Magna...   109   8e-23
gi|5738170|gb|AAD50282.1| putative intermediate compartment prot...   109   8e-23
gi|1370178|emb|CAA98166.1| RAB5A [Lotus corniculatus var. japoni...   109   8e-23
gi|49093914|ref|XP_408418.1| YPT1_NEUCR GTP-binding protein ypt1...   109   8e-23
gi|6010031|emb|CAB57219.1| GTP binding protein [Cichorium intybu...   109   8e-23
gi|47216652|emb|CAG04850.1| unnamed protein product [Tetraodon n...   109   8e-23
gi|37788823|gb|AAP51289.1| Rab11-1c [Limulus polyphemus]              109   8e-23
gi|27817324|emb|CAD61089.1| SI:zC101N13.3 (novel protein similar...   108   1e-22
gi|13569962|ref|NP_112243.1| RAB1B, member RAS oncogene family; ...   108   1e-22
gi|4758988|ref|NP_004152.1| RAB1A, member RAS oncogene family; R...   108   1e-22
gi|131787|sp|P05711|RB1A_RAT Ras-related protein Rab-1A >gnl|BL_...   108   1e-22
gi|6682935|dbj|BAA88954.1| Rab7 [Tetrahymena thermophila]             108   1e-22
gi|46138717|ref|XP_391049.1| YPT1_NEUCR GTP-binding protein ypt1...   108   1e-22
gi|131785|sp|P22125|RAB1_DISOM Ras-related protein ORAB-1 >gnl|B...   108   1e-22
gi|13385282|ref|NP_085031.1| RAB27b, member RAS oncogene family ...   108   1e-22
gi|48102358|ref|XP_395340.1| similar to ENSANGP00000023894 [Apis...   108   1e-22
gi|50738954|ref|XP_419342.1| PREDICTED: similar to ras-related p...   108   1e-22
gi|134228|sp|P20790|SAS1_DICDI GTP-binding protein SAS1 >gnl|BL_...   108   1e-22
gi|27924279|gb|AAH45014.1| Rab1-prov protein [Xenopus laevis] >g...   108   1e-22
gi|29789271|ref|NP_112354.1| RAB13 [Rattus norvegicus] >gnl|BL_O...   108   1e-22
gi|1616614|emb|CAA69701.1| small GTP-binding protein [Nicotiana ...   108   1e-22
gi|50259473|gb|EAL22146.1| hypothetical protein CNBC2840 [Crypto...   108   1e-22
gi|12311678|emb|CAC24474.1| GTP binding protein [Cichorium intyb...   108   1e-22
gi|46561764|gb|AAT01087.1| putative rab11 [Homalodisca coagulata]     108   1e-22
gi|49065350|emb|CAG38493.1| RAB1B [Homo sapiens]                      108   1e-22
gi|541980|pir||S41432 GTP-binding protein, ras-like (clone vfa-y...   108   1e-22
gi|50752910|ref|XP_413795.1| PREDICTED: similar to Ras-related p...   108   1e-22
gi|3024502|sp|Q40194|R11D_LOTJA Ras-related protein Rab11D >gnl|...   108   1e-22
gi|49257311|gb|AAH73168.1| RAB13 protein [Homo sapiens]               108   1e-22
gi|18422766|ref|NP_568678.1| Ras-related GTP-binding protein, pu...   108   1e-22
gi|11558500|emb|CAC17744.1| small GTP-binding protein YPTI [Hypo...   108   1e-22
gi|1053065|gb|AAA80679.1| small GTP-binding protein                   108   1e-22
gi|7438392|pir||T14391 GTP-binding protein homolog - turnip >gnl...   108   1e-22
gi|50291301|ref|XP_448083.1| unnamed protein product [Candida gl...   108   1e-22
gi|39595276|emb|CAE60313.1| Hypothetical protein CBG03904 [Caeno...   108   1e-22
gi|41152205|ref|NP_958486.1| RAB13, member RAS oncogene family [...   108   1e-22
gi|266879|sp|P29687|RAB5_TOBAC Ras-related protein Rab5 >gnl|BL_...   108   1e-22
gi|17507543|ref|NP_490675.1| RAB family member (23.4 kD) (rab-11...   108   1e-22
gi|12083645|ref|NP_073183.1| small GTP-binding protein rab5 [Rat...   108   1e-22
gi|50752811|ref|XP_413757.1| PREDICTED: similar to GTPase Rab8b ...   108   2e-22
gi|28828910|gb|AAO51496.1| similar to Mus musculus (Mouse). simi...   108   2e-22
gi|7533034|gb|AAF63333.1| YptA [Aspergillus awamori]                  108   2e-22
gi|15229836|ref|NP_187779.1| Ras-related GTP-binding protein, pu...   108   2e-22
gi|50370256|gb|AAH76054.1| Unknown (protein for MGC:92523) [Dani...   108   2e-22
gi|48096697|ref|XP_392500.1| similar to Ras-related protein Rab-...   108   2e-22
gi|283769|pir||A43958 GTP-binding protein, synaptic vesicle spec...   108   2e-22
gi|15236555|ref|NP_193486.1| Ras-related GTP-binding protein, pu...   108   2e-22
gi|16974365|gb|AAL31108.1| AT4g17530/dl4800c [Arabidopsis thaliana]   108   2e-22
gi|7438375|pir||H71444 GTP-binding protein - Arabidopsis thalian...   108   2e-22
gi|17506899|ref|NP_492481.1| RAB family member (22.8 kD) (rab-5)...   108   2e-22
gi|45185690|ref|NP_983406.1| ACR003Cp [Eremothecium gossypii] >g...   108   2e-22
gi|2133238|pir||S51495 GTP-binding protein RYL1 - yeast (Yarrowi...   108   2e-22
gi|49110379|ref|XP_411739.1| hypothetical protein AN7602.2 [Aspe...   108   2e-22
gi|6010033|emb|CAB57220.1| GTP binding protein [Cichorium intybu...   108   2e-22
gi|7438430|pir||T06445 GTP-binding protein - garden pea >gnl|BL_...   108   2e-22
gi|50728924|ref|XP_416347.1| PREDICTED: similar to dGTPase (EC 3...   108   2e-22
gi|15232652|ref|NP_190267.1| Ras-related protein (RAB11A) / smal...   108   2e-22
gi|131794|sp|P18066|RB5A_CANFA Ras-related protein Rab-5A >gnl|B...   108   2e-22
gi|19923262|ref|NP_004153.2| RAB5A, member RAS oncogene family; ...   108   2e-22
gi|13385374|ref|NP_080163.1| RAB5A, member RAS oncogene family [...   108   2e-22
gi|41469625|gb|AAS07348.1| putative GTP-binding protein [Oryza s...   107   2e-22
gi|6324236|ref|NP_014306.1| Involved in vacuolar protein sorting...   107   2e-22
gi|32766475|gb|AAH54969.1| MGC64433 protein [Xenopus laevis]          107   2e-22
gi|50405593|ref|XP_456433.1| unnamed protein product [Debaryomyc...   107   2e-22
gi|27066008|pdb|1N6H|A Chain A, Crystal Structure Of Human Rab5a...   107   2e-22
gi|30923579|gb|EAA46056.1| CG17515-PA [Drosophila melanogaster]       107   2e-22
gi|31204497|ref|XP_311197.1| ENSANGP00000019091 [Anopheles gambi...   107   2e-22
gi|227603|prf||1707300A guanine nucleotide binding protein            107   2e-22
gi|45383121|ref|NP_989856.1| rab5C-like protein [Gallus gallus] ...   107   2e-22
gi|47216650|emb|CAG04848.1| unnamed protein product [Tetraodon n...   107   2e-22
gi|27694927|gb|AAH43866.1| Rab5a-prov protein [Xenopus laevis]        107   2e-22
gi|420269|pir||B42148 GTP-binding protein rab10 - rat                 107   2e-22
gi|50604253|gb|AAH78133.1| Unknown (protein for MGC:84543) [Xeno...   107   2e-22
gi|42543204|pdb|1OIW|A Chain A, X-Ray Structure Of The Small G P...   107   3e-22
gi|47209142|emb|CAF90455.1| unnamed protein product [Tetraodon n...   107   3e-22
gi|15238852|ref|NP_199607.1| Ras-related GTP-binding family prot...   107   3e-22
gi|5729997|ref|NP_004154.2| RAB27B, member RAS oncogene family [...   107   3e-22
gi|31199429|ref|XP_308662.1| ENSANGP00000011129 [Anopheles gambi...   107   3e-22
gi|39597850|emb|CAE68542.1| Hypothetical protein CBG14372 [Caeno...   107   3e-22
gi|6324663|ref|NP_014732.1| Rab5-like GTPase involved in vacuola...   107   3e-22
gi|47213194|emb|CAF95985.1| unnamed protein product [Tetraodon n...   107   3e-22
gi|4506363|ref|NP_002861.1| RAB13, member RAS oncogene family; R...   107   3e-22
gi|33859608|ref|NP_035356.1| RAB19, member RAS oncogene family [...   107   3e-22
gi|3041721|sp|P35294|RB19_MOUSE Ras-related protein Rab-19 >gnl|...   107   3e-22
gi|15237828|ref|NP_200723.1| Ras-related GTP-binding protein, pu...   107   3e-22
gi|31209781|ref|XP_313857.1| ENSANGP00000024287 [Anopheles gambi...   107   3e-22
gi|12832758|dbj|BAB22245.1| unnamed protein product [Mus musculus]    107   3e-22
gi|37362623|ref|NP_009823.2| similar to Rab proteins and other s...   107   4e-22
gi|38303826|gb|AAH61984.1| Rab26 protein [Rattus norvegicus]          107   4e-22
gi|41055496|ref|NP_957436.1| similar to RAB1, member RAS oncogen...   107   4e-22
gi|32411557|ref|XP_326259.1| RAS-RELATED PROTEIN RAB1BV [Neurosp...   107   4e-22
gi|3024503|sp|Q40520|R11C_TOBAC Ras-related protein Rab11C >gnl|...   107   4e-22
gi|586381|sp|P38146|YP10_YEAST GTP-binding protein YPT10 >gnl|BL...   107   4e-22
gi|27807425|ref|NP_777163.1| RAB27B, member RAS oncogene family ...   107   4e-22
gi|28828965|gb|AAO51546.1| similar to RAS-related protein [Caeno...   107   4e-22
gi|49119014|gb|AAH72698.1| Rab0 protein [Rattus norvegicus]           107   4e-22
gi|46575955|gb|AAT01316.1| putative GTP-binding protein RIC2 [Or...   107   4e-22
gi|38110337|gb|EAA56073.1| hypothetical protein MG01724.4 [Magna...   107   4e-22
gi|131848|sp|P22128|RAB8_DISOM Ras-related protein Rab-8 (ORA2) ...   107   4e-22
gi|27066009|pdb|1N6I|A Chain A, Crystal Structure Of Human Rab5a...   107   4e-22
gi|27066016|pdb|1N6N|A Chain A, Crystal Structure Of Human Rab5a...   107   4e-22
gi|27066019|pdb|1N6P|A Chain A, Crystal Structure Of Human Rab5a...   107   4e-22
gi|27066018|pdb|1N6O|A Chain A, Crystal Structure Of Human Rab5a...   107   4e-22
gi|34910940|ref|NP_916817.1| putative GTP-binding protein [Oryza...   107   4e-22
gi|6755258|ref|NP_035355.1| RAB18, member RAS oncogene family [M...   107   4e-22
gi|10880989|ref|NP_067075.1| RAB18, member RAS oncogene family; ...   107   4e-22
gi|41056251|ref|NP_956417.1| Unknown (protein for MGC:63565); wu...   107   4e-22
gi|17737545|ref|NP_523970.1| CG7062-PA [Drosophila melanogaster]...   107   4e-22
gi|46193751|emb|CAG25544.1| putative Ras-related GTP-binding pro...   107   4e-22
gi|47086269|ref|NP_998050.1| hypothetical protein zgc:76978 [Dan...   107   4e-22
gi|17570221|ref|NP_508721.1| RAB family member (rab-37) [Caenorh...   107   4e-22
gi|1362064|pir||S57474 GTP-binding protein - garden pea >gnl|BL_...   107   4e-22
gi|29250860|gb|EAA42348.1| GLP_440_103492_104175 [Giardia lambli...   106   5e-22
gi|37360618|dbj|BAC98287.1| mKIAA3012 protein [Mus musculus]          106   5e-22
gi|48103887|ref|XP_392903.1| similar to RAB18, member RAS oncoge...   106   5e-22
gi|34068436|gb|AAQ56773.1| ras-related GTP-binding protein Rab18...   106   5e-22
gi|103724|pir||B38625 GTP-binding protein ora2 - electric ray (D...   106   5e-22
gi|4741844|gb|AAD28731.1| small GTP-binding protein [Triticum ae...   106   5e-22
gi|50550177|ref|XP_502561.1| hypothetical protein [Yarrowia lipo...   106   5e-22
gi|47224370|emb|CAG09216.1| unnamed protein product [Tetraodon n...   106   5e-22
gi|28628539|gb|AAO49245.1| GTPase Rab11-like protein [Giardia in...   106   5e-22
gi|46435716|gb|EAK95092.1| hypothetical protein CaO19.8221 [Cand...   106   5e-22
gi|47937791|gb|AAH72360.1| MGC83515 protein [Xenopus laevis]          106   5e-22
gi|49250515|gb|AAH74609.1| Unknown (protein for MGC:69471) [Xeno...   106   5e-22
gi|15235113|ref|NP_193699.1| Ras-related GTP-binding protein, pu...   106   5e-22
gi|23463313|ref|NP_695229.1| GTPase Rab8b [Rattus norvegicus] >g...   106   5e-22
gi|7706563|ref|NP_057614.1| RAB8B, member RAS oncogene family; R...   106   5e-22
gi|21489995|ref|NP_659562.1| GTP-binding protein Rab0 [Rattus no...   106   5e-22
gi|19526850|ref|NP_598446.1| Rab31-like [Mus musculus] >gnl|BL_O...   106   5e-22
gi|39582824|emb|CAE71600.1| Hypothetical protein CBG18559 [Caeno...   106   5e-22
gi|13537449|dbj|BAB40679.1| small GTPase Rab11C [Entamoeba histo...   106   5e-22
gi|41148993|ref|XP_372086.1| similar to RAB1B, member RAS oncoge...   106   7e-22
gi|34864862|ref|XP_216895.2| similar to Ras-related protein Rab-...   106   7e-22
gi|24648682|ref|NP_732610.1| CG3320-PA [Drosophila melanogaster]...   106   7e-22
gi|47223089|emb|CAG07176.1| unnamed protein product [Tetraodon n...   106   7e-22
gi|17555956|ref|NP_499454.1| RAB family member (23.4 kD) (rab-35...   106   7e-22


>gi|25149700|ref|NP_495318.2| small GTP-binding proteins rab-like
           (30.0 kD) (2G815) [Caenorhabditis elegans]
 gi|20198800|gb|AAA81090.2| Hypothetical protein C56E6.2
           [Caenorhabditis elegans]
          Length = 266

 Score =  516 bits (1329), Expect = e-145
 Identities = 260/266 (97%), Positives = 260/266 (97%)
 Frame = +1

Query: 1   MQVLRQLPHQHQLAXXXXXXCDIKSIYASEKVREAIRDHEQTIATSTAPKHKAKVVVLGD 180
           MQVLRQLPHQHQLA      CDIKSIYASEKVREAIRDHEQTIATSTAPKHKAKVVVLGD
Sbjct: 1   MQVLRQLPHQHQLASSPSSSCDIKSIYASEKVREAIRDHEQTIATSTAPKHKAKVVVLGD 60

Query: 181 SGVGKTSIIYRHRYGAHYRPVNATIGASFVSFDVGADYRDREDVVRLQVWDTAGQERFRC 360
           SGVGKTSIIYRHRYGAHYRPVNATIGASFVSFDVGADYRDREDVVRLQVWDTAGQERFRC
Sbjct: 61  SGVGKTSIIYRHRYGAHYRPVNATIGASFVSFDVGADYRDREDVVRLQVWDTAGQERFRC 120

Query: 361 MVPMYMRNADAALIVYDVTDRNTFEDVEKWLKDLDRSSGTEDANVYLIGNKTDLVEKREV 540
           MVPMYMRNADAALIVYDVTDRNTFEDVEKWLKDLDRSSGTEDANVYLIGNKTDLVEKREV
Sbjct: 121 MVPMYMRNADAALIVYDVTDRNTFEDVEKWLKDLDRSSGTEDANVYLIGNKTDLVEKREV 180

Query: 541 TEAEGKAMAAKINAKFFELSNDQPNLFAAILSELSDDVLQSRQESSEKKTDLQLIRKEKV 720
           TEAEGKAMAAKINAKFFELSNDQPNLFAAILSELSDDVLQSRQESSEKKTDLQLIRKEKV
Sbjct: 181 TEAEGKAMAAKINAKFFELSNDQPNLFAAILSELSDDVLQSRQESSEKKTDLQLIRKEKV 240

Query: 721 SLGDDKFEDNPNIQLKIQKSKCCSML 798
           SLGDDKFEDNPNIQLKIQKSKCCSML
Sbjct: 241 SLGDDKFEDNPNIQLKIQKSKCCSML 266




[DB home][top]