Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C54E10_3
(339 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17558932|ref|NP_507675.1| putative nuclear protein, with a co... 221 3e-57
gi|17552718|ref|NP_498862.1| C.Elegans Chromodomain protein (33.... 45 4e-04
gi|15235717|ref|NP_195495.1| expressed protein [Arabidopsis thal... 44 0.001
gi|34495238|gb|AAQ73469.1| erythrocyte binding protein 3 [Plasmo... 44 0.001
gi|23508673|ref|NP_701342.1| MAEBL, putative [Plasmodium falcipa... 44 0.001
gi|38080873|ref|XP_207119.2| similar to hypothetical protein [Mu... 44 0.001
gi|19401863|gb|AAL87694.1| non-transporter ABC protein AbcF4 [Di... 44 0.001
gi|39594465|emb|CAE72043.1| Hypothetical protein CBG19125 [Caeno... 44 0.001
gi|34495237|gb|AAQ73468.1| erythrocyte binding protein 2 [Plasmo... 44 0.001
gi|23510180|ref|NP_702846.1| ran binding protein 1 [Plasmodium f... 43 0.001
gi|29376614|ref|NP_815768.1| hypothetical protein [Enterococcus ... 43 0.002
gi|19704348|ref|NP_603910.1| Hypothetical protein [Fusobacterium... 42 0.002
gi|46444424|gb|EAL03699.1| hypothetical protein CaO19.9118 [Cand... 42 0.002
gi|39590442|emb|CAE66182.1| Hypothetical protein CBG11420 [Caeno... 42 0.003
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 42 0.004
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 42 0.004
gi|32421759|ref|XP_331323.1| hypothetical protein [Neurospora cr... 42 0.004
gi|17507323|ref|NP_492340.1| microfibrillar-associated protein 1... 42 0.004
gi|19074574|ref|NP_586080.1| similarity to ribosomal protein L5 ... 41 0.005
gi|46229652|gb|EAK90470.1| hypothetical low complexity protein w... 41 0.005
gi|23956212|ref|NP_082518.1| RIKEN cDNA 2600017A12 [Mus musculus... 41 0.007
gi|41054736|ref|NP_955828.1| Unknown (protein for MGC:65851); sb... 41 0.007
gi|45384402|ref|NP_990272.1| chromo-helicase-DNA-binding on the ... 41 0.007
gi|50551847|ref|XP_503398.1| hypothetical protein [Yarrowia lipo... 41 0.007
gi|15239633|ref|NP_200252.1| hypothetical protein [Arabidopsis t... 40 0.009
gi|42528199|ref|NP_973297.1| antigen, putative [Treponema dentic... 40 0.009
gi|23508562|ref|NP_701231.1| hypothetical protein [Plasmodium fa... 40 0.009
gi|23508707|ref|NP_701375.1| hypothetical protein [Plasmodium fa... 40 0.009
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 40 0.009
gi|23509641|ref|NP_702308.1| hypothetical protein [Plasmodium fa... 40 0.011
gi|7494317|pir||E71606 hypothetical protein PFB0765w - malaria p... 40 0.011
gi|48697020|ref|YP_025017.1| hypothetical protein B124 [Sulfolob... 40 0.011
gi|23593319|ref|NP_703169.1| hypothetical protein [Plasmodium fa... 40 0.011
gi|16805048|ref|NP_473077.1| hypothetical protein [Plasmodium fa... 40 0.011
gi|23481592|gb|EAA17823.1| hypothetical protein [Plasmodium yoel... 40 0.011
gi|48095883|ref|XP_394542.1| similar to kinesin family member 21... 40 0.011
gi|462702|sp|P16884|NFH_RAT Neurofilament triplet H protein (200... 40 0.011
gi|39593039|emb|CAE64508.1| Hypothetical protein CBG09238 [Caeno... 40 0.011
gi|92538|pir||S02003 neurofilament triplet H protein - rat (frag... 40 0.011
gi|15238595|ref|NP_200811.1| expressed protein [Arabidopsis thal... 40 0.011
gi|32416118|ref|XP_328537.1| hypothetical protein [Neurospora cr... 40 0.011
gi|23464923|ref|NP_695526.1| hypothetical protein BL0322 [Bifido... 40 0.015
gi|46138671|ref|XP_391026.1| hypothetical protein FG10850.1 [Gib... 40 0.015
gi|17554908|ref|NP_497967.1| cyclin-like F-box (3F797) [Caenorha... 40 0.015
gi|23335802|ref|ZP_00121034.1| COG3599: Cell division initiation... 40 0.015
gi|49076500|ref|XP_402218.1| hypothetical protein UM04603.1 [Ust... 40 0.015
gi|25395695|pir||G88436 protein T04A8.13 [imported] - Caenorhabd... 40 0.015
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb... 40 0.015
gi|39593526|emb|CAE61818.1| Hypothetical protein CBG05788 [Caeno... 39 0.020
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl... 39 0.020
gi|418112|sp|Q04750|TOP1_MOUSE DNA topoisomerase I >gnl|BL_ORD_I... 39 0.020
gi|34869750|ref|XP_223980.2| similar to RPGR-interacting protein... 39 0.020
gi|23479053|gb|EAA15986.1| mature-parasite-infected erythrocyte ... 39 0.020
gi|23486287|gb|EAA20763.1| hypothetical protein [Plasmodium yoel... 39 0.020
gi|29350163|ref|NP_813666.1| putative two-component system senso... 39 0.020
gi|205686|gb|AAA41695.1| heavy neurofilament subunit 39 0.026
gi|50413684|ref|XP_457300.1| unnamed protein product [Debaryomyc... 39 0.026
gi|28828540|gb|AAO51148.1| similar to Y55B1BR.3.p [Caenorhabditi... 39 0.026
gi|23508384|ref|NP_701053.1| hypothetical protein [Plasmodium fa... 39 0.026
gi|21429606|gb|AAM49796.1| heavy neurofilament NF-H [Rattus norv... 39 0.026
gi|205680|gb|AAA41692.1| high molecular weight neurofilament 39 0.026
gi|40956306|gb|AAO14563.2| Hsp90 [Heterodera glycines] 39 0.026
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto... 39 0.026
gi|23508962|ref|NP_701630.1| hypothetical protein [Plasmodium fa... 39 0.026
gi|33331979|gb|AAQ11205.1| major surface protein 3 [Anaplasma ma... 39 0.026
gi|1408194|gb|AAB03661.1| myosin heavy chain [Placopecten magell... 39 0.026
gi|29789026|ref|NP_036739.1| neurofilament, heavy polypeptide [R... 39 0.026
gi|1408192|gb|AAB03660.1| myosin heavy chain [Placopecten magell... 39 0.026
gi|8894548|emb|CAB95829.1| hypothetical protein [Cicer arietinum] 39 0.026
gi|22326876|ref|NP_197291.2| LIM domain-containing protein / dis... 39 0.033
gi|23491066|gb|EAA22695.1| hypothetical protein [Plasmodium yoel... 39 0.033
gi|8096269|dbj|BAA95789.1| KED [Nicotiana tabacum] 39 0.033
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 39 0.033
gi|27227741|emb|CAD59239.1| NAD(+) ADP-ribosyltransferase-3 [Dic... 39 0.033
gi|25518567|pir||E86336 hypothetical protein F14O10.11 - Arabido... 39 0.033
gi|23488127|gb|EAA21236.1| maebl [Plasmodium yoelii yoelii] 39 0.033
gi|48096331|ref|XP_392432.1| similar to ENSANGP00000009968 [Apis... 39 0.033
gi|22326629|ref|NP_196285.2| kinesin motor protein-related [Arab... 39 0.033
gi|17558378|ref|NP_504775.1| putative protein, with 4 coiled coi... 39 0.033
gi|10177890|dbj|BAB11222.1| disease resistance protein-like [Ara... 39 0.033
gi|15223583|ref|NP_176058.1| expressed protein [Arabidopsis thal... 39 0.033
gi|39594797|emb|CAE70665.1| Hypothetical protein CBG17372 [Caeno... 39 0.033
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet... 39 0.033
gi|16648923|gb|AAL24313.1| Unknown protein [Arabidopsis thaliana] 39 0.033
gi|23593313|ref|NP_473064.2| hypothetical protein [Plasmodium fa... 38 0.044
gi|31211073|ref|XP_314503.1| ENSANGP00000020564 [Anopheles gambi... 38 0.044
gi|50545281|ref|XP_500178.1| hypothetical protein [Yarrowia lipo... 38 0.044
gi|15921537|ref|NP_377206.1| 311aa long conserved hypothetical p... 38 0.044
gi|46136219|ref|XP_389801.1| hypothetical protein FG09625.1 [Gib... 38 0.044
gi|28829349|gb|AAO51891.1| similar to C33G8.2.p [Caenorhabditis ... 38 0.044
gi|46441128|gb|EAL00427.1| hypothetical protein CaO19.7553 [Cand... 38 0.044
gi|23479649|gb|EAA16419.1| Late embryogenesis abundant protein, ... 38 0.044
gi|24656966|ref|NP_524833.2| CG9696-PA [Drosophila melanogaster]... 38 0.044
gi|8953897|gb|AAF82185.1| helicase DOMINO A [Drosophila melanoga... 38 0.044
gi|23491222|gb|EAA22812.1| RNA polymerase A/beta'/A'' subunit, p... 38 0.044
gi|20521262|dbj|BAB91778.1| putative ZmGR2c [Oryza sativa (japon... 38 0.044
gi|24656962|ref|NP_726065.1| CG9696-PD [Drosophila melanogaster]... 38 0.044
gi|23612385|ref|NP_703965.1| hypothetical protein [Plasmodium fa... 38 0.044
gi|15207931|dbj|BAB62990.1| hypothetical protein [Macaca fascicu... 38 0.044
gi|23480067|gb|EAA16729.1| hypothetical protein [Plasmodium yoel... 38 0.044
gi|48839314|ref|ZP_00296247.1| COG0532: Translation initiation f... 38 0.044
gi|15208079|dbj|BAB63064.1| hypothetical protein [Macaca fascicu... 38 0.044
gi|7494310|pir||B71609 hypothetical protein PFB0680w - malaria p... 38 0.044
gi|14090511|gb|AAK53539.1| DOMINO B [Drosophila melanogaster] 38 0.044
gi|39595447|emb|CAE60485.1| Hypothetical protein CBG04099 [Caeno... 38 0.044
gi|28573600|ref|NP_788424.1| CG9696-PE [Drosophila melanogaster]... 38 0.044
gi|23507944|ref|NP_700614.1| hypothetical protein [Plasmodium fa... 38 0.057
gi|30721677|gb|AAP33688.1| phoshoprotein 300 [Plasmodium falcipa... 38 0.057
gi|23507975|ref|NP_700645.1| hypothetical protein [Plasmodium fa... 38 0.057
gi|160409|gb|AAA29651.1| mature-parasite-infected erythrocyte su... 38 0.057
gi|12018294|ref|NP_072137.1| DNA topoisomerase I [Rattus norvegi... 38 0.057
gi|7489882|pir||T18283 hypothetical protein G5 - slime mold (Dic... 38 0.057
gi|32408649|ref|XP_324805.1| hypothetical protein [Neurospora cr... 38 0.057
gi|17509191|ref|NP_491919.1| putative nuclear protein, with 3 co... 38 0.057
gi|23480647|gb|EAA17150.1| hypothetical protein [Plasmodium yoel... 38 0.057
gi|23613032|ref|NP_703354.1| Mature parasite-infected erythrocyt... 38 0.057
gi|323126|pir||A45605 mature-parasite-infected erythrocyte surfa... 38 0.057
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano... 38 0.057
gi|39597669|emb|CAE68360.1| Hypothetical protein CBG14099 [Caeno... 38 0.057
gi|34857223|ref|XP_212873.2| similar to DNA topoisomerase I [Rat... 38 0.057
gi|6322042|ref|NP_012117.1| Mlp proteins restrict telomere lengt... 38 0.057
gi|45361443|ref|NP_989298.1| hypothetical protein MGC75641 [Xeno... 38 0.057
gi|50255893|gb|EAL18624.1| hypothetical protein CNBJ0490 [Crypto... 38 0.057
gi|24020878|gb|AAN40837.1| heavy neurofilament protein [Canis fa... 38 0.057
gi|33331985|gb|AAQ11208.1| major surface protein 3 [Anaplasma ma... 37 0.074
gi|33331965|gb|AAQ11198.1| major surface protein 3 [Anaplasma ma... 37 0.074
gi|33331981|gb|AAQ11206.1| major surface protein 3 [Anaplasma ma... 37 0.074
gi|33331983|gb|AAQ11207.1| major surface protein 3 [Anaplasma ma... 37 0.074
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster... 37 0.074
gi|128127|sp|P19246|NFH_MOUSE Neurofilament triplet H protein (2... 37 0.074
gi|28972433|dbj|BAC65670.1| mKIAA0845 protein [Mus musculus] 37 0.074
gi|23613556|ref|NP_704577.1| hypothetical protein [Plasmodium fa... 37 0.074
gi|24580684|ref|NP_608540.1| CG2839-PA [Drosophila melanogaster]... 37 0.074
gi|50400510|sp|Q8BMD2|DZIP_MOUSE Zinc finger protein DZIP1 (DAZ-... 37 0.074
gi|48096459|ref|XP_392462.1| similar to CG18255-PA [Apis mellifera] 37 0.074
gi|42733645|gb|AAS38609.1| hypothetical protein [Dictyostelium d... 37 0.074
gi|39597375|emb|CAE59603.1| Hypothetical protein CBG03011 [Caeno... 37 0.074
gi|463250|emb|CAA83229.1| Neurofilament protein, high molecular ... 37 0.074
gi|45382587|ref|NP_990577.1| claustrin [Gallus gallus] >gnl|BL_O... 37 0.074
gi|28975395|gb|AAO61783.1| chromo-helicase DNA-binding protein [... 37 0.074
gi|12861956|dbj|BAB32310.1| unnamed protein product [Mus musculus] 37 0.074
gi|48130462|ref|XP_396665.1| similar to hypothetical protein [Ap... 37 0.074
gi|33331975|gb|AAQ11203.1| major surface protein 3 [Anaplasma ma... 37 0.074
gi|33302611|sp|P12036|NFH_HUMAN Neurofilament triplet H protein ... 37 0.074
gi|33331991|gb|AAQ11211.1| major surface protein 3 [Anaplasma ma... 37 0.074
gi|48859547|ref|ZP_00313480.1| COG0419: ATPase involved in DNA r... 37 0.074
gi|33331969|gb|AAQ11200.1| major surface protein 3 [Anaplasma ma... 37 0.074
gi|33331973|gb|AAQ11202.1| major surface protein 3 [Anaplasma ma... 37 0.074
gi|27529742|dbj|BAA74868.2| KIAA0845 protein [Homo sapiens] 37 0.074
gi|33331971|gb|AAQ11201.1| major surface protein 3 [Anaplasma ma... 37 0.074
gi|26328623|dbj|BAC28050.1| unnamed protein product [Mus musculus] 37 0.074
gi|50762280|ref|XP_425003.1| PREDICTED: similar to Retinoic acid... 37 0.074
gi|38047887|gb|AAR09846.1| similar to Drosophila melanogaster CG... 37 0.074
gi|4503469|ref|NP_003557.1| early endosome antigen 1, 162kD; ear... 37 0.074
gi|34222508|sp|Q15075|EEA1_HUMAN Early endosome antigen 1 (Endos... 37 0.074
gi|45185544|ref|NP_983260.1| ACL144Cp [Eremothecium gossypii] >g... 37 0.074
gi|46275814|ref|NP_035034.1| neurofilament, heavy polypeptide [M... 37 0.074
gi|33331963|gb|AAQ11197.1| major surface protein 3 [Anaplasma ma... 37 0.074
gi|71549|pir||QFHUH neurofilament triplet H protein - human >gnl... 37 0.074
gi|32483416|ref|NP_066554.2| neurofilament, heavy polypeptide 20... 37 0.074
gi|23612947|ref|NP_704486.1| hypothetical protein [Plasmodium fa... 37 0.074
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633... 37 0.074
gi|24954572|gb|AAN64679.1| M protein [Streptococcus pyogenes] 37 0.074
gi|17539584|ref|NP_500689.1| putative protein, with 2 coiled coi... 37 0.074
gi|33331989|gb|AAQ11210.1| major surface protein 3 [Anaplasma ma... 37 0.074
gi|14250426|gb|AAH08648.1| Unknown (protein for IMAGE:3866238) [... 37 0.074
gi|15230232|ref|NP_191274.1| dyskerin, putative / nucleolar prot... 37 0.097
gi|50306375|ref|XP_453161.1| unnamed protein product [Kluyveromy... 37 0.097
gi|17224446|gb|AAL36978.1| zinc-finger protein DZIP1 [Homo sapiens] 37 0.097
gi|497653|gb|AAC46490.1| myosin heavy chain >gnl|BL_ORD_ID|76853... 37 0.097
gi|127773|sp|P24733|MYS_AEQIR Myosin heavy chain, striated muscl... 37 0.097
gi|25152613|ref|NP_510449.2| putative nuclear protein, with a co... 37 0.097
gi|1160355|gb|AAB00542.1| UNC-89 37 0.097
gi|7416979|gb|AAF62391.1| myosin heavy chain striated muscle spe... 37 0.097
gi|25141314|ref|NP_491290.2| UNCoordinated locomotion UNC-89, PH... 37 0.097
gi|39595257|emb|CAE60294.1| Hypothetical protein CBG03878 [Caeno... 37 0.097
gi|20260450|gb|AAM13123.1| putative protein [Arabidopsis thalian... 37 0.097
gi|31746683|gb|AAP68958.1| Uncoordinated protein 89, isoform b [... 37 0.097
gi|50761332|ref|XP_424694.1| PREDICTED: similar to chromo-helica... 37 0.097
gi|38503303|sp|Q7YR26|TOP1_CERAE DNA topoisomerase I >gnl|BL_ORD... 37 0.097
gi|50753985|ref|XP_414205.1| PREDICTED: similar to ankyrin repea... 37 0.097
gi|23619203|ref|NP_705165.1| hypothetical malaria antigen [Plasm... 37 0.097
gi|30687294|ref|NP_194393.3| expressed protein [Arabidopsis thal... 37 0.097
gi|4505319|ref|NP_002472.1| protein phosphatase 1, regulatory (i... 37 0.097
gi|14195597|ref|NP_115286.1| protein phosphatase 1, regulatory (... 37 0.097
gi|45382609|ref|NP_990058.1| protein phosphatase 1M regulatory s... 37 0.097
gi|7511618|pir||T29757 protein UNC-89 - Caenorhabditis elegans 37 0.097
gi|38109634|gb|EAA55472.1| hypothetical protein MG09279.4 [Magna... 37 0.097
gi|39725957|ref|NP_945319.1| DAZ interacting protein 1; zinc fin... 37 0.097
gi|7416980|gb|AAF62392.1| myosin heavy chain catch (smooth) musc... 37 0.097
gi|23613089|ref|NP_703411.1| hypothetical protein [Plasmodium fa... 37 0.097
gi|284668|pir||B43427 neurofilament protein H form H2 (repetitiv... 37 0.097
gi|7662436|ref|NP_055749.1| DAZ interacting protein 1; zinc fing... 37 0.097
gi|50552886|ref|XP_503853.1| hypothetical protein [Yarrowia lipo... 37 0.097
gi|7416983|gb|AAF62395.1| myosin heavy chain cardiac muscle spec... 37 0.097
gi|30018740|ref|NP_830371.1| Internalin protein [Bacillus cereus... 37 0.097
gi|48838225|ref|ZP_00295172.1| hypothetical protein Meth02003882... 37 0.097
gi|18311102|ref|NP_563036.1| ComE operon protein [Clostridium pe... 37 0.097
gi|45384130|ref|NP_990441.1| DNA topoisomerase I [Gallus gallus]... 37 0.097
gi|23481897|gb|EAA18039.1| hypothetical protein [Plasmodium yoel... 37 0.097
gi|47566162|ref|ZP_00237190.1| erpL protein [Bacillus cereus G92... 37 0.097
gi|236789|gb|AAB19995.1| myosin heavy chain=rod region [Aequipec... 37 0.097
gi|50547935|ref|XP_501437.1| hypothetical protein [Yarrowia lipo... 37 0.097
gi|7416982|gb|AAF62394.1| myosin heavy chain cardiac muscle spec... 37 0.097
gi|47225554|emb|CAG12037.1| unnamed protein product [Tetraodon n... 37 0.097
gi|40789014|dbj|BAA76840.2| KIAA0996 protein [Homo sapiens] 37 0.097
gi|34763487|ref|ZP_00144430.1| hypothetical protein [Fusobacteri... 37 0.13
gi|30348579|emb|CAC84371.1| hypothetical protein [Saimiriine her... 37 0.13
gi|7489869|pir||T30330 gelsolin-related protein GRP125 - slime m... 37 0.13
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 37 0.13
gi|23486190|gb|EAA20743.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [... 37 0.13
gi|39592658|emb|CAE62272.1| Hypothetical protein CBG06331 [Caeno... 37 0.13
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans] 37 0.13
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 37 0.13
gi|23619251|ref|NP_705213.1| hypothetical protein [Plasmodium fa... 37 0.13
gi|47214634|emb|CAG01475.1| unnamed protein product [Tetraodon n... 37 0.13
gi|39588491|emb|CAE58014.1| Hypothetical protein CBG01084 [Caeno... 37 0.13
gi|45184817|ref|NP_982535.1| AAL007Cp [Eremothecium gossypii] >g... 37 0.13
gi|23490877|gb|EAA22546.1| maebl [Plasmodium yoelii yoelii] 37 0.13
gi|39589507|emb|CAE74536.1| Hypothetical protein CBG22293 [Caeno... 37 0.13
gi|9826|emb|CAA30336.1| 11-1 polypeptide [Plasmodium falciparum] 37 0.13
gi|38073681|ref|XP_129658.4| leucine, glutamic acid, lysine fami... 37 0.13
gi|50550293|ref|XP_502619.1| hypothetical protein [Yarrowia lipo... 37 0.13
gi|46435573|gb|EAK94952.1| hypothetical protein CaO19.7762 [Cand... 37 0.13
gi|68486|pir||ISHUT1 DNA topoisomerase (EC 5.99.1.2) - human >gn... 37 0.13
gi|17569821|ref|NP_510142.1| oxygen regulated protein (XN487) [C... 37 0.13
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot... 37 0.13
gi|15606061|ref|NP_213438.1| chromosome assembly protein homolog... 37 0.13
gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans] 37 0.13
gi|28872861|ref|NP_055987.1| HBxAg transactivated protein 2 [Hom... 37 0.13
gi|17559578|ref|NP_504584.1| immunoglobulin-like and fibronectin... 37 0.13
gi|84211|pir||S00485 gene 11-1 protein precursor - malaria paras... 37 0.13
gi|7498955|pir||T34418 hypothetical protein F12F3.3 - Caenorhabd... 37 0.13
gi|6678399|ref|NP_033434.1| topoisomerase (DNA) I [Mus musculus]... 37 0.13
gi|24308157|ref|NP_060754.1| guanylate binding protein 3 [Homo s... 37 0.13
gi|46228680|gb|EAK89550.1| large protein with 3x cNMP binding do... 37 0.13
gi|23487851|gb|EAA21161.1| putative peptidyl prolyl cis-trans is... 37 0.13
gi|48135928|ref|XP_393354.1| similar to CG7971-PC [Apis mellifera] 37 0.13
gi|6319178|gb|AAF07196.1| LEK1 [Mus musculus] 37 0.13
gi|32412236|ref|XP_326598.1| predicted protein [Neurospora crass... 37 0.13
gi|12322006|gb|AAG51044.1| kinesin heavy chain, putative; 55116-... 36 0.17
gi|10998143|dbj|BAB03114.1| kinesin (centromere protein) like he... 36 0.17
gi|39584941|emb|CAE64365.1| Hypothetical protein CBG09052 [Caeno... 36 0.17
gi|284667|pir||A43427 neurofilament triplet H1 protein - rabbit ... 36 0.17
gi|30019431|ref|NP_831062.1| hypothetical protein [Bacillus cere... 36 0.17
gi|28972079|dbj|BAC65493.1| mKIAA0147 protein [Mus musculus] 36 0.17
gi|16804929|ref|NP_472958.1| hypothetical protein [Plasmodium fa... 36 0.17
gi|45478208|gb|AAS66275.1| LRRGT00184 [Rattus norvegicus] 36 0.17
gi|42572143|ref|NP_974162.1| myosin heavy chain-related [Arabido... 36 0.17
gi|14165456|ref|NP_114399.1| microtubule-associated protein 1B i... 36 0.17
gi|15240555|ref|NP_200377.1| expressed protein [Arabidopsis thal... 36 0.17
gi|23507939|ref|NP_700609.1| hypothetical protein [Plasmodium fa... 36 0.17
gi|23481108|gb|EAA17484.1| hypothetical protein [Plasmodium yoel... 36 0.17
gi|22331006|ref|NP_187809.2| kinesin motor protein-related [Arab... 36 0.17
gi|23612604|ref|NP_704165.1| hypothetical protein [Plasmodium fa... 36 0.17
gi|7511720|pir||T31069 tolloid-BMP-1 like protein 1 - California... 36 0.17
gi|9937992|ref|NP_064663.1| DIPB protein; DIPB gene; brain cDNA ... 36 0.17
gi|38566048|gb|AAH62888.1| Scrib protein [Mus musculus] 36 0.17
gi|50400983|sp|Q80U72|LAP4_MOUSE LAP4 protein (Scribble homolog ... 36 0.17
gi|26450189|dbj|BAC42213.1| unknown protein [Arabidopsis thaliana] 36 0.17
gi|601931|gb|AAA57153.1| neurofilament-H 36 0.17
gi|42526879|ref|NP_971977.1| RNB-like family protein [Treponema ... 36 0.17
gi|50551701|ref|XP_503325.1| hypothetical protein [Yarrowia lipo... 36 0.17
gi|17540128|ref|NP_501232.1| chromo domain containing protein (4... 36 0.17
gi|37360176|dbj|BAC98066.1| mKIAA0996 protein [Mus musculus] 36 0.17
gi|17367114|sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX ... 36 0.17
gi|17509687|ref|NP_491423.1| human XNP gene related (156.2 kD) (... 36 0.17
gi|20373163|ref|NP_598850.1| PDZ-domain protein scribble; Scribb... 36 0.17
gi|46227005|gb|EAK87955.1| membrane associated thioredoxin [Cryp... 36 0.17
gi|47219841|emb|CAF97111.1| unnamed protein product [Tetraodon n... 36 0.17
gi|8468621|gb|AAF75554.1| mature parasite-infected erythrocyte s... 36 0.17
gi|5174525|ref|NP_005900.1| microtubule-associated protein 1B is... 36 0.17
gi|38080839|ref|XP_358982.1| similar to endonuclease/reverse tra... 36 0.17
gi|23479635|gb|EAA16409.1| glutamic acid-rich protein precursor,... 36 0.17
gi|30699270|ref|NP_177881.2| myosin heavy chain-related [Arabido... 36 0.17
gi|39594275|emb|CAE71853.1| Hypothetical protein CBG18897 [Caeno... 36 0.17
gi|9758600|dbj|BAB09233.1| unnamed protein product [Arabidopsis ... 36 0.17
gi|50260602|gb|EAL23255.1| hypothetical protein CNBA3710 [Crypto... 36 0.17
gi|38173753|gb|AAH60689.1| Scrib protein [Mus musculus] 36 0.17
gi|30693307|ref|NP_198700.2| forkhead-associated domain-containi... 36 0.22
gi|47125165|gb|AAH70659.1| LOC431812 protein [Xenopus laevis] 36 0.22
gi|50294918|ref|XP_449870.1| unnamed protein product [Candida gl... 36 0.22
gi|39586156|emb|CAE69232.1| Hypothetical protein CBG15274 [Caeno... 36 0.22
gi|24620455|gb|AAN61519.1| 1MDa_1 protein [Caenorhabditis elegans] 36 0.22
gi|1083177|pir||A49546 DNA topoisomerase (EC 5.99.1.2) - Chinese... 36 0.22
gi|586107|sp|Q07050|TOP1_CRIGR DNA topoisomerase I >gnl|BL_ORD_I... 36 0.22
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat... 36 0.22
gi|9758061|dbj|BAB08640.1| unnamed protein product [Arabidopsis ... 36 0.22
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p... 36 0.22
gi|28828674|gb|AAO51277.1| hypothetical protein [Dictyostelium d... 36 0.22
gi|9837381|gb|AAG00552.1| retinitis pigmentosa GTPase regulator ... 36 0.22
gi|39590714|emb|CAE65084.1| Hypothetical protein CBG09942 [Caeno... 36 0.22
gi|23509309|ref|NP_701976.1| hypothetical protein [Plasmodium fa... 36 0.22
gi|46229667|gb|EAK90485.1| thioredoxin/PDI, cyanobacterial type,... 36 0.22
gi|23491364|gb|EAA22916.1| erythrocyte membrane-associated giant... 36 0.22
gi|48111808|ref|XP_396309.1| similar to hypothetical protein [Ap... 36 0.22
gi|47211645|emb|CAF92169.1| unnamed protein product [Tetraodon n... 36 0.22
gi|39592481|emb|CAE63558.1| Hypothetical protein CBG08044 [Caeno... 36 0.22
gi|13235466|emb|CAC33701.1| hypothetical protein [Rickettsia ric... 36 0.22
gi|5817598|gb|AAD52842.1| myosin heavy chain [Pecten maximus] 36 0.22
gi|46434019|gb|EAK93441.1| hypothetical protein CaO19.4162 [Cand... 36 0.22
gi|17505881|ref|NP_492824.1| vamp-associated protein like family... 36 0.22
gi|42453560|ref|ZP_00153467.1| hypothetical protein Rick041401 [... 36 0.22
gi|50556082|ref|XP_505449.1| hypothetical protein [Yarrowia lipo... 36 0.22
gi|17508321|ref|NP_493337.1| eukaryotic DNA topoisomerase I., TO... 36 0.22
gi|23482296|gb|EAA18317.1| hypothetical protein [Plasmodium yoel... 36 0.22
gi|39586604|emb|CAE69324.1| Hypothetical protein CBG15399 [Caeno... 36 0.22
gi|23490695|gb|EAA22410.1| hypothetical protein [Plasmodium yoel... 36 0.22
gi|34876008|ref|XP_344461.1| similar to zinc finger DAZ interact... 36 0.22
gi|50761757|ref|XP_424825.1| PREDICTED: similar to chromosome 9 ... 35 0.28
gi|39595819|emb|CAE67322.1| Hypothetical protein CBG12784 [Caeno... 35 0.28
gi|6322151|ref|NP_012226.1| Subunit of the CCR4-NOT complex, whi... 35 0.28
gi|50756165|ref|XP_425261.1| PREDICTED: similar to phosphoinosit... 35 0.28
gi|17544558|ref|NP_500774.1| MSP-domain protein 2 like family me... 35 0.28
gi|34869119|ref|XP_340983.1| similar to RIKEN cDNA C330027C09 [R... 35 0.28
gi|23619130|ref|NP_705092.1| chromosome segregation protein, put... 35 0.28
gi|50305341|ref|XP_452630.1| unnamed protein product [Kluyveromy... 35 0.28
gi|17541376|ref|NP_501845.1| putative nuclear protein, with a co... 35 0.28
gi|32419006|ref|XP_329981.1| hypothetical protein [Neurospora cr... 35 0.28
gi|23508148|ref|NP_700818.1| merozoite surface protein 3 [Plasmo... 35 0.28
gi|15146212|gb|AAK83589.1| AT3g57150/F24I3_230 [Arabidopsis thal... 35 0.28
gi|23619465|ref|NP_705427.1| methyltransferase, putative [Plasmo... 35 0.28
gi|49091686|ref|XP_407304.1| hypothetical protein AN3167.2 [Aspe... 35 0.28
gi|23612532|ref|NP_704093.1| hypothetical protein [Plasmodium fa... 35 0.28
gi|4995271|emb|CAB43980.1| dJ1J6.1 (topoisomerase (DNA) I) [Homo... 35 0.28
gi|13569852|ref|NP_076368.1| retinitis pigmentosa GTPase regulat... 35 0.28
gi|39595024|emb|CAE70892.1| Hypothetical protein CBG17683 [Caeno... 35 0.28
gi|48859553|ref|ZP_00313486.1| COG1196: Chromosome segregation A... 35 0.28
gi|50290531|ref|XP_447697.1| unnamed protein product [Candida gl... 35 0.28
gi|11225260|ref|NP_003277.1| DNA topoisomerase I; type I DNA top... 35 0.28
gi|25148570|ref|NP_740973.1| M protein repeat containing protein... 35 0.28
gi|39581535|emb|CAE64271.1| Hypothetical protein CBG08922 [Caeno... 35 0.28
gi|46137999|ref|XP_390690.1| hypothetical protein FG10514.1 [Gib... 35 0.28
gi|39591638|emb|CAE71215.1| Hypothetical protein CBG18078 [Caeno... 35 0.28
gi|3044185|gb|AAC13303.1| mature parasite-infected erythrocyte s... 35 0.28
gi|46122985|ref|XP_386046.1| hypothetical protein FG05870.1 [Gib... 35 0.28
gi|50419029|ref|XP_458036.1| unnamed protein product [Debaryomyc... 35 0.28
gi|46431856|gb|EAK91379.1| hypothetical protein CaO19.7818 [Cand... 35 0.28
gi|19112004|ref|NP_595212.1| hypothetical protein [Schizosacchar... 35 0.28
gi|23489737|gb|EAA21674.1| mature-parasite-infected erythrocyte ... 35 0.28
gi|39580737|emb|CAE64123.1| Hypothetical protein CBG08739 [Caeno... 35 0.28
gi|1107512|emb|CAA62539.1| ORF2 [Bacteriophage A511] 35 0.28
gi|23509042|ref|NP_701710.1| hypothetical protein [Plasmodium fa... 35 0.28
gi|16758254|ref|NP_445949.1| cyclic nucleotide-gated cation chan... 35 0.28
gi|45501396|gb|AAH67349.1| Unknown (protein for IMAGE:6378027) [... 35 0.28
gi|2493742|sp|Q62927|CNG1_RAT cGMP-gated cation channel alpha 1 ... 35 0.28
gi|23509352|ref|NP_702019.1| hypothetical protein [Plasmodium fa... 35 0.28
gi|17542530|ref|NP_502432.1| RNA Binding Domain protein (98.0 kD... 35 0.28
gi|23484716|gb|EAA19952.1| hypothetical protein [Plasmodium yoel... 35 0.28
gi|50412385|ref|XP_457128.1| unnamed protein product [Debaryomyc... 35 0.28
gi|26325886|dbj|BAC26697.1| unnamed protein product [Mus musculus] 35 0.28
gi|473581|gb|AAB60379.1| DNA topoisomerase I 35 0.28
gi|473583|gb|AAB60380.1| DNA topoisomerase I 35 0.28
gi|7443375|pir||S70458 plasminogen-binding M-like protein (Pd 56... 35 0.28
gi|12838850|dbj|BAB24353.1| unnamed protein product [Mus musculus] 35 0.37
gi|38086943|ref|XP_136135.2| RIKEN cDNA 5330432J06 [Mus musculus] 35 0.37
gi|482393|pir||A45669 neurofilament triplet M protein - rat >gnl... 35 0.37
gi|2136369|pir||I54367 X-linked nuclear protein - human >gnl|BL_... 35 0.37
gi|8393823|ref|NP_058725.1| neurofilament 3, medium; Neurofilame... 35 0.37
gi|28949944|emb|CAD70930.1| related to wound-responsive protein ... 35 0.37
gi|7494129|pir||T18296 myosin heavy chain - Entamoeba histolytic... 35 0.37
gi|48840689|ref|ZP_00297615.1| COG2219: Eukaryotic-type DNA prim... 35 0.37
gi|33872820|gb|AAH04475.1| TOP1 protein [Homo sapiens] 35 0.37
gi|39587824|emb|CAE67842.1| Hypothetical protein CBG13429 [Caeno... 35 0.37
gi|15242427|ref|NP_199365.1| hypothetical protein [Arabidopsis t... 35 0.37
gi|26326305|dbj|BAC26896.1| unnamed protein product [Mus musculus] 35 0.37
gi|23480522|gb|EAA17059.1| putative copper efflux ATPase [Plasmo... 35 0.37
gi|1709261|sp|P54938|NFM_RABIT Neurofilament triplet M protein (... 35 0.37
gi|29789160|ref|NP_080176.1| DEK oncogene (DNA binding) [Mus mus... 35 0.37
gi|33416321|gb|AAH55451.1| DEK oncogene (DNA binding) [Mus muscu... 35 0.37
gi|12841160|dbj|BAB25100.1| unnamed protein product [Mus musculus] 35 0.37
gi|15425681|dbj|BAB64297.1| I-connectin [Procambarus clarkii] 35 0.37
gi|23508149|ref|NP_700819.1| merozoite surface protein 6 [Plasmo... 35 0.37
gi|42374892|gb|AAS13446.1| merozoite surface protein 6 [Plasmodi... 35 0.37
gi|32418656|ref|XP_329806.1| hypothetical protein [Neurospora cr... 35 0.37
gi|50426497|ref|XP_461845.1| unnamed protein product [Debaryomyc... 35 0.37
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 35 0.37
gi|26337331|dbj|BAC32351.1| unnamed protein product [Mus musculus] 35 0.37
gi|128150|sp|P12839|NFM_RAT Neurofilament triplet M protein (160... 35 0.37
gi|246049|gb|AAB21495.1| neurofilament protein M [rats, Peptide ... 35 0.37
gi|15668510|ref|NP_247308.1| M. jannaschii predicted coding regi... 35 0.37
gi|39595358|emb|CAE60395.1| Hypothetical protein CBG03997 [Caeno... 35 0.37
gi|32413022|ref|XP_326991.1| hypothetical protein [Neurospora cr... 35 0.37
gi|46442648|gb|EAL01936.1| hypothetical protein CaO19.11806 [Can... 35 0.37
gi|39596781|emb|CAE59008.1| Hypothetical protein CBG02284 [Caeno... 35 0.37
gi|27802723|emb|CAD60828.1| SI:bZ1D10.2 (novel protein similar t... 35 0.37
gi|17565434|ref|NP_504585.1| fibronectin, type III and M protein... 35 0.37
gi|6323007|ref|NP_013079.1| Component of the polarisome, which f... 35 0.37
gi|39589597|emb|CAE66832.1| Hypothetical protein CBG12202 [Caeno... 35 0.37
gi|46226825|gb|EAK87791.1| Noc3 like protein involved in nuclear... 35 0.37
gi|15612032|ref|NP_223684.1| METHIONYL-TRNA SYNTHETASE [Helicoba... 35 0.37
gi|42780481|ref|NP_977728.1| conserved hypothetical protein [Bac... 35 0.37
gi|39581019|emb|CAE72500.1| Hypothetical protein CBG19679 [Caeno... 35 0.37
gi|50290483|ref|XP_447673.1| unnamed protein product [Candida gl... 35 0.48
gi|34763716|ref|ZP_00144638.1| Chromosome partition protein smc ... 35 0.48
gi|45185103|ref|NP_982820.1| ABL127Wp [Eremothecium gossypii] >g... 35 0.48
gi|31216396|ref|XP_316223.1| ENSANGP00000017802 [Anopheles gambi... 35 0.48
gi|6679048|ref|NP_032717.1| neurofilament 3, medium; neurofilame... 35 0.48
gi|37515182|gb|AAF60628.2| Hypothetical protein Y46H3C.6 [Caenor... 35 0.48
gi|31746635|gb|AAP68941.1| Troponin t protein 2, isoform a [Caen... 35 0.48
gi|17558380|ref|NP_504774.1| putative nuclear protein, with a co... 35 0.48
gi|23481834|gb|EAA17992.1| probable RNA 3'-terminal phosphate cy... 35 0.48
gi|41629667|ref|NP_009389.2| Transcriptional modulator involved ... 35 0.48
gi|24644332|ref|NP_730971.1| CG31551-PA [Drosophila melanogaster... 35 0.48
gi|46441098|gb|EAL00398.1| hypothetical protein CaO19.13055 [Can... 35 0.48
gi|15234968|ref|NP_195630.1| expressed protein [Arabidopsis thal... 35 0.48
gi|23508512|ref|NP_701181.1| hypothetical protein [Plasmodium fa... 35 0.48
gi|21309834|gb|AAM19759.1| glutamic acid-rich protein cNBL1500 [... 35 0.48
gi|45550734|ref|NP_650019.2| CG14692-PA [Drosophila melanogaster... 35 0.48
gi|38080233|ref|XP_132137.2| RIKEN cDNA 2310011G06 [Mus musculus] 35 0.48
gi|50312415|ref|XP_456241.1| unnamed protein product [Kluyveromy... 35 0.48
gi|23482103|gb|EAA18183.1| hypothetical protein [Plasmodium yoel... 35 0.48
gi|23508177|ref|NP_700847.1| gene 11-1 protein precursor [Plasmo... 35 0.48
gi|50510497|dbj|BAD32234.1| mKIAA0480 protein [Mus musculus] 35 0.48
gi|23479048|gb|EAA15981.1| ring-infected erythrocyte surface ant... 35 0.48
gi|39586319|emb|CAE66730.1| Hypothetical protein CBG12079 [Caeno... 35 0.48
gi|47939723|gb|AAH72145.1| MGC80064 protein [Xenopus laevis] 35 0.48
gi|26342124|dbj|BAC34724.1| unnamed protein product [Mus musculus] 35 0.48
gi|23509656|ref|NP_702323.1| hypothetical protein [Plasmodium fa... 35 0.48
gi|25990101|gb|AAN75020.1| chromosome scaffold protein p85 [Mone... 35 0.48
gi|47225394|emb|CAG11877.1| unnamed protein product [Tetraodon n... 35 0.48
gi|50408706|ref|XP_456805.1| unnamed protein product [Debaryomyc... 35 0.48
gi|23481567|gb|EAA17806.1| hypothetical protein [Plasmodium yoel... 35 0.48
gi|14591553|ref|NP_143635.1| chromosome assembly protein [Pyroco... 35 0.48
gi|18410791|ref|NP_565104.1| expressed protein [Arabidopsis thal... 35 0.48
gi|46580664|ref|YP_011472.1| conserved hypothetical protein TIGR... 35 0.48
gi|2133452|pir||S65469 DNA topoisomerase (EC 5.99.1.2) - Caenorh... 35 0.48
gi|6010435|gb|AAF01135.1| erythrocyte membrane protein 3 [Plasmo... 35 0.48
gi|49481764|ref|YP_034811.1| possible internalin protein [Bacill... 35 0.48
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 35 0.48
gi|46442513|gb|EAL01802.1| hypothetical protein CaO19.4330 [Cand... 35 0.48
gi|15920601|ref|NP_376270.1| 115aa long hypothetical protein [Su... 35 0.48
gi|17565810|ref|NP_503485.1| putative protein family member, wit... 35 0.48
gi|29243964|ref|NP_808268.1| hypothetical protein 4931417A20 [Mu... 35 0.48
gi|17568063|ref|NP_509479.1| troponin T (tnt-2) [Caenorhabditis ... 35 0.48
gi|24585169|ref|NP_724173.1| CG31797-PA [Drosophila melanogaster... 35 0.48
gi|46227123|gb|EAK88073.1| hypothetical protein, transcripts ide... 35 0.48
gi|23481889|gb|EAA18034.1| immediate early protein homolog [Plas... 35 0.48
gi|15644689|ref|NP_206859.1| hypothetical protein HP0059 [Helico... 35 0.48
gi|33440491|gb|AAH56140.1| PNN protein [Danio rerio] 35 0.48
gi|16804919|ref|NP_472948.1| erythrocyte membrane protein 3 [Pla... 35 0.48
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur... 35 0.48
gi|23479124|gb|EAA16038.1| repeat organellar protein-related [Pl... 35 0.48
gi|27881943|gb|AAH44500.1| LOC407619 protein [Danio rerio] 35 0.48
gi|12005803|gb|AAG44627.1| BAT2-iso [Homo sapiens] 35 0.48
gi|7494190|pir||T18423 hypothetical protein C0150w - malaria par... 35 0.48
gi|39581964|emb|CAE73826.1| Hypothetical protein CBG21388 [Caeno... 35 0.48
gi|23508971|ref|NP_701639.1| 101 kd malaria antigen [Plasmodium ... 35 0.48
gi|23480531|gb|EAA17067.1| mature-parasite-infected erythrocyte ... 35 0.48
gi|1934847|emb|CAA65537.1| DNA topoisomerase; DNA topoisomerase ... 35 0.48
gi|19682979|gb|AAL92604.1| similar to expressed protein; protein... 35 0.48
gi|23957710|ref|NP_473163.2| hypothetical protein, conserved [Pl... 35 0.48
gi|486970|pir||S36721 DEP1 protein - yeast (Saccharomyces cerevi... 35 0.48
gi|29789008|ref|NP_036404.1| Huntingtin interacting protein C [H... 34 0.63
gi|6322676|ref|NP_012749.1| Essential protein required for the m... 34 0.63
gi|19698568|gb|AAL93211.1| Baf57 [Xenopus laevis] 34 0.63
gi|28279129|gb|AAH45875.1| Wu:fi20g04 protein [Danio rerio] 34 0.63
gi|27371255|gb|AAH41216.1| MGC52696 protein [Xenopus laevis] 34 0.63
gi|192363|gb|AAA37364.1| calspermin 34 0.63
gi|11360040|pir||T46402 hypothetical protein DKFZp434H2121.1 - h... 34 0.63
gi|40218526|gb|AAR83180.1| LPXTG anchored putative adhesin [Stre... 34 0.63
gi|50756763|ref|XP_415310.1| PREDICTED: similar to heavy neurofi... 34 0.63
gi|46228494|gb|EAK89364.1| coiled coil protein [Cryptosporidium ... 34 0.63
gi|7484811|pir||T01393 apoptosis inhibitor homolog T4I9.12 - Ara... 34 0.63
gi|23619423|ref|NP_705385.1| hypothetical protein [Plasmodium fa... 34 0.63
gi|50554961|ref|XP_504889.1| hypothetical protein [Yarrowia lipo... 34 0.63
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 34 0.63
gi|17505635|ref|NP_491917.1| putative nuclear protein, with 2 co... 34 0.63
gi|23509159|ref|NP_701827.1| hypothetical protein [Plasmodium fa... 34 0.63
gi|50259202|gb|EAL21875.1| hypothetical protein CNBC0160 [Crypto... 34 0.63
gi|23957777|ref|NP_473326.2| hypothetical protein [Plasmodium fa... 34 0.63
gi|387512|gb|AAA39933.1| Ca2+/Calmodulin-dependent protein kinase 34 0.63
gi|50551075|ref|XP_503011.1| hypothetical protein [Yarrowia lipo... 34 0.63
gi|20908094|tpg|DAA00021.1| TPA: TITIN [Drosophila melanogaster] 34 0.63
gi|39598193|emb|CAE68885.1| Hypothetical protein CBG14851 [Caeno... 34 0.63
gi|31227282|ref|XP_317857.1| ENSANGP00000014192 [Anopheles gambi... 34 0.63
gi|25151561|ref|NP_741667.1| protein tyrosine phosphatase family... 34 0.63
gi|23478152|gb|EAA15316.1| hypothetical protein [Plasmodium yoel... 34 0.63
gi|21389505|ref|NP_653321.1| multiple coiled-coil GABABR1-bindin... 34 0.63
gi|49901196|gb|AAH76308.1| Unknown (protein for IMAGE:7116684) [... 34 0.63
gi|25986817|gb|AAM93744.1| heat shock protein 90 [Rhynchopus sp.... 34 0.63
gi|30682987|ref|NP_196568.2| expressed protein [Arabidopsis thal... 34 0.63
gi|26326213|dbj|BAC26850.1| unnamed protein product [Mus musculu... 34 0.63
gi|23508469|ref|NP_701138.1| hypothetical protein [Plasmodium fa... 34 0.63
gi|23479871|gb|EAA16587.1| R27-2 protein [Plasmodium yoelii yoelii] 34 0.63
gi|28436730|gb|AAH47075.1| Multiple coiled-coil GABABR1-binding ... 34 0.63
gi|6753252|ref|NP_033923.1| calcium/calmodulin-dependent protein... 34 0.63
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n... 34 0.63
gi|21553446|gb|AAM62539.1| unknown [Arabidopsis thaliana] >gnl|B... 34 0.63
gi|226386|prf||1509336A ryanodine receptor 34 0.63
gi|134134|sp|P11716|RYR1_RABIT Ryanodine receptor 1 (Skeletal mu... 34 0.63
gi|15607012|ref|NP_214394.1| initiation factor IF-2 [Aquifex aeo... 34 0.63
gi|20807578|ref|NP_622749.1| conserved hypothetical protein [The... 34 0.63
gi|23486501|gb|EAA20811.1| hypothetical protein [Plasmodium yoel... 34 0.63
gi|46440978|gb|EAL00279.1| hypothetical protein CaO19.5612 [Cand... 34 0.63
gi|23613291|ref|NP_703613.1| minichromosome maintenance protein ... 34 0.63
gi|42566260|ref|NP_192209.2| expressed protein [Arabidopsis thal... 34 0.63
gi|32410929|ref|XP_325945.1| hypothetical protein [Neurospora cr... 34 0.63
gi|13235475|emb|CAC33634.1| hypothetical protein [Rickettsia mon... 34 0.63
gi|192367|gb|AAA37366.1| brain Ca++/calmodulin-dependent protein... 34 0.63
>gi|17558932|ref|NP_507675.1| putative nuclear protein, with a
coiled coil-4 domain (5T288) [Caenorhabditis elegans]
gi|7497928|pir||T20224 hypothetical protein C54E10.6 -
Caenorhabditis elegans
gi|3924718|emb|CAB03999.1| Hypothetical protein C54E10.6
[Caenorhabditis elegans]
Length = 112
Score = 221 bits (563), Expect = 3e-57
Identities = 112/112 (100%), Positives = 112/112 (100%)
Frame = -1
Query: 339 MSEISIKRAHENEKDAEEDMEPATKKIKSDDVTEEQEKPEIVEKAEKVKSMKKEEAGSLK 160
MSEISIKRAHENEKDAEEDMEPATKKIKSDDVTEEQEKPEIVEKAEKVKSMKKEEAGSLK
Sbjct: 1 MSEISIKRAHENEKDAEEDMEPATKKIKSDDVTEEQEKPEIVEKAEKVKSMKKEEAGSLK 60
Query: 159 SPPNDEMESEFTHVLNELSKQKETIKKLLDDLRADNKKRKTHNIRTIFQRKD 4
SPPNDEMESEFTHVLNELSKQKETIKKLLDDLRADNKKRKTHNIRTIFQRKD
Sbjct: 61 SPPNDEMESEFTHVLNELSKQKETIKKLLDDLRADNKKRKTHNIRTIFQRKD 112