Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C55B7_6
(1041 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17506237|ref|NP_491872.1| protein tyrosine phosphatase recept... 706 0.0
gi|17506573|ref|NP_492647.1| predicted CDS, receptor-type protei... 689 0.0
gi|39591757|emb|CAE71335.1| Hypothetical protein CBG18235 [Caeno... 587 e-166
gi|39583064|emb|CAE60604.1| Hypothetical protein CBG04241 [Caeno... 467 e-130
gi|17511089|ref|NP_491758.1| predicted CDS, protein-tyrosine pho... 451 e-125
gi|39589704|emb|CAE66939.1| Hypothetical protein CBG12331 [Caeno... 449 e-125
gi|17541250|ref|NP_501766.1| protein tyrosine phosphatase non-re... 416 e-115
gi|25529542|pir||G88793 protein K07F5.8 [imported] - Caenorhabdi... 415 e-114
gi|17539010|ref|NP_501293.1| predicted CDS, protein tyrosine pho... 336 5e-91
gi|39584737|emb|CAE67632.1| Hypothetical protein CBG13187 [Caeno... 224 3e-57
gi|17507415|ref|NP_491275.1| protein tyrosine phosphatase family... 222 1e-56
gi|17507405|ref|NP_491278.1| CD45 family member (1E541) [Caenorh... 222 1e-56
gi|17538406|ref|NP_500718.1| tyrosine phosphatase family member ... 221 3e-56
gi|39584102|emb|CAE61477.1| Hypothetical protein CBG05371 [Caeno... 221 3e-56
gi|17540214|ref|NP_500756.1| tyrosine phosphatase family member ... 219 6e-56
gi|17538678|ref|NP_501041.1| protein tyrosine phosphatase family... 219 8e-56
gi|17507417|ref|NP_491276.1| hemopoietic cell phosphatase family... 217 3e-55
gi|39595749|emb|CAE67252.1| Hypothetical protein CBG12692 [Caeno... 213 4e-54
gi|47270756|gb|AAB52361.2| Hypothetical protein F47B3.6 [Caenorh... 213 4e-54
gi|39582941|emb|CAE73006.1| Hypothetical protein CBG20357 [Caeno... 208 1e-52
gi|39580808|emb|CAE58977.1| Hypothetical protein CBG02250 [Caeno... 203 6e-51
gi|39595369|emb|CAE60407.1| Hypothetical protein CBG04012 [Caeno... 193 6e-48
gi|17544560|ref|NP_500775.1| protein tyrosine phosphatase family... 192 1e-47
gi|31746552|gb|AAB42298.2| Hypothetical protein T27A3.5 [Caenorh... 184 3e-45
gi|17505300|ref|NP_491722.1| predicted CDS, protein tyrosine pho... 179 1e-43
gi|47270778|gb|AAB52456.2| Hypothetical protein B0207.1 [Caenorh... 179 1e-43
gi|39586013|emb|CAE69089.1| Hypothetical protein CBG15108 [Caeno... 175 1e-42
gi|39580978|emb|CAE72948.1| Hypothetical protein CBG20279 [Caeno... 174 2e-42
gi|17556034|ref|NP_497499.1| receptor protein tyrosine phosphata... 174 4e-42
gi|17509277|ref|NP_491761.1| tyrosine specific protein phosphata... 173 5e-42
gi|32699194|gb|AAP86612.1| Hypothetical protein Y48G9A.9b [Caeno... 171 2e-41
gi|39588439|emb|CAE72790.1| Hypothetical protein CBG20059 [Caeno... 170 4e-41
gi|17540192|ref|NP_502058.1| predicted CDS, protein tyrosine pho... 169 7e-41
gi|39585173|emb|CAE57416.1| Hypothetical protein CBG00373 [Caeno... 166 1e-39
gi|17509155|ref|NP_492194.1| protein tyrosine phosphatase family... 164 4e-39
gi|17510459|ref|NP_491071.1| protein tyrosine phosphatase family... 162 9e-39
gi|39595787|emb|CAE67290.1| Hypothetical protein CBG12739 [Caeno... 158 2e-37
gi|41054954|ref|NP_956760.1| hypothetical protein MGC63623 [Dani... 158 2e-37
gi|17541540|ref|NP_499934.1| protein tyrosine phosphatase family... 158 2e-37
gi|39595765|emb|CAE67268.1| Hypothetical protein CBG12715 [Caeno... 154 3e-36
gi|45382183|ref|NP_990762.1| phosphotyrosyl phosphatase [Gallus ... 152 9e-36
gi|42542909|gb|AAH66385.1| Ptpn12 protein [Danio rerio] 152 9e-36
gi|41054756|ref|NP_956963.1| protein tyrosine phosphatase, non-r... 152 9e-36
gi|39584405|emb|CAE72543.1| Hypothetical protein CBG19727 [Caeno... 152 1e-35
gi|22022291|dbj|BAC06501.1| CD45 [Eptatretus stoutii] 150 5e-35
gi|930104|emb|CAA38070.1| protein-tyrosine phosphatase [Homo sap... 149 8e-35
gi|6094682|gb|AAF03527.1| receptor-type protein tyrosine phospha... 149 8e-35
gi|4506329|ref|NP_002842.1| protein tyrosine phosphatase, recept... 149 8e-35
gi|300182|gb|AAB26530.1| receptor-type protein tyrosine phosphat... 149 8e-35
gi|6981448|ref|NP_037212.1| protein tyrosine phosphatase, recept... 149 1e-34
gi|34854925|ref|XP_346696.1| hypothetical protein XP_346695 [Rat... 149 1e-34
gi|22022295|dbj|BAC06503.1| CD45 [Eptatretus stoutii] 149 1e-34
gi|112238|pir||A40169 protein-tyrosine-phosphatase (EC 3.1.3.48)... 149 1e-34
gi|22022289|dbj|BAC06500.1| CD45 [Eptatretus stoutii] 149 1e-34
gi|22022293|dbj|BAC06502.1| CD45 [Eptatretus stoutii] 149 1e-34
gi|47682858|gb|AAH70850.1| MGC84589 protein [Xenopus laevis] 148 2e-34
gi|17507651|ref|NP_491657.1| protein tyrosine phosphatase family... 148 2e-34
gi|47212466|emb|CAG12148.1| unnamed protein product [Tetraodon n... 148 2e-34
gi|17544616|ref|NP_500806.1| protein tyrosine phosphatase (4G174... 148 2e-34
gi|17506837|ref|NP_492454.1| protein tyrosine phosphatase family... 148 2e-34
gi|24640857|ref|NP_727356.1| CG32697-PC [Drosophila melanogaster... 147 3e-34
gi|47221567|emb|CAF97832.1| unnamed protein product [Tetraodon n... 147 3e-34
gi|24640860|ref|NP_727357.1| CG32697-PB [Drosophila melanogaster... 147 3e-34
gi|39587423|emb|CAE75077.1| Hypothetical protein CBG22995 [Caeno... 147 3e-34
gi|18858107|ref|NP_572576.1| CG32697-PA [Drosophila melanogaster... 147 3e-34
gi|24640862|ref|NP_727358.1| CG32697-PD [Drosophila melanogaster... 147 3e-34
gi|22022307|dbj|BAC06504.1| CD45 [Eptatretus stoutii] 147 5e-34
gi|8885504|dbj|BAA97445.1| receptor-type protein tyrosine phosph... 145 1e-33
gi|17541230|ref|NP_501863.1| protein tyrosine phosphatase, recep... 145 2e-33
gi|6679559|ref|NP_033007.1| protein tyrosine phosphatase, recept... 145 2e-33
gi|2144456|pir||JC1368 protein-tyrosine-phosphatase (EC 3.1.3.48... 144 3e-33
gi|18375652|ref|NP_002826.2| protein tyrosine phosphatase, non-r... 144 3e-33
gi|37674431|gb|AAQ96881.1| unknown [Homo sapiens] 144 3e-33
gi|18860898|ref|NP_002832.2| protein tyrosine phosphatase, recep... 144 3e-33
gi|1263069|gb|AAC50439.1| receptor tyrosine phosphatase gamma >g... 144 3e-33
gi|477137|pir||A48148 protein-tyrosine-phosphatase (EC 3.1.3.48)... 144 3e-33
gi|25281969|gb|AAN72430.1| receptor-like protein tyrosine phosph... 144 3e-33
gi|47086727|ref|NP_997819.1| Unknown (protein for MGC:76973); wu... 144 3e-33
gi|29789369|ref|NP_599183.1| protein tyrosine phosphatase, recep... 144 3e-33
gi|31243219|ref|XP_322055.1| ENSANGP00000004166 [Anopheles gambi... 144 3e-33
gi|25281971|gb|AAN72431.1| receptor-like protein tyrosine phosph... 144 3e-33
gi|44890380|gb|AAH66698.1| Unknown (protein for MGC:76973) [Dani... 144 3e-33
gi|39585712|emb|CAE59914.1| Hypothetical protein CBG03399 [Caeno... 144 4e-33
gi|41053929|ref|NP_956254.1| protein tyrosine phosphatase, non-r... 144 4e-33
gi|31207081|ref|XP_312507.1| ENSANGP00000001164 [Anopheles gambi... 144 4e-33
gi|34328195|ref|NP_035333.2| protein tyrosine phosphatase, non-r... 143 6e-33
gi|45382391|ref|NP_990206.1| non-receptor protein tyrosine phosp... 143 6e-33
gi|35794|emb|CAA38067.1| protein-tyrosine phosphatase [Homo sapi... 143 7e-33
gi|41055194|ref|NP_956748.1| hypothetical protein MGC63553 [Dani... 142 1e-32
gi|7435157|pir||JW0049 protein-tyrosine-phosphatase (EC 3.1.3.48... 142 1e-32
gi|2117999|pir||S55345 protein-tyrosine-phosphatase (EC 3.1.3.48... 142 1e-32
gi|1346902|sp|P35831|PTNC_MOUSE Protein-tyrosine phosphatase, no... 142 1e-32
gi|39583734|emb|CAE63838.1| Hypothetical protein CBG08394 [Caeno... 142 1e-32
gi|16923960|ref|NP_476456.1| protein tyrosine phosphatase, non-r... 142 1e-32
gi|45383516|ref|NP_989645.1| protein tyrosine phosphatase, recep... 142 2e-32
gi|14488467|pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Com... 141 2e-32
gi|6729771|pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh 141 2e-32
gi|4506289|ref|NP_002818.1| protein tyrosine phosphatase, non-re... 141 2e-32
gi|809208|pdb|2HNP| Protein-Tyrosine Phosphatase 1b (Human) (E.... 141 2e-32
gi|37927867|pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine... 141 2e-32
gi|30584229|gb|AAP36363.1| Homo sapiens protein tyrosine phospha... 141 2e-32
gi|9588103|emb|CAC00618.1| dJ530I15.1 (protein tyrosine phosphat... 141 2e-32
gi|6729926|pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human... 141 3e-32
gi|2507225|sp|P35821|PTN1_MOUSE Protein-tyrosine phosphatase, no... 141 3e-32
gi|6729770|pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Comp... 141 3e-32
gi|49256084|gb|AAH74171.1| Unknown (protein for MGC:81984) [Xeno... 141 3e-32
gi|7546544|pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyro... 140 4e-32
gi|21465993|pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Compl... 140 4e-32
gi|47214005|emb|CAG01518.1| unnamed protein product [Tetraodon n... 140 4e-32
gi|50728053|ref|XP_415970.1| PREDICTED: similar to protein tyros... 140 6e-32
gi|1079313|pir||A55651 protein-tyrosine-phosphatase (EC 3.1.3.48... 139 8e-32
gi|49118658|gb|AAH73687.1| Ptp-2 protein [Xenopus laevis] 139 8e-32
gi|50507786|emb|CAH04747.1| Hypothetical protein R09E10.9 [Caeno... 139 8e-32
gi|17541854|ref|NP_501894.1| protein tyrosine phosphatase family... 139 8e-32
gi|6981442|ref|NP_036769.1| protein tyrosine phosphatase, non-re... 139 1e-31
gi|22219272|pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex Wi... 139 1e-31
gi|7305133|ref|NP_038573.1| hemopoietic cell phosphatase [Mus mu... 139 1e-31
gi|21903454|sp|P29351|PTN6_MOUSE Protein-tyrosine phosphatase, n... 139 1e-31
gi|15215088|gb|AAH12660.1| Hemopoietic cell phosphatase [Mus mus... 139 1e-31
gi|4097668|gb|AAD00151.1| SH2 phosphatase 1 [Mus musculus] 139 1e-31
gi|2289909|gb|AAC36008.1| PTPN6 [Mus musculus] 139 1e-31
gi|50759255|ref|XP_417590.1| PREDICTED: similar to Hypothetical ... 139 1e-31
gi|49118310|gb|AAH73317.1| Unknown (protein for MGC:80720) [Xeno... 138 2e-31
gi|25148564|ref|NP_500211.2| protein tyrosine phosphatase family... 138 2e-31
gi|2499753|sp|Q15262|PTPK_HUMAN Receptor-type protein-tyrosine p... 138 2e-31
gi|13096596|pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyr... 138 2e-31
gi|18860902|ref|NP_002835.2| protein tyrosine phosphatase, recep... 138 2e-31
gi|28629201|gb|AAO49502.1| mutant receptor type protein tyrosine... 138 2e-31
gi|1479976|gb|AAC37599.1| protein tyrosine phosphatase [Homo sap... 138 2e-31
gi|50743033|ref|XP_419748.1| PREDICTED: similar to protein tyros... 138 2e-31
gi|31206259|ref|XP_312081.1| ENSANGP00000016184 [Anopheles gambi... 138 2e-31
gi|91245|pir||JN0317 protein-tyrosine-phosphatase (EC 3.1.3.48),... 137 3e-31
gi|2914480|pdb|1PTY| Crystal Structure Of Protein Tyrosine Phos... 137 3e-31
gi|2981942|pdb|1AAX| Crystal Structure Of Protein Tyrosine Phos... 137 3e-31
gi|1827883|pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyro... 137 3e-31
gi|15825777|pdb|1I57|A Chain A, Crystal Structure Of Apo Human P... 137 3e-31
gi|45384450|ref|NP_990299.1| cSH-PTP2 [Gallus gallus] >gnl|BL_OR... 137 4e-31
gi|7766808|pdb|1C86|A Chain A, Crystal Structure Of Protein Tyro... 137 4e-31
gi|33357677|pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cystein... 137 4e-31
gi|91246|pir||JH0609 protein-tyrosine-phosphatase (EC 3.1.3.48) ... 137 4e-31
gi|9256882|pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant ... 137 5e-31
gi|31240897|ref|XP_320862.1| ENSANGP00000019140 [Anopheles gambi... 137 5e-31
gi|30353785|gb|AAH51651.1| PTPRM protein [Homo sapiens] 137 5e-31
gi|1827881|pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyro... 137 5e-31
gi|34810874|pdb|1PA1|A Chain A, Crystal Structure Of The C215d M... 137 5e-31
gi|50736546|ref|XP_419126.1| PREDICTED: similar to protein tyros... 137 5e-31
gi|16758788|ref|NP_446360.1| protein tyrosine phosphatase, non-r... 136 7e-31
gi|338080|gb|AAA36610.1| tyrosine phosphatase 136 7e-31
gi|557900|gb|AAA82880.1| protein tyrosine phosphatase 1C 136 7e-31
gi|18104989|ref|NP_002822.2| protein tyrosine phosphatase, non-r... 136 7e-31
gi|18104991|ref|NP_536858.1| protein tyrosine phosphatase, non-r... 136 7e-31
gi|5822080|pdb|1GWZ| Crystal Structure Of The Catalytic Domain ... 136 7e-31
gi|39726084|gb|AAR29979.1| protein tyrosine phosphatase [Cotesia... 136 7e-31
gi|557899|gb|AAA82879.1| protein tyrosine phosphatase 1C 136 7e-31
gi|1732418|gb|AAB51322.1| protein tyrosine phosphatase 1C [Homo ... 136 7e-31
gi|32451801|gb|AAH54648.1| Protein tyrosine phosphatase 1b [Dani... 136 7e-31
gi|18859293|ref|NP_570999.1| protein tyrosine phosphatase 1b [Da... 136 7e-31
gi|30584457|gb|AAP36481.1| Homo sapiens protein tyrosine phospha... 136 7e-31
gi|18104993|ref|NP_536859.1| protein tyrosine phosphatase, non-r... 136 7e-31
gi|5825608|gb|AAD53317.1| 70 kDa SHP-1L protein [Homo sapiens] 136 7e-31
gi|4519425|dbj|BAA02740.2| protein-tyrosine phosphatase [Homo sa... 136 7e-31
gi|33356177|ref|NP_002825.3| protein tyrosine phosphatase, non-r... 136 7e-31
gi|37590688|gb|AAH59278.1| Ptpn11 protein [Mus musculus] 136 7e-31
gi|29351615|gb|AAH49294.1| Ptp1b protein [Danio rerio] 136 7e-31
gi|47124685|gb|AAH70580.1| MGC81077 protein [Xenopus laevis] 136 7e-31
gi|29726784|pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b C... 136 9e-31
gi|5738203|gb|AAD50295.1| receptor protein tyrosine phosphatase ... 136 9e-31
gi|7684355|dbj|BAA95199.1| ryPTPN6c [Potamotrygon motoro] 135 1e-30
gi|6755228|ref|NP_035332.1| protein tyrosine phosphatase, non-re... 135 1e-30
gi|7106471|dbj|BAA92179.1| CD45 [Cyprinus carpio] 135 1e-30
gi|464495|sp|P35235|PTNB_MOUSE Protein-tyrosine phosphatase, non... 135 1e-30
gi|6981444|ref|NP_037220.1| protein tyrosine phosphatase, non-re... 135 1e-30
gi|3123258|sp|P41499|PTNB_RAT Protein-tyrosine phosphatase, non-... 135 1e-30
gi|13378308|gb|AAK18742.1| brain RPTPmam4 isoform II [Mus musculus] 135 2e-30
gi|48762924|ref|NP_008981.3| protein tyrosine phosphatase, recep... 135 2e-30
gi|50872127|ref|NP_035331.2| protein tyrosine phosphatase, non-r... 135 2e-30
gi|33112429|sp|Q99M80|PTPT_MOUSE Receptor-type protein-tyrosine ... 135 2e-30
gi|48762922|ref|NP_573400.2| protein tyrosine phosphatase, recep... 135 2e-30
gi|33112420|sp|O14522|PTPT_HUMAN Receptor-type protein-tyrosine ... 135 2e-30
gi|10946856|ref|NP_067439.1| protein tyrosine phosphatase, recep... 135 2e-30
gi|3355583|emb|CAA19666.1| dJ707K17.1 (Protein tyrosine phosphat... 135 2e-30
gi|27529712|dbj|BAA22952.2| KIAA0283 [Homo sapiens] 135 2e-30
gi|9049512|gb|AAF82401.1| receptor-like protein tyrosine phospha... 135 2e-30
gi|48096511|ref|XP_394701.1| similar to CG32697-PA [Apis mellifera] 135 2e-30
gi|628027|pir||A53593 protein-tyrosine-phosphatase (EC 3.1.3.48)... 134 3e-30
gi|24663403|ref|NP_524048.2| CG10975-PA [Drosophila melanogaster... 134 3e-30
gi|28574507|ref|NP_788502.1| CG10975-PB [Drosophila melanogaster... 134 3e-30
gi|3318983|pdb|1A5Y| Protein Tyrosine Phosphatase 1b Cysteinyl-... 134 3e-30
gi|37791449|gb|AAR03705.1| protein tyrosine phosphatase PTP-PEST... 134 3e-30
gi|38524401|dbj|BAD02401.1| protein tyrosine phosphatase e [Oryz... 134 3e-30
gi|38524406|dbj|BAD02404.1| protein tyrosine phosphatase e [Oryz... 134 3e-30
gi|3114491|pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine P... 134 3e-30
gi|131569|sp|P28827|PTPM_HUMAN Receptor-type protein-tyrosine ph... 134 3e-30
gi|228097|prf||1717216B receptor-like Tyr phosphatase 134 3e-30
gi|18860904|ref|NP_002836.2| protein tyrosine phosphatase, recep... 134 3e-30
gi|34861151|ref|XP_341951.1| Protein tyrosine phosphatase, recep... 134 4e-30
gi|2190301|dbj|BAA20333.1| protein tyrosine phosphatase epsilon ... 134 4e-30
gi|29789375|ref|NP_612516.1| protein tyrosine phosphatase, recep... 133 6e-30
gi|56561|emb|CAA68274.1| L-CA variant 2 [Rattus norvegicus] 133 6e-30
gi|56560|emb|CAA68273.1| L-CA variant 3 [Rattus norvegicus] 133 6e-30
gi|41399289|gb|AAS06902.1| CD45 [Aotus nancymaae] 133 6e-30
gi|116008|sp|P04157|CD45_RAT Leukocyte common antigen variant 4 ... 133 6e-30
gi|90254|pir||A28334 protein-tyrosine-phosphatase (EC 3.1.3.48) ... 133 6e-30
gi|198917|gb|AAA39459.1| lymphocyte common antigen 133 6e-30
gi|39596883|emb|CAE59110.1| Hypothetical protein CBG02405 [Caeno... 133 6e-30
gi|50414509|gb|AAH77741.1| Unknown (protein for MGC:78881) [Xeno... 133 6e-30
gi|41054133|ref|NP_956140.1| protein tyrosine phosphatase, non-r... 133 6e-30
gi|34281|emb|CAA68669.1| unnamed protein product [Homo sapiens] 133 6e-30
gi|28416331|gb|AAO42638.1| RE52018p [Drosophila melanogaster] 133 6e-30
gi|6755244|ref|NP_035340.1| protein tyrosine phosphatase, recept... 133 6e-30
gi|56562|emb|CAA68275.1| L-CA variant 1 [Rattus norvegicus] 133 6e-30
gi|26343963|dbj|BAC35638.1| unnamed protein product [Mus musculus] 133 6e-30
gi|50752652|ref|XP_413696.1| PREDICTED: similar to Protein-tyros... 133 6e-30
gi|11382546|pir||TDRTLT leukocyte common antigen precursor, spli... 133 6e-30
gi|7439347|pir||JC6312 protein-tyrosine-phosphatase (EC 3.1.3.48... 133 8e-30
gi|118913|sp|P16620|PTP6_DROME Protein-tyrosine phosphatase DPTP... 133 8e-30
gi|7684353|dbj|BAA95198.1| ryPTPN6b [Potamotrygon motoro] 133 8e-30
gi|280853|pir||A60345 protein-tyrosine-phosphatase (EC 3.1.3.48)... 133 8e-30
gi|13276131|emb|CAC33882.1| receptor protein tyrosine phosphatas... 133 8e-30
gi|158645|gb|AAA28952.1| receptor-linked protein tyrosine phosph... 132 1e-29
gi|125977|sp|P16621|LAR_DROME Protein-tyrosine phosphatase Lar p... 132 1e-29
gi|24585307|ref|NP_523604.2| CG10443-PA [Drosophila melanogaster... 132 1e-29
gi|18641362|ref|NP_563578.1| protein tyrosine phosphatase, recep... 132 1e-29
gi|4506291|ref|NP_002819.1| protein tyrosine phosphatase, non-re... 132 1e-29
gi|88523|pir||A33899 protein-tyrosine-phosphatase (EC 3.1.3.48),... 132 1e-29
gi|47217901|emb|CAG05023.1| unnamed protein product [Tetraodon n... 132 1e-29
gi|18104982|ref|NP_536348.1| protein tyrosine phosphatase, non-r... 132 1e-29
gi|15292281|gb|AAK93409.1| LD45391p [Drosophila melanogaster] 132 1e-29
gi|1127579|gb|AAC52331.1| epsilon tyrosine phosphatase cytoplasm... 132 1e-29
gi|24641350|ref|NP_511127.2| CG1817-PC [Drosophila melanogaster]... 132 1e-29
gi|4558223|pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 >gnl|B... 132 1e-29
gi|10999057|gb|AAD15273.2| T200 leukocyte common antigen precurs... 132 1e-29
gi|21465994|pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphat... 132 1e-29
gi|18104980|ref|NP_536347.1| protein tyrosine phosphatase, non-r... 132 1e-29
gi|18641347|ref|NP_002829.2| protein tyrosine phosphatase, recep... 132 1e-29
gi|539627|pir||A46546 leukocyte common antigen long splice form ... 132 1e-29
gi|20455509|sp|P35992|PTP1_DROME Protein-tyrosine phosphatase 10... 132 1e-29
gi|157296|gb|AAA28484.1| protein-tyrosine phosphatase 132 1e-29
gi|24641348|ref|NP_727544.1| CG1817-PB [Drosophila melanogaster]... 132 1e-29
gi|18641364|ref|NP_563579.1| protein tyrosine phosphatase, recep... 132 1e-29
gi|13399465|pdb|1FPR|A Chain A, Crystal Structure Of The Complex... 132 1e-29
gi|31543531|ref|NP_035342.2| protein tyrosine phosphatase, recep... 132 1e-29
gi|2507226|sp|P49446|PTPE_MOUSE Protein-tyrosine phosphatase eps... 132 1e-29
gi|1199933|dbj|BAA11927.1| protein tyrosine phosphatase epsilon ... 132 1e-29
gi|7439344|pir||JC6132 protein-tyrosine-phosphatase (EC 3.1.3.48... 132 1e-29
gi|4506301|ref|NP_002824.1| protein tyrosine phosphatase, non-re... 132 1e-29
gi|5729993|ref|NP_006495.1| protein tyrosine phosphatase, recept... 132 1e-29
gi|50728336|ref|XP_416095.1| PREDICTED: similar to Protein-tyros... 132 1e-29
gi|15866730|emb|CAC86583.1| tyrosine phosphatase epsilon [Homo s... 132 1e-29
gi|18860859|ref|NP_569119.1| protein tyrosine phosphatase, recep... 132 1e-29
gi|47940438|gb|AAH71574.1| PTPN9 protein [Homo sapiens] 132 1e-29
gi|47124687|gb|AAH70582.1| MGC81122 protein [Xenopus laevis] 132 1e-29
gi|19171239|emb|CAD23182.1| tyrosine phosphatase epsilon PD1 [Ho... 132 1e-29
gi|7525122|gb|AAD34158.4| receptor protein tyrosine phosphatase-... 132 2e-29
gi|6679561|ref|NP_033009.1| protein tyrosine phosphatase, recept... 132 2e-29
gi|50414825|gb|AAH77326.1| LOC397709 protein [Xenopus laevis] 132 2e-29
gi|11275231|pir||T43148 probable protein-tyrosine-phosphatase (E... 132 2e-29
gi|103342|pir||D41214 protein-tyrosine-phosphatase (EC 3.1.3.48)... 131 2e-29
gi|28436889|gb|AAH47086.1| Ptprb protein [Mus musculus] 131 2e-29
gi|16758896|ref|NP_446442.1| protein tyrosine phosphatase, non-r... 131 2e-29
gi|103341|pir||C41214 protein-tyrosine-phosphatase (EC 3.1.3.48)... 131 2e-29
gi|23618914|ref|NP_084204.1| protein tyrosine phosphatase, recep... 131 2e-29
gi|34863475|ref|XP_236280.2| similar to Protein-tyrosine phospha... 131 2e-29
gi|48094922|ref|XP_392208.1| similar to receptor-linked protein ... 131 2e-29
gi|45479860|gb|AAS06901.1| CD45 [Aotus nigriceps] 131 3e-29
gi|627275|pir||B53978 protein-tyrosine-phosphatase (EC 3.1.3.48)... 131 3e-29
gi|27696700|gb|AAH43621.1| MGC52584 protein [Xenopus laevis] 131 3e-29
gi|6679563|ref|NP_033010.1| protein tyrosine phosphatase, recept... 131 3e-29
gi|4249550|dbj|BAA74951.1| phosphotyrosyl protein phosphatase [R... 131 3e-29
gi|45383331|ref|NP_989748.1| protein tyrosine phosphatase, recep... 130 4e-29
gi|47223076|emb|CAG07163.1| unnamed protein product [Tetraodon n... 130 4e-29
gi|14198420|gb|AAH08269.1| Ptpn2 protein [Mus musculus] >gnl|BL_... 130 4e-29
gi|41399291|gb|AAS06903.1| CD45 [Aotus vociferans] 130 4e-29
gi|6679553|ref|NP_033003.1| protein tyrosine phosphatase, non-re... 130 4e-29
gi|8886021|gb|AAF80346.1| receptor-type protein tyrosine phospha... 130 5e-29
gi|47214899|emb|CAG01030.1| unnamed protein product [Tetraodon n... 130 5e-29
gi|17553080|ref|NP_498458.1| tyrosine phosphatase family member ... 130 5e-29
gi|34864869|ref|XP_235156.2| similar to vascular endothelial pro... 130 5e-29
gi|8919952|emb|CAB96212.1| CD45 [Takifugu rubripes] 130 5e-29
gi|8919950|emb|CAB96211.1| CD45 [Takifugu rubripes] 130 5e-29
gi|25092609|ref|NP_035348.1| protein tyrosine phosphatase, recep... 130 6e-29
gi|1083771|pir||A48758 protein-tyrosine-phosphatase (EC 3.1.3.48... 130 6e-29
gi|1085568|pir||S46217 protein-tyrosine-phosphatase (EC 3.1.3.48... 130 6e-29
gi|9507011|ref|NP_062013.1| protein tyrosine phosphatase, recept... 130 6e-29
gi|1083772|pir||B48758 protein-tyrosine-phosphatase (EC 3.1.3.48... 130 6e-29
gi|39597360|emb|CAE59588.1| Hypothetical protein CBG02994 [Caeno... 130 6e-29
gi|310202|gb|AAA75407.1| receptor-linked protein tyrosine phosph... 130 6e-29
gi|2118906|pir||I58148 protein-tyrosine-phosphatase (EC 3.1.3.48... 130 6e-29
gi|440973|gb|AAB28877.1| receptor protein tyrosine phosphatase-s... 130 6e-29
gi|310204|gb|AAA50568.1| receptor-linked protein tyrosine phosph... 130 6e-29
gi|18859295|ref|NP_571963.1| protein tyrosine phosphatase, recep... 130 6e-29
gi|31418511|gb|AAH53017.1| Unknown (protein for MGC:62214) [Mus ... 129 8e-29
gi|2144715|pir||I38670 protein-tyrosine-phosphatase (EC 3.1.3.48... 129 8e-29
gi|1685075|gb|AAB36687.1| density enhanced phosphatase-1 129 8e-29
gi|18860900|ref|NP_002834.2| protein tyrosine phosphatase, recep... 129 8e-29
gi|633073|dbj|BAA07035.1| protein-tyrosine phosphatase [Homo sap... 129 8e-29
gi|30851400|gb|AAH52462.1| Ptprs protein [Mus musculus] 129 8e-29
gi|48098669|ref|XP_394130.1| similar to ENSANGP00000013354 [Apis... 129 8e-29
gi|21634739|gb|AAM69432.1| protein tyrosine phosphatase receptor... 129 8e-29
gi|31235464|ref|XP_319248.1| ENSANGP00000006103 [Anopheles gambi... 129 1e-28
gi|39589164|emb|CAE57897.1| Hypothetical protein CBG00946 [Caeno... 129 1e-28
gi|627274|pir||A53978 protein-tyrosine-phosphatase (EC 3.1.3.48)... 129 1e-28
gi|483922|gb|AAA17990.1| protein tyrosine phosphatase alpha 129 1e-28
gi|48097821|ref|XP_393897.1| similar to protein tyrosine phospha... 129 1e-28
gi|18491010|ref|NP_002828.2| protein tyrosine phosphatase, recep... 128 2e-28
gi|126469|sp|P23467|PTPB_HUMAN Protein-tyrosine phosphatase beta... 128 2e-28
gi|47123868|gb|AAH70687.1| MGC83117 protein [Xenopus laevis] 128 2e-28
gi|34367936|emb|CAE46198.1| hypothetical protein [Homo sapiens] 128 2e-28
gi|1063642|gb|AAC52312.1| protein tyrosine phosphatase phi, shor... 128 2e-28
gi|450583|gb|AAB04150.1| protein tyrosine phosphatase >gnl|BL_OR... 128 2e-28
gi|1063644|gb|AAC52313.1| protein tyrosine phosphatase phi, inse... 128 2e-28
gi|47059069|ref|NP_035346.2| protein tyrosine phosphatase, recep... 128 2e-28
gi|45383866|ref|NP_989453.1| protein tyrosine phosphatase, recep... 128 2e-28
gi|2118909|pir||I49372 protein-tyrosine-phosphatase (EC 3.1.3.48... 128 2e-28
gi|1083485|pir||S50893 protein-tyrosine-phosphatase (EC 3.1.3.48... 128 2e-28
gi|7511581|pir||T19121 probable protein-tyrosine-phosphatase (EC... 128 2e-28
gi|50417772|gb|AAH78054.1| MGC83117 protein [Xenopus laevis] 128 2e-28
gi|25146572|ref|NP_741043.1| protein tyrosine phosphatase, LAR-l... 128 2e-28
gi|7958608|gb|AAF70856.1| glomerular epithelial protein 1 precur... 128 2e-28
gi|20871585|emb|CAD31753.1| Hypothetical protein C09D8.1b [Caeno... 128 2e-28
gi|21707427|gb|AAH33716.1| Unknown (protein for IMAGE:4452690) [... 128 2e-28
gi|49116976|gb|AAH73110.1| Unknown (protein for MGC:83614) [Xeno... 128 2e-28
gi|30704669|gb|AAH51976.1| Ptpro protein [Mus musculus] 128 2e-28
gi|38969708|gb|AAH63258.1| Ptpro protein [Mus musculus] 128 2e-28
gi|20871584|emb|CAA86842.3| Hypothetical protein C09D8.1a [Caeno... 128 2e-28
gi|14193729|gb|AAK56109.1| protein tyrosin phosphatase receptor ... 128 2e-28
gi|25146575|ref|NP_741044.1| protein tyrosine phosphatase, LAR-l... 128 2e-28
gi|8394112|ref|NP_058965.1| protein tyrosine phosphatase, recept... 128 2e-28
gi|26985797|emb|CAD59171.1| Hypothetical protein C09D8.1c [Caeno... 128 2e-28
gi|2098414|pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phospha... 128 2e-28
gi|17566500|ref|NP_507918.1| protein tyrosine phosphatase family... 128 2e-28
gi|45553601|ref|NP_996302.1| CG2005-PC [Drosophila melanogaster]... 127 3e-28
gi|17136638|ref|NP_476816.1| CG2005-PB [Drosophila melanogaster]... 127 3e-28
gi|13677216|ref|NP_109593.1| receptor-type protein tyrosine phos... 127 3e-28
gi|18104986|ref|NP_002820.2| protein tyrosine phosphatase, non-r... 127 3e-28
gi|131530|sp|P26045|PTN3_HUMAN Protein tyrosine phosphatase, non... 127 3e-28
gi|1321658|dbj|BAA08252.1| brain-enriched membrane-associated pr... 127 3e-28
gi|34484430|gb|AAQ72837.1| CD45 [Ictalurus punctatus] 127 3e-28
gi|4506323|ref|NP_002839.1| receptor-type protein tyrosine phosp... 127 3e-28
gi|157300|gb|AAA28486.1| protein-tyrosine phosphatase 127 3e-28
gi|157298|gb|AAA28485.1| receptor-linked protein tyrosine phosph... 127 3e-28
gi|24651039|ref|NP_733288.1| CG2005-PA [Drosophila melanogaster]... 127 3e-28
gi|18450369|ref|NP_543030.1| protein tyrosine phosphatase, recep... 127 3e-28
gi|32067|emb|CAA37447.1| tyrosine phosphatase precursor [Homo sa... 127 3e-28
gi|227294|prf||1701300A protein Tyr phosphatase 127 3e-28
gi|4506303|ref|NP_002827.1| protein tyrosine phosphatase, recept... 127 3e-28
gi|126467|sp|P18433|PTRA_HUMAN Protein-tyrosine phosphatase alph... 127 3e-28
gi|8394227|ref|NP_059032.1| receptor-type protein tyrosine phosp... 127 3e-28
gi|33112422|sp|Q16827|PTPO_HUMAN Receptor-type protein-tyrosine ... 127 3e-28
gi|13677214|ref|NP_109592.1| receptor-type protein tyrosine phos... 127 3e-28
gi|13677218|ref|NP_109594.1| receptor-type protein tyrosine phos... 127 3e-28
gi|46849981|gb|AAT02413.1| protein tyrosine phosphatase non-rece... 127 3e-28
gi|47229353|emb|CAF99341.1| unnamed protein product [Tetraodon n... 127 3e-28
gi|285113|pir||JC1285 protein-tyrosine-phosphatase (EC 3.1.3.48)... 127 4e-28
gi|6981446|ref|NP_036895.1| protein tyrosine phosphatase, recept... 127 4e-28
gi|21631865|gb|AAK98640.1| PTPRJ [Mus musculus] 127 4e-28
gi|17509337|ref|NP_492100.1| tyrosine phosphatase family member ... 127 4e-28
gi|627804|pir||A53661 protein-tyrosine-phosphatase (EC 3.1.3.48)... 127 5e-28
gi|682753|dbj|BAA08386.1| protein tyrosine phosphatase [Mus musc... 127 5e-28
gi|19743925|ref|NP_570925.1| protein tyrosine phosphatase, recep... 127 5e-28
gi|22128621|ref|NP_033008.1| protein tyrosine phosphatase, recep... 127 5e-28
gi|23268287|gb|AAN11409.1| protein tyrosine phosphatase receptor... 127 5e-28
gi|19743919|ref|NP_002841.2| protein tyrosine phosphatase, recep... 127 5e-28
gi|19743923|ref|NP_570924.1| protein tyrosine phosphatase, recep... 127 5e-28
gi|19743921|ref|NP_570923.1| protein tyrosine phosphatase, recep... 127 5e-28
gi|2137014|pir||S68250 protein-tyrosine-phosphatase (EC 3.1.3.48... 127 5e-28
gi|25289046|pir||B88486 protein F20H11.4 [imported] - Caenorhabd... 127 5e-28
gi|1407625|gb|AAC50567.1| PTPsigma 127 5e-28
gi|4096822|gb|AAD09360.1| PTPsigma-(brain) [Homo sapiens] 127 5e-28
gi|9652147|gb|AAF91411.1| transmembrane-type protein tyrosine ph... 126 7e-28
gi|34328115|ref|NP_031981.2| protein tyrosine phosphatase, recep... 126 7e-28
gi|3183134|sp|P70289|PTPV_MOUSE Receptor-type protein-tyrosine p... 126 7e-28
gi|18652302|gb|AAL77056.1| SH2 phosphatase 1 [Rattus norvegicus] 126 7e-28
gi|31199365|ref|XP_308630.1| ENSANGP00000007560 [Anopheles gambi... 126 9e-28
gi|31207837|ref|XP_312885.1| ENSANGP00000003247 [Anopheles gambi... 126 9e-28
gi|11275230|pir||T42522 protein-tyrosine-phosphatase (EC 3.1.3.4... 126 9e-28
gi|25154084|ref|NP_495041.2| encoding in order receptor tyrosine... 126 9e-28
gi|19424294|ref|NP_598276.1| brain-enriched membrane-associated ... 126 9e-28
gi|24418260|gb|AAN60516.1| Clear protein 1, isoform b [Caenorhab... 126 9e-28
gi|7511703|pir||T31093 probable protein-tyrosine-phosphatase (EC... 125 1e-27
gi|3702284|gb|AAC62834.1| PTPsigma [AA 524- 1926] [Homo sapiens] 125 1e-27
gi|9790181|ref|NP_062625.1| protein tyrosine phosphatase, non-re... 125 1e-27
gi|38524399|dbj|BAD02400.1| protein tyrosine phosphatase a [Oryz... 125 2e-27
gi|38524403|dbj|BAD02402.1| protein tyrosine phosphatase a [Oryz... 125 2e-27
gi|1109792|gb|AAC50299.1| protein tyrosine phosphatase sigma >gn... 125 2e-27
gi|47204449|emb|CAG04747.1| unnamed protein product [Tetraodon n... 125 2e-27
gi|20828736|ref|XP_143789.1| protein tyrosine phosphatase, non-r... 125 2e-27
gi|38078421|ref|XP_355486.1| protein tyrosine phosphatase, non-r... 125 2e-27
gi|548625|sp|P35832|PTP9_DROME Protein-tyrosine phosphatase 99A ... 125 2e-27
gi|47213552|emb|CAF91826.1| unnamed protein product [Tetraodon n... 125 2e-27
gi|9507013|ref|NP_062122.1| protein tyrosine phosphatase, recept... 125 2e-27
gi|25294241|pir||JC7503 protein-tyrosine-phosphatase (EC 3.1.3.4... 125 2e-27
gi|47216120|emb|CAG11188.1| unnamed protein product [Tetraodon n... 124 3e-27
gi|15619018|ref|NP_036543.2| lymphoid-specific protein tyrosine ... 124 3e-27
gi|13378310|gb|AAK18743.1| brain RPTPmam4 isoform III [Mus muscu... 124 3e-27
gi|18702313|ref|NP_035343.1| protein tyrosine phosphatase, recep... 124 3e-27
gi|24935301|gb|AAN64298.1| CD45 protein tyrosine phosphatase rec... 124 3e-27
gi|45382907|ref|NP_989952.1| supporting-cell antigen [Gallus gal... 124 4e-27
gi|47206263|emb|CAF91063.1| unnamed protein product [Tetraodon n... 124 5e-27
gi|13195754|gb|AAB22439.2| protein tyrosine phosphatase; PTPase ... 124 5e-27
gi|249840|gb|AAB22251.1| LAR, leukocyte common antigen-related p... 124 5e-27
gi|9910518|ref|NP_064317.1| protein tyrosine phosphatase, non-re... 124 5e-27
gi|1083478|pir||C54689 protein-tyrosine-phosphatase (EC 3.1.3.48... 124 5e-27
gi|47717352|gb|AAR97566.1| frizzled-8 associated multidomain pro... 124 5e-27
gi|34870151|ref|XP_346749.1| hypothetical protein XP_346748 [Rat... 124 5e-27
gi|205131|gb|AAA41510.1| leukocyte common antigen related protein 124 5e-27
gi|2118903|pir||A56493 leucocyte common antigen-related protein ... 124 5e-27
gi|1083477|pir||D54689 protein-tyrosine-phosphatase (EC 3.1.3.48... 124 5e-27
gi|1519396|gb|AAB42210.1| receptor type protein tyrosine phospha... 124 5e-27
gi|47211684|emb|CAF92848.1| unnamed protein product [Tetraodon n... 124 5e-27
gi|693993|emb|CAA58537.1| leucocyte common antigen-related prote... 124 5e-27
gi|7248659|gb|AAF43606.1| receptor protein tyrosine phosphatase ... 123 6e-27
gi|4506313|ref|NP_002833.1| protein tyrosine phosphatase, recept... 123 6e-27
gi|34879411|ref|XP_341110.1| similar to testis-enriched protein ... 123 6e-27
gi|48928054|ref|NP_057051.2| lymphoid-specific protein tyrosine ... 123 6e-27
gi|20139861|sp|Q9Y2R2|PTNM_HUMAN Protein-tyrosine phosphatase, n... 123 6e-27
gi|110068|pir||S17671 protein-tyrosine-phosphatase (EC 3.1.3.48)... 123 6e-27
gi|46048665|ref|NP_990738.1| protein-tyrosine phosphatase [Gallu... 123 6e-27
gi|50749981|ref|XP_421821.1| PREDICTED: similar to Protein-tyros... 123 8e-27
gi|14250184|gb|AAH08512.1| Ptpn18 protein [Mus musculus] 123 8e-27
gi|50728376|ref|XP_416114.1| PREDICTED: similar to protein tyros... 123 8e-27
gi|39581409|emb|CAE74691.1| Hypothetical protein CBG22503 [Caeno... 123 8e-27
gi|46402289|ref|NP_997153.1| protein tyrosine phosphatase, recep... 123 8e-27
gi|6679557|ref|NP_033006.1| protein tyrosine phosphatase, recept... 123 8e-27
gi|1363186|pir||A57068 protein-tyrosine-phosphatase (EC 3.1.3.48... 122 1e-26
gi|34980829|gb|AAH57166.1| Ptprf protein [Mus musculus] 122 1e-26
gi|45383181|ref|NP_989823.1| receptor tyrosine phosphatase [Gall... 122 1e-26
gi|24654059|ref|NP_611093.1| CG18243-PA [Drosophila melanogaster... 122 1e-26
gi|7766938|pdb|1LAR|A Chain A, Crystal Structure Of The Tandem P... 122 1e-26
gi|4100634|gb|AAD00905.1| lymphoid phosphatase LyP2 [Homo sapiens] 122 1e-26
gi|227796|prf||1711408A protein Tyr phosphatase LAR 122 1e-26
gi|4506311|ref|NP_002831.1| protein tyrosine phosphatase, recept... 122 1e-26
gi|31873230|emb|CAD97607.1| hypothetical protein [Homo sapiens] 122 1e-26
gi|48096308|ref|XP_392429.1| similar to protein tyrosine phospha... 122 1e-26
gi|18860896|ref|NP_569707.1| protein tyrosine phosphatase, recep... 122 1e-26
gi|7688663|gb|AAF67472.1| protein tyrosine phosphatase [Homo sap... 122 1e-26
gi|4100632|gb|AAD00904.1| lymphoid phosphatase LyP1 [Homo sapiens] 122 1e-26
gi|1669508|gb|AAC52896.1| protein tyrosine phosphatase 20 [Rattu... 122 2e-26
gi|1079024|pir||S53089 protein-tyrosine-phosphatase (EC 3.1.3.48... 122 2e-26
gi|47228368|emb|CAG07763.1| unnamed protein product [Tetraodon n... 122 2e-26
gi|12621078|ref|NP_075214.1| protein tyrosine phosphatase, recep... 122 2e-26
gi|39597557|emb|CAE59787.1| Hypothetical protein CBG03240 [Caeno... 121 2e-26
gi|33317518|gb|AAQ04720.1| tyrosine phosphatase 1B [Sus scrofa] 121 2e-26
gi|1293622|gb|AAB18623.1| tyrosine phosphatase [Mus musculus] >g... 121 2e-26
gi|25151580|ref|NP_741679.1| protein tyrosine phosphatase family... 121 2e-26
gi|38090755|ref|XP_137234.3| similar to protein tyrosine phospha... 121 2e-26
gi|11359772|pir||T45031 hypothetical protein Y39B6B.e [imported]... 121 2e-26
gi|4689110|gb|AAD27764.1| protein tyrosine phosphatase homolog [... 121 2e-26
gi|6755236|ref|NP_035336.1| protein tyrosine phosphatase, non-re... 121 2e-26
gi|48143772|ref|XP_393650.1| similar to CG3328-PA [Apis mellifera] 121 2e-26
gi|35790|emb|CAA38068.1| protein-tyrosine phosphatase [Homo sapi... 121 3e-26
gi|18860892|ref|NP_569076.1| protein tyrosine phosphatase, recep... 121 3e-26
gi|4506295|ref|NP_002821.1| protein tyrosine phosphatase, non-re... 121 3e-26
gi|19263606|gb|AAH25145.1| Ptprd protein [Mus musculus] 121 3e-26
gi|50761732|ref|XP_429156.1| PREDICTED: similar to protein tyros... 121 3e-26
gi|20833032|ref|XP_131462.1| protein tyrosine phosphatase, recep... 121 3e-26
gi|18860894|ref|NP_569077.1| protein tyrosine phosphatase, recep... 121 3e-26
gi|14861868|ref|NP_149090.1| Osteotesticular phosphatase; protei... 121 3e-26
gi|1083770|pir||A55148 protein-tyrosine-phosphatase (EC 3.1.3.48... 121 3e-26
gi|4506309|ref|NP_002830.1| protein tyrosine phosphatase, recept... 121 3e-26
gi|34869007|ref|XP_233065.2| similar to protein tyrosine phospha... 121 3e-26
gi|15027042|emb|CAC44759.1| receptor protein-tyrosine phosphatas... 121 3e-26
gi|6679551|ref|NP_033004.1| protein tyrosine phosphatase, non-re... 121 3e-26
gi|18860890|ref|NP_569075.1| protein tyrosine phosphatase, recep... 121 3e-26
gi|34871761|ref|XP_342931.1| protein tyrosine phosphatase, recep... 120 4e-26
gi|19743935|ref|NP_005695.2| protein tyrosine phosphatase, recep... 120 4e-26
gi|1518672|gb|AAB07074.1| receptor protein tyrosine phosphatase psi 120 4e-26
gi|7439345|pir||JC5290 protein-tyrosine-phosphatase (EC 3.1.3.48... 120 4e-26
gi|19743933|ref|NP_573439.1| protein tyrosine phosphatase, recep... 120 4e-26
gi|41149682|ref|XP_370699.1| similar to protein tyrosine phospha... 120 4e-26
gi|17554412|ref|NP_497733.1| protein tyrosine phosphatase (68.8 ... 120 4e-26
gi|25151513|ref|NP_741112.1| protein tyrosine phosphatase (ptp-1... 120 4e-26
gi|17554410|ref|NP_497732.1| protein tyrosine phosphatase (115.1... 120 4e-26
gi|7684256|dbj|BAA95171.1| amPTPR4c [Branchiostoma belcheri] 120 5e-26
gi|47220844|emb|CAG00051.1| unnamed protein product [Tetraodon n... 120 5e-26
gi|47210609|emb|CAF89865.1| unnamed protein product [Tetraodon n... 120 5e-26
gi|47225918|emb|CAF98398.1| unnamed protein product [Tetraodon n... 120 5e-26
gi|28981412|gb|AAH48768.1| PTPRF protein [Homo sapiens] 120 5e-26
gi|47558926|gb|AAT35563.1| protein tyrosine phosphatase; PTP [Ph... 120 7e-26
gi|7248661|gb|AAF43607.1| receptor protein tyrosine phosphatase ... 120 7e-26
gi|25151561|ref|NP_741667.1| protein tyrosine phosphatase family... 120 7e-26
gi|11359780|pir||T45039 hypothetical protein Y39B6B.m [imported]... 120 7e-26
gi|15027040|emb|CAC44758.1| receptor protein-tyrosine phosphatas... 120 7e-26
gi|29427426|sp|Q24708|CSW_DROVI Protein-tyrosine phosphatase cor... 120 7e-26
gi|7511704|pir||T30938 receptor tyrosine phosphatase - medicinal... 120 7e-26
gi|32313|emb|CAA38662.1| protein-tyrosine phosphatase [Homo sapi... 120 7e-26
gi|7248657|gb|AAF43605.1| receptor protein tyrosine phosphatase ... 120 7e-26
gi|47207147|emb|CAF94630.1| unnamed protein product [Tetraodon n... 119 1e-25
gi|2499758|sp|Q92729|PTPU_HUMAN Receptor-type protein-tyrosine p... 119 1e-25
gi|9229928|dbj|BAB00633.1| tyrosine phosphatase [Ciona intestina... 119 1e-25
gi|50760401|ref|XP_418006.1| PREDICTED: similar to Adaptor-relat... 118 2e-25
gi|22316173|emb|CAD43435.2| SI:dZ37O5.1 (novel protein tyrosine ... 118 3e-25
gi|25396045|pir||H88683 protein C02B10.6 [imported] - Caenorhabd... 117 3e-25
gi|19743931|ref|NP_573438.1| protein tyrosine phosphatase, recep... 117 3e-25
gi|50539668|ref|NP_001002299.1| protein tyrosine phosphatase, re... 117 3e-25
gi|1890660|gb|AAC51938.1| protein tyrosine phosphatase receptor ... 117 3e-25
gi|3413473|emb|CAA06975.1| tyrosine phosphatase 1 [Glycine max] 117 4e-25
gi|47210329|emb|CAF91472.1| unnamed protein product [Tetraodon n... 117 4e-25
gi|17534045|ref|NP_495925.1| protein tyrosine phosphatase 10D (2... 117 4e-25
gi|47219585|emb|CAG02291.1| unnamed protein product [Tetraodon n... 117 4e-25
>gi|17506237|ref|NP_491872.1| protein tyrosine phosphatase receptor
type G family member (39.8 kD) (1H77) [Caenorhabditis
elegans]
gi|14573993|gb|AAK68274.1| Hypothetical protein C55B7.3
[Caenorhabditis elegans]
Length = 346
Score = 706 bits (1823), Expect = 0.0
Identities = 346/346 (100%), Positives = 346/346 (100%)
Frame = +1
Query: 1 MSKMKRRTNKPRATESANSSTKSSVLDEPTLVERKQQKKQILKFVQRTLEKMPQGLRAEF 180
MSKMKRRTNKPRATESANSSTKSSVLDEPTLVERKQQKKQILKFVQRTLEKMPQGLRAEF
Sbjct: 1 MSKMKRRTNKPRATESANSSTKSSVLDEPTLVERKQQKKQILKFVQRTLEKMPQGLRAEF 60
Query: 181 VGMRRFNDFEKMKAFKEAQEAGKNRYKDVGCLDNNRVKLEGPWPHEYIHANYVATPTNPK 360
VGMRRFNDFEKMKAFKEAQEAGKNRYKDVGCLDNNRVKLEGPWPHEYIHANYVATPTNPK
Sbjct: 61 VGMRRFNDFEKMKAFKEAQEAGKNRYKDVGCLDNNRVKLEGPWPHEYIHANYVATPTNPK 120
Query: 361 RFICTQAPLEKTCADFWYMCYQDKVEYIFMLCNLLEKGARKCFEYFPSKKGDVMDFEEGG 540
RFICTQAPLEKTCADFWYMCYQDKVEYIFMLCNLLEKGARKCFEYFPSKKGDVMDFEEGG
Sbjct: 121 RFICTQAPLEKTCADFWYMCYQDKVEYIFMLCNLLEKGARKCFEYFPSKKGDVMDFEEGG 180
Query: 541 QKISVKCESSVTYSFRSDAKANVTATEIVIEGPGEKTRKTTHYHWNDWPDRGVPAADMAV 720
QKISVKCESSVTYSFRSDAKANVTATEIVIEGPGEKTRKTTHYHWNDWPDRGVPAADMAV
Sbjct: 181 QKISVKCESSVTYSFRSDAKANVTATEIVIEGPGEKTRKTTHYHWNDWPDRGVPAADMAV 240
Query: 721 LELLENARPSKGPIVVHCSAGIGRTGSVVMLEYIMDQLLAGQIIDDGEKILVKIREQRNN 900
LELLENARPSKGPIVVHCSAGIGRTGSVVMLEYIMDQLLAGQIIDDGEKILVKIREQRNN
Sbjct: 241 LELLENARPSKGPIVVHCSAGIGRTGSVVMLEYIMDQLLAGQIIDDGEKILVKIREQRNN 300
Query: 901 SIQTDAQYLFVHQVILNYFRKKKLMEETGVQEAYDAFLEQYKKVVV 1038
SIQTDAQYLFVHQVILNYFRKKKLMEETGVQEAYDAFLEQYKKVVV
Sbjct: 301 SIQTDAQYLFVHQVILNYFRKKKLMEETGVQEAYDAFLEQYKKVVV 346
>gi|17506573|ref|NP_492647.1| predicted CDS, receptor-type protein
tyrosine phosphatase family member (1K595)
[Caenorhabditis elegans]
gi|7498856|pir||T20729 hypothetical protein F10G8.1 - Caenorhabditis
elegans
gi|3924722|emb|CAB02287.1| Hypothetical protein F10G8.1
[Caenorhabditis elegans]
Length = 352
Score = 689 bits (1778), Expect = 0.0
Identities = 339/352 (96%), Positives = 344/352 (97%), Gaps = 6/352 (1%)
Frame = +1
Query: 1 MSKMKRRTNKPRATESANSSTKSSVLDEPTLVERKQQKKQILKFVQRTLEKMPQGLRAEF 180
MSKMKRRTNKPRATESANSSTKSSVLDEPTLVERKQQKKQILKFVQRTLEKMPQGLRAEF
Sbjct: 1 MSKMKRRTNKPRATESANSSTKSSVLDEPTLVERKQQKKQILKFVQRTLEKMPQGLRAEF 60
Query: 181 VGMRRFNDFEKMKAFKEAQEAGKNRYKDVGCLDNNRVKLEGPWPHEYIHANYVATPTNPK 360
VGMRRFNDFEKMKAFKEAQEAGKNRYKDVGCLDNNRVKLEGPWPHEYIHANYVATPTNPK
Sbjct: 61 VGMRRFNDFEKMKAFKEAQEAGKNRYKDVGCLDNNRVKLEGPWPHEYIHANYVATPTNPK 120
Query: 361 RFICTQAPLEKTCADFWYMCYQDKVEYIFMLCNLLEKGARKCFEYFPSKKGDVMDFEEGG 540
RFICTQAPLEKTCADFWYMCYQDKVEYIFMLCN LEKGA+KCFEYFPSKKGDVMDF+EGG
Sbjct: 121 RFICTQAPLEKTCADFWYMCYQDKVEYIFMLCNFLEKGAKKCFEYFPSKKGDVMDFDEGG 180
Query: 541 QKISVKCESSVT------YSFRSDAKANVTATEIVIEGPGEKTRKTTHYHWNDWPDRGVP 702
QKISVKCESSVT YSFR+DAKANVTATEIVIEGPGEKTRKTTHYHWNDWPDRGVP
Sbjct: 181 QKISVKCESSVTFIESFHYSFRADAKANVTATEIVIEGPGEKTRKTTHYHWNDWPDRGVP 240
Query: 703 AADMAVLELLENARPSKGPIVVHCSAGIGRTGSVVMLEYIMDQLLAGQIIDDGEKILVKI 882
AADMAVLELLENARPSKGPIVVHCSAGIGRTGSVVMLEYIMDQLLAGQIIDDGEKILVKI
Sbjct: 241 AADMAVLELLENARPSKGPIVVHCSAGIGRTGSVVMLEYIMDQLLAGQIIDDGEKILVKI 300
Query: 883 REQRNNSIQTDAQYLFVHQVILNYFRKKKLMEETGVQEAYDAFLEQYKKVVV 1038
EQRNNSIQTDAQYLFVHQVILNYFRKKKLM+E+GVQEAYDAFLEQYKKVVV
Sbjct: 301 CEQRNNSIQTDAQYLFVHQVILNYFRKKKLMDESGVQEAYDAFLEQYKKVVV 352