Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C53A5_12
(938 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17565624|ref|NP_506608.1| g-protein-linked acetylcholine rece... 527 e-148
gi|33186643|gb|AAP97492.1| muscarinic acetylcholine receptor lar... 527 e-148
gi|39589872|emb|CAE60870.1| Hypothetical protein CBG04581 [Caeno... 485 e-136
gi|7497844|pir||T20171 hypothetical protein C53A5.12 - Caenorhab... 438 e-121
gi|31211039|ref|XP_314486.1| ENSANGP00000020598 [Anopheles gambi... 107 3e-22
gi|18409567|gb|AAL67911.1| muscarinic receptor 3 [Cavia porcellus] 105 1e-21
gi|15149489|ref|NP_150372.1| cholinergic receptor, muscarinic 3,... 105 1e-21
gi|47218153|emb|CAG10073.1| unnamed protein product [Tetraodon n... 105 2e-21
gi|27806259|ref|NP_776695.1| cholinergic receptor, muscarinic 3 ... 105 2e-21
gi|6978653|ref|NP_036659.1| cholinergic receptor, muscarinic 3 [... 104 2e-21
gi|113127|sp|P08483|ACM3_RAT Muscarinic acetylcholine receptor M... 104 2e-21
gi|7592983|dbj|BAA94481.1| muscarinic acetylcholine receptor m3 ... 104 2e-21
gi|30231250|ref|NP_840086.1| cholinergic receptor, muscarinic 2 ... 104 2e-21
gi|92493|pir||A29476 muscarinic acetylcholine receptor M4 - rat ... 104 3e-21
gi|14194443|sp|Q9N2A4|ACM3_PANTR Muscarinic acetylcholine recept... 104 3e-21
gi|4502819|ref|NP_000731.1| cholinergic receptor, muscarinic 3; ... 104 3e-21
gi|24762610|ref|NP_726440.1| CG4356-PA [Drosophila melanogaster]... 104 3e-21
gi|85058|pir||S05661 muscarinic acetylcholine receptor - fruit f... 104 3e-21
gi|24762612|ref|NP_523844.2| CG4356-PB [Drosophila melanogaster]... 104 3e-21
gi|113126|sp|P11483|ACM3_PIG Muscarinic acetylcholine receptor M... 103 4e-21
gi|14194442|sp|Q9N2A3|ACM3_GORGO Muscarinic acetylcholine recept... 103 4e-21
gi|14573541|gb|AAK68114.1| m3 muscarinic cholinergic receptor [H... 103 4e-21
gi|14194441|sp|Q9N2A2|ACM3_PONPY Muscarinic acetylcholine recept... 103 7e-21
gi|47522888|ref|NP_999199.1| muscarinic acetylcholine receptor [... 103 7e-21
gi|30583775|gb|AAP36136.1| Homo sapiens cholinergic receptor, mu... 102 9e-21
gi|14573537|gb|AAK68112.1| m1 muscarinic cholinergic receptor [H... 102 9e-21
gi|18409560|gb|AAL67909.1| muscarinic receptor 1 [Cavia porcellus] 102 9e-21
gi|47219776|emb|CAG03403.1| unnamed protein product [Tetraodon n... 102 9e-21
gi|37622910|ref|NP_000729.2| cholinergic receptor, muscarinic 1;... 102 9e-21
gi|3023248|sp|P56489|ACM1_MACMU Muscarinic acetylcholine recepto... 102 9e-21
gi|32318|emb|CAA33334.1| unnamed protein product [Homo sapiens] 102 9e-21
gi|31542388|ref|NP_031724.2| cholinergic receptor, muscarinic 1,... 102 1e-20
gi|18249941|ref|NP_542951.1| cholinergic receptor, muscarinic 1;... 102 1e-20
gi|45429983|ref|NP_991352.1| cholinergic receptor, muscarinic 5;... 102 2e-20
gi|88173|pir||JT0530 muscarinic acetylcholine receptor M5 - human 102 2e-20
gi|27469809|gb|AAH41805.1| Cholinergic receptor, muscarinic 5 [H... 102 2e-20
gi|3023249|sp|P56490|ACM5_MACMU Muscarinic acetylcholine recepto... 102 2e-20
gi|46250436|gb|AAH68528.1| CHRM5 protein [Homo sapiens] 102 2e-20
gi|7108336|ref|NP_036257.1| cholinergic receptor, muscarinic 5; ... 102 2e-20
gi|14573545|gb|AAK68116.1| m5 muscarinic cholinergic receptor [H... 102 2e-20
gi|8393123|ref|NP_059058.1| muscarinic acetylcholine receptor M5... 102 2e-20
gi|21693518|gb|AAM75334.1| CHRM3 [Macaca mulatta] 101 3e-20
gi|47224545|emb|CAG03529.1| unnamed protein product [Tetraodon n... 100 4e-20
gi|18409573|gb|AAL67913.1| muscarinic receptor 5 [Cavia porcellus] 100 4e-20
gi|113117|sp|P16395|ACM1_DROME Muscarinic acetylcholine receptor... 100 5e-20
gi|47230256|emb|CAG10670.1| unnamed protein product [Tetraodon n... 100 5e-20
gi|47209657|emb|CAF92462.1| unnamed protein product [Tetraodon n... 100 6e-20
gi|47216350|emb|CAG02408.1| unnamed protein product [Tetraodon n... 100 6e-20
gi|32394376|gb|AAK93794.1| M5 muscarinic receptor [Danio rerio] 100 8e-20
gi|45382331|ref|NP_990730.1| M3 muscarinic acetylcholine recepto... 100 8e-20
gi|18409563|gb|AAL67910.1| muscarinic receptor 2 [Cavia porcellus] 99 1e-19
gi|50748996|ref|XP_426437.1| PREDICTED: similar to M5 muscarinic... 99 1e-19
gi|6601553|gb|AAF19027.1| M5 muscarinic acetylcholine receptor [... 99 1e-19
gi|86345|pir||A40972 muscarinic acetylcholine receptor M2 - chicken 99 1e-19
gi|231489|sp|P30372|ACM2_CHICK Muscarinic acetylcholine receptor... 99 1e-19
gi|50728950|ref|XP_416359.1| PREDICTED: similar to m2 muscarinic... 99 1e-19
gi|47226768|emb|CAG06610.1| unnamed protein product [Tetraodon n... 99 2e-19
gi|38605066|sp|Q9N2A7|ACM2_PANTR Muscarinic acetylcholine recept... 98 3e-19
gi|7592979|dbj|BAA94479.1| muscarinic acetylcholine receptor m2 ... 98 3e-19
gi|13591922|ref|NP_112278.1| muscarinic receptor m2 [Rattus norv... 98 3e-19
gi|4502817|ref|NP_000730.1| cholinergic receptor, muscarinic 2; ... 98 3e-19
gi|12643977|sp|P10980|ACM2_RAT Muscarinic acetylcholine receptor... 98 3e-19
gi|47523590|ref|NP_999426.1| cardiac muscarinic acetylcholine re... 98 3e-19
gi|89243|pir||A27386 muscarinic acetylcholine receptor, cardiac ... 98 3e-19
gi|92491|pir||JH0197 muscarinic acetylcholine receptor M2 - rat 98 3e-19
gi|45237189|ref|NP_987076.1| cholinergic receptor, muscarinic 2,... 98 3e-19
gi|48104347|ref|XP_395760.1| similar to muscarinic acetylcholine... 98 3e-19
gi|156743|gb|AAA85449.1| muscarinic acetylcholine receptor 97 4e-19
gi|91095|pir||A31897 muscarinic acetylcholine receptor M1 - mouse 97 4e-19
gi|113119|sp|P12657|ACM1_MOUSE Muscarinic acetylcholine receptor... 97 4e-19
gi|1085217|pir||S48657 muscarinic acetylcholine receptor MR - Af... 97 7e-19
gi|231490|sp|P30544|ACM4_XENLA Muscarinic acetylcholine receptor... 97 7e-19
gi|4502821|ref|NP_000732.1| cholinergic receptor, muscarinic 4; ... 96 9e-19
gi|113128|sp|P17200|ACM4_CHICK Muscarinic acetylcholine receptor... 96 9e-19
gi|50748131|ref|XP_421119.1| PREDICTED: similar to muscarinic ac... 96 9e-19
gi|23503039|sp|P08173|ACM4_HUMAN Muscarinic acetylcholine recept... 96 9e-19
gi|92494|pir||C29514 muscarinic acetylcholine receptor M4 - rat 96 1e-18
gi|18409570|gb|AAL67912.1| muscarinic receptor 4 [Cavia porcellus] 96 1e-18
gi|14573543|gb|AAK68115.1| m4 muscarinic cholinergic receptor [H... 96 2e-18
gi|113130|sp|P08485|ACM4_RAT Muscarinic acetylcholine receptor M4 95 3e-18
gi|202666|gb|AAA40663.1| muscarinic acetylcholine receptor m4 95 3e-18
gi|6680940|ref|NP_031725.1| cholinergic receptor, muscarinic 4; ... 95 3e-18
gi|34857374|ref|XP_345404.1| cholinergic receptor, muscarin 4 [R... 95 3e-18
gi|14573539|gb|AAK68113.1| m2 muscarinic cholinergic receptor [H... 92 2e-17
gi|38232109|gb|AAR14893.1| M2 muscarinic acetylcholine receptor ... 91 4e-17
gi|47220599|emb|CAG05625.1| unnamed protein product [Tetraodon n... 91 5e-17
gi|21928448|dbj|BAC05814.1| seven transmembrane helix receptor [... 85 3e-15
gi|48102991|ref|XP_395477.1| similar to CG7918-PA [Apis mellifera] 78 2e-13
gi|24644966|ref|NP_649764.1| CG7918-PA [Drosophila melanogaster]... 77 6e-13
gi|31209163|ref|XP_313548.1| ENSANGP00000000343 [Anopheles gambi... 77 7e-13
gi|4878017|gb|AAD31538.1| muscarinic acetylcholine receptor subt... 74 6e-12
gi|32564238|ref|NP_741186.2| g-protein-linked acetylcholine rece... 67 4e-10
gi|32564236|ref|NP_741187.2| g-protein-linked acetylcholine rece... 66 1e-09
gi|39594842|emb|CAE70710.1| Hypothetical protein CBG17450 [Caeno... 66 1e-09
gi|26251523|gb|AAN84802.1| G-protein-linked acetylcholine recept... 66 1e-09
gi|25151102|ref|NP_741188.1| g-protein-linked acetylcholine rece... 66 1e-09
gi|25395795|pir||D88479 protein F47D12.1 [imported] - Caenorhabd... 66 1e-09
gi|22532905|gb|AAM98012.1| G-protein-linked acetylcholine recept... 66 1e-09
gi|38258252|sp|Q9N2B2|HH1R_PANTR Histamine H1 receptor >gnl|BL_O... 65 2e-09
gi|48428168|sp|Q9N2B0|HH1R_PONPY Histamine H1 receptor >gnl|BL_O... 65 2e-09
gi|4504491|ref|NP_000852.1| histamine receptor H1; histamine rec... 65 2e-09
gi|7592954|dbj|BAA94467.1| histamine H1 receptor [Gorilla gorilla] 65 2e-09
gi|38174245|gb|AAH60802.1| Histamine receptor H1 [Homo sapiens] 65 2e-09
gi|399889|sp|P31389|HH1R_CAVPO Histamine H1 receptor >gnl|BL_ORD... 65 3e-09
gi|25149888|ref|NP_741815.1| g-protein-linked acetylcholine rece... 63 8e-09
gi|25149880|ref|NP_741816.1| g-protein-linked acetylcholine rece... 63 8e-09
gi|25149883|ref|NP_741817.1| g-protein-linked acetylcholine rece... 63 8e-09
gi|39585854|emb|CAE61268.1| Hypothetical protein CBG05078 [Caeno... 63 8e-09
gi|7496040|pir||T15504 hypothetical protein C15B12.5 - Caenorhab... 63 1e-08
gi|1655414|dbj|BAA08791.1| histamine H1 receptor [Mus musculus] 62 1e-08
gi|14626729|gb|AAK71646.1| histamine receptor H1 [Rattus norvegi... 62 1e-08
gi|31542963|ref|NP_032311.2| histamine receptor H 1; Histamine H... 62 1e-08
gi|14538040|gb|AAK66778.1| histamine receptor H1 [Mus musculus] 62 1e-08
gi|14626725|gb|AAK71644.1| histamine receptor H1 [Rattus norvegi... 62 1e-08
gi|14626745|gb|AAK71654.1| histamine receptor H1 [Mus musculus] ... 62 1e-08
gi|8393564|ref|NP_058714.1| histamine receptor H 1; Histamine re... 62 1e-08
gi|9711356|dbj|BAB07823.1| muscarinic acetylcholine receptor M4 ... 62 2e-08
gi|47213181|emb|CAF95370.1| unnamed protein product [Tetraodon n... 61 3e-08
gi|27806585|ref|NP_776508.1| histamine H1 receptor [Bos taurus] ... 61 3e-08
gi|7227910|sp|O77408|OAR1_LYMST OCTOPAMINE RECEPTOR 1 (OA1) >gnl... 61 4e-08
gi|6224984|sp|O70528|5H4_CAVPO 5-hydroxytryptamine 4 receptor (5... 61 4e-08
gi|50737187|ref|XP_426079.1| PREDICTED: similar to histamine H3 ... 60 5e-08
gi|50754733|ref|XP_414481.1| PREDICTED: similar to serotonin rec... 60 5e-08
gi|6226822|sp|Q93126|GRE1_BALAM Probable G protein-coupled recep... 60 7e-08
gi|40643226|emb|CAC79538.1| serotonin receptor 5-HT4 [Homo sapiens] 60 9e-08
gi|1363262|pir||S55550 5-HT4S receptor - rat >gnl|BL_ORD_ID|1579... 60 9e-08
gi|3647301|emb|CAA70775.1| serotonin 4 receptor [Mus musculus] 60 9e-08
gi|2584765|emb|CAA70774.1| serotonin 4 receptor [Homo sapiens] >... 60 9e-08
gi|6900062|emb|CAB71316.1| 5-HT4 receptor [Homo sapiens] 60 9e-08
gi|6981060|ref|NP_036985.1| 5-hydroxytryptamine (serotonin) rece... 60 9e-08
gi|3646424|emb|CAA09599.1| serotonin 4 receptor [Rattus norvegicus] 60 9e-08
gi|3647303|emb|CAA70776.1| serotonin 4 receptor [Mus musculus] 60 9e-08
gi|6680325|ref|NP_032339.1| 5 hydroxytryptamine receptor 4; sero... 60 9e-08
gi|26005719|emb|CAD58392.1| 5-hydroxytryptamine 4 receptor subun... 60 9e-08
gi|11321563|ref|NP_000861.1| 5-hydroxytryptamine (serotonin) rec... 60 9e-08
gi|3326989|emb|CAA73108.1| 5-HT4 receptor [Homo sapiens] 60 9e-08
gi|3326991|emb|CAA73109.1| 5-HT4 receptor [Homo sapiens] 60 9e-08
gi|12274906|emb|CAC22251.1| 5-hydroxytryptamine4 receptor [Homo ... 60 9e-08
gi|41282074|ref|NP_955525.1| 5-hydroxytryptamine (serotonin) rec... 60 9e-08
gi|3646355|emb|CAA09598.1| serotonin 4 receptor [Mus musculus] 60 9e-08
gi|1510125|dbj|BAA11424.1| G protein-coupled receptor [Balanus a... 59 1e-07
gi|15420533|gb|AAK97379.1| histamine H4 receptor [Cavia porcellus] 59 1e-07
gi|47216965|emb|CAG04907.1| unnamed protein product [Tetraodon n... 59 2e-07
gi|37606093|emb|CAE49238.1| SI:bZ34G2.4 (novel protein similar t... 58 3e-07
gi|2494931|sp|Q16951|5HT2_APLCA 5-HYDROXYTRYPTAMINE 2 RECEPTOR (... 58 3e-07
gi|47229858|emb|CAG07054.1| unnamed protein product [Tetraodon n... 58 3e-07
gi|38678755|gb|AAR26369.1| 5-hydroxytryptamine receptor 4 [Sus s... 58 3e-07
gi|45439382|gb|AAS18239.2| 5-hydroxytryptamine receptor 4 [Sus s... 58 3e-07
gi|47575845|ref|NP_001001267.1| serotonin 4A receptor (5-HT4A); ... 58 3e-07
gi|3941555|gb|AAC82385.1| putative odorant receptor LOR22 [Lampe... 57 5e-07
gi|50754527|ref|XP_425153.1| PREDICTED: similar to histamine H1 ... 57 5e-07
gi|32765778|gb|AAP87365.1| 5-hydroxytryptamine receptor 4 [Equus... 57 6e-07
gi|14538035|gb|AAK66776.1| histamine receptor H1 [Mus musculus] 57 8e-07
gi|39596321|emb|CAE69959.1| Hypothetical protein CBG16350 [Caeno... 57 8e-07
gi|7504744|pir||T29877 hypothetical protein F59C12.2 - Caenorhab... 56 1e-06
gi|25147926|ref|NP_741944.1| SERotonin/octopamine receptor subun... 56 1e-06
gi|17569447|ref|NP_510684.1| SERotonin/octopamine receptor subun... 56 1e-06
gi|86790|pir||JH0447 alpha-1A-adrenergic receptor - human >gnl|B... 56 1e-06
gi|3182885|sp|O02666|A1AD_RABIT Alpha-1D adrenergic receptor (Al... 56 1e-06
gi|2494930|sp|Q16950|5HT1_APLCA 5-hydroxytryptamine 1 receptor (... 56 1e-06
gi|111359|pir||A38731 alpha-1A adrenergic receptor - rat >gnl|BL... 56 1e-06
gi|7690135|gb|AAB31163.2| alpha adrenergic receptor subtype alph... 56 1e-06
gi|4501957|ref|NP_000669.1| alpha-1D-adrenergic receptor; adrene... 56 1e-06
gi|13324696|ref|NP_077809.1| adrenergic receptor, alpha 1d; adre... 56 1e-06
gi|241214|gb|AAB20701.1| alpha 1-adrenergic receptor subtype alp... 56 1e-06
gi|34328059|ref|NP_038488.1| adrenergic receptor, alpha 1d [Mus ... 56 1e-06
gi|2494932|sp|Q17239|5HT_BOMMO 5-HYDROXYTRYPTAMINE RECEPTOR (5-H... 55 2e-06
gi|47207357|emb|CAF93600.1| unnamed protein product [Tetraodon n... 55 2e-06
gi|26351717|dbj|BAC39495.1| unnamed protein product [Mus musculus] 55 3e-06
gi|31542114|ref|NP_038489.2| adrenergic receptor, alpha 1a; adre... 55 3e-06
gi|20141255|sp|P97718|A1AA_MOUSE Alpha-1A adrenergic receptor (A... 55 3e-06
gi|33089868|gb|AAP93817.1| octopamine receptor [Periplaneta amer... 54 4e-06
gi|47219388|emb|CAG01551.1| unnamed protein product [Tetraodon n... 54 4e-06
gi|3023364|sp|O42574|B1AR_XENLA Beta-1 adrenergic receptor (Beta... 54 4e-06
gi|6114881|emb|CAB59347.1| alpha-1D adrenergic receptor [Sus scr... 54 4e-06
gi|47219320|emb|CAG10949.1| unnamed protein product [Tetraodon n... 54 5e-06
gi|50736344|ref|XP_426066.1| PREDICTED: similar to Galanin recep... 54 5e-06
gi|47212001|emb|CAF92745.1| unnamed protein product [Tetraodon n... 54 7e-06
gi|24646335|ref|NP_650212.1| CG6989-PA [Drosophila melanogaster]... 54 7e-06
gi|27806213|ref|NP_776923.1| adrenergic, alpha 1A, receptor [adr... 54 7e-06
gi|6563386|emb|CAB62570.1| alpha-1A adrenergic receptor [Sus scr... 54 7e-06
gi|50756803|ref|XP_425280.1| PREDICTED: similar to Adenosine A2a... 53 9e-06
gi|31198011|ref|XP_307953.1| ENSANGP00000013461 [Anopheles gambi... 53 9e-06
gi|30016935|gb|AAO92605.1| octopamine receptor [Apis mellifera] 53 9e-06
gi|31206907|ref|XP_312420.1| ENSANGP00000003015 [Anopheles gambi... 53 9e-06
gi|37987893|emb|CAD67999.1| octopamine receptor [Apis mellifera] 53 9e-06
gi|47215070|emb|CAG04524.1| unnamed protein product [Tetraodon n... 53 9e-06
gi|48098584|ref|XP_392093.1| similar to octopamine receptor [Api... 53 9e-06
gi|47523052|ref|NP_999287.1| histamine H4 receptor [Sus scrofa] ... 53 9e-06
gi|15451761|ref|NP_150647.1| alpha-1A-adrenergic receptor isofor... 53 1e-05
gi|4261905|gb|AAD14205.1| alpha 1c-adrenoceptor subtype [Homo sa... 53 1e-05
gi|25014090|ref|NP_663758.1| melatonin receptor 1B; MT2 melatoni... 53 1e-05
gi|15451759|ref|NP_150646.1| alpha-1A-adrenergic receptor isofor... 53 1e-05
gi|28269720|gb|AAL85489.3| MT2 melatonin receptor [Mus musculus] 53 1e-05
gi|48096886|ref|XP_394798.1| similar to ENSANGP00000013461 [Apis... 53 1e-05
gi|24648491|ref|NP_524669.2| CG3856-PB [Drosophila melanogaster]... 53 1e-05
gi|3153891|gb|AAC17442.1| octopamine receptor OAMB [Drosophila m... 53 1e-05
gi|48526616|gb|AAT45507.1| histamine receptor H4 subtype [Pan tr... 53 1e-05
gi|15451757|ref|NP_150645.1| alpha-1A-adrenergic receptor isofor... 53 1e-05
gi|2147113|pir||I47013 alpha 1c-adrenoceptor subtype - rabbit (f... 53 1e-05
gi|3892952|gb|AAC78396.1| serotonin receptor [Ascaris suum] 53 1e-05
gi|48526618|gb|AAT45508.1| histamine receptor H4 subtype [Gorill... 53 1e-05
gi|23346507|ref|NP_694727.1| histamine H4 receptor [Mus musculus... 53 1e-05
gi|10241847|dbj|BAB13698.1| histamine H4 receptor [Homo sapiens] 53 1e-05
gi|15822541|gb|AAL09297.1| histamine receptor H4 [Homo sapiens] 53 1e-05
gi|639573|gb|AAB30835.1| alpha 1c-adrenoceptor, alpha 1c-AR [hum... 53 1e-05
gi|14251205|ref|NP_067637.2| histamine H4 receptor [Homo sapiens... 53 1e-05
gi|1168247|sp|P43140|A1AA_RAT Alpha-1A adrenergic receptor (Alph... 53 1e-05
gi|666893|gb|AAB59486.1| alpha-1C-adrenergic receptor 53 1e-05
gi|50753666|ref|XP_414080.1| PREDICTED: similar to Galanin recep... 53 1e-05
gi|8392870|ref|NP_058887.1| adrenergic receptor, alpha 1a; adren... 53 1e-05
gi|15004694|gb|AAK77197.1| adrenergic receptor alpha-1a [Homo sa... 53 1e-05
gi|409029|gb|AAA93114.1| alpha1C adrenergic receptor 53 1e-05
gi|4501961|ref|NP_000671.1| alpha-1A-adrenergic receptor isoform... 53 1e-05
gi|47224013|emb|CAG12842.1| unnamed protein product [Tetraodon n... 53 1e-05
gi|1168246|sp|P35348|A1AA_HUMAN Alpha-1A adrenergic receptor (Al... 53 1e-05
gi|24648487|ref|NP_732541.1| CG3856-PA [Drosophila melanogaster]... 52 1e-05
gi|28894840|gb|AAO61442.1| Hypothetical protein C09B7.1c [Caenor... 52 1e-05
gi|25151203|ref|NP_741731.1| rhodopsin-like GPCR superfamily (47... 52 1e-05
gi|28630991|gb|AAO45883.1| serotonin receptor protein [Haemonchu... 52 1e-05
gi|50729576|ref|XP_416570.1| PREDICTED: similar to dopamine rece... 52 1e-05
gi|25151199|ref|NP_741730.1| rhodopsin-like GPCR superfamily (49... 52 1e-05
gi|34860506|ref|XP_345900.1| similar to Mel1b melatonin receptor... 52 1e-05
gi|547222|gb|AAB31165.1| alpha adrenergic receptor subtype alpha... 52 1e-05
gi|47228218|emb|CAG07613.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|47214321|emb|CAG11192.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|31204329|ref|XP_311113.1| ENSANGP00000004731 [Anopheles gambi... 52 2e-05
gi|48116265|ref|XP_393187.1| similar to G-protein coupled recept... 52 2e-05
gi|37622140|gb|AAQ95165.1| adenosine A2A receptor [Equus caballus] 52 2e-05
gi|37625045|gb|AAQ95735.1| dopamine receptor D2 [Mustela putoriu... 52 2e-05
gi|3941549|gb|AAC82382.1| putative odorant receptor LOR4 [Lampet... 52 2e-05
gi|39591067|emb|CAE58847.1| Hypothetical protein CBG02068 [Caeno... 52 2e-05
gi|2494997|sp|Q62805|GALR_RAT Galanin receptor type 1 (GAL1-R) (... 52 2e-05
gi|12229835|sp|Q93127|GRE2_BALAM Probable G protein-coupled rece... 52 2e-05
gi|8843927|gb|AAF80169.1| alpha 1a-adrenoceptor isoform 3 [Oryct... 52 3e-05
gi|22531331|emb|CAD12656.1| thyrotropin-releasing hormone recept... 52 3e-05
gi|112301|pir||JH0315 serotonin receptor 1A - rat >gnl|BL_ORD_ID... 52 3e-05
gi|17551118|ref|NP_508238.1| 5-hydroxytryptamine receptor (XB915... 52 3e-05
gi|8843925|gb|AAF80168.1| alpha 1a-adrenoceptor isoform 2 [Oryct... 52 3e-05
gi|18777763|ref|NP_571984.1| histamine H4 receptor [Rattus norve... 52 3e-05
gi|226700|prf||1603358B D2 dopamine receptor 2in 52 3e-05
gi|6753680|ref|NP_034207.1| dopamine receptor 2; D2 receptor [Mu... 52 3e-05
gi|288118|emb|CAA37373.1| D2 dopamine receptor [Rattus norvegicus] 52 3e-05
gi|203906|gb|AAA41075.1| dopamine receptor subtype D2 >gnl|BL_OR... 52 3e-05
gi|14916519|sp|Q9WU25|A1AA_CAVPO Alpha-1A adrenergic receptor (A... 52 3e-05
gi|27461808|gb|AAN08044.1| serotonin receptor 1A [Canis familiaris] 52 3e-05
gi|3023219|sp|O02824|A1AA_RABIT Alpha-1A adrenergic receptor (Al... 52 3e-05
gi|31227069|ref|XP_317820.1| ENSANGP00000004842 [Anopheles gambi... 52 3e-05
gi|33439694|gb|AAP12466.1| 5-HT1A receptor; serotonin receptor 1... 52 3e-05
gi|33439696|gb|AAP12467.1| 5-HT1A receptor; serotonin receptor 1... 52 3e-05
gi|478273|pir||JC1525 alpha-1B-adrenergic receptor - rat >gnl|BL... 51 3e-05
gi|24644036|ref|NP_524223.2| CG1056-PA [Drosophila melanogaster]... 51 3e-05
gi|992988|emb|CAA57429.1| serotonin receptor 5-HT2 subtype [Dros... 51 3e-05
gi|16768736|gb|AAL28587.1| HL07802p [Drosophila melanogaster] 51 3e-05
gi|24644034|ref|NP_730859.1| CG1056-PB [Drosophila melanogaster]... 51 3e-05
gi|27806203|ref|NP_776922.1| adenosine A1 receptor [Bos taurus] ... 51 3e-05
gi|112934|sp|P11616|AA1R_CANFA Adenosine A1 receptor >gnl|BL_ORD... 51 3e-05
gi|112933|sp|P28190|AA1R_BOVIN Adenosine A1 receptor >gnl|BL_ORD... 51 3e-05
gi|118208|sp|P24628|D2D1_XENLA D(2) dopamine receptor 1 >gnl|BL_... 51 3e-05
gi|112871|sp|P18841|A1AB_MESAU Alpha-1B adrenergic receptor (Alp... 51 4e-05
gi|28212218|ref|NP_783190.1| trace amine receptor 10 [Rattus nor... 51 4e-05
gi|21322662|emb|CAC87882.1| alpha2 b1 adrenergic receptor [Takif... 51 4e-05
gi|7242702|emb|CAB77262.1| G-protein coupled receptor [Lymnaea s... 51 4e-05
gi|7242708|emb|CAB77265.1| G-protein coupled receptor [Lymnaea s... 51 4e-05
gi|4501947|ref|NP_000665.1| adenosine A1 receptor [Homo sapiens]... 51 4e-05
gi|47575853|ref|NP_058687.2| adrenergic receptor, alpha 1b; Adre... 50 6e-05
gi|55558|emb|CAA35934.1| unnamed protein product [Rattus norvegi... 50 6e-05
gi|12836418|dbj|BAB23647.1| unnamed protein product [Mus musculu... 50 6e-05
gi|543734|sp|P15823|A1AB_RAT Alpha-1B adrenergic receptor (Alpha... 50 6e-05
gi|202764|gb|AAA63478.1| alpha-1B adrenergic receptor 50 6e-05
gi|7381416|gb|AAF61479.1| dopamine receptor D2longer [Homo sapie... 50 6e-05
gi|1352060|sp|P47899|B1AR_MACMU Beta-1 adrenergic receptor (Beta... 50 6e-05
gi|47223740|emb|CAF98510.1| unnamed protein product [Tetraodon n... 50 6e-05
gi|2494944|sp|P79148|B1AR_CANFA Beta-1 adrenergic receptor (Beta... 50 6e-05
gi|4503385|ref|NP_000786.1| dopamine receptor D2 isoform long [H... 50 6e-05
gi|11344837|gb|AAG34494.1| dopamine D2 receptor [Canis familiari... 50 6e-05
gi|7593001|dbj|BAA94490.1| serotonin receptor 1A [Gorilla gorilla] 50 6e-05
gi|38257779|sp|Q9N298|5H1A_PANTR 5-hydroxytryptamine 1A receptor... 50 6e-05
gi|405310|gb|AAB26819.1| D2 dopamine receptor [Homo sapiens] 50 6e-05
gi|48428167|sp|Q9N296|5H1A_PONPY 5-hydroxytryptamine 1A receptor... 50 6e-05
gi|231454|sp|P08908|5H1A_HUMAN 5-hydroxytryptamine 1A receptor (... 50 6e-05
gi|3820492|gb|AAC78779.1| dopamine D2 receptor [Homo sapiens] 50 6e-05
gi|1706283|sp|P52702|D2DR_CERAE D(2) dopamine receptor >gnl|BL_O... 50 6e-05
gi|50754742|ref|XP_414483.1| PREDICTED: similar to alpha-1-adren... 50 6e-05
gi|1542954|emb|CAA69208.1| 5-HT1A receptor [Xenopus laevis] 50 6e-05
gi|27371132|gb|AAH37002.1| Adra1b protein [Mus musculus] 50 6e-05
gi|6680660|ref|NP_031442.1| adrenergic receptor, alpha 1b; alpha... 50 6e-05
gi|449413|prf||1919247A beta1 adrenergic receptor 50 6e-05
gi|1709047|sp|P51050|ML1B_CHICK MELATONIN RECEPTOR TYPE 1B (MEL-... 50 6e-05
gi|11344838|gb|AAG34495.1| dopamine D2 receptor short isoform [C... 50 6e-05
gi|17986270|ref|NP_057658.2| dopamine receptor D2 isoform short ... 50 6e-05
gi|11344842|gb|AAG34497.1| dopamine D2 receptor short isoform [C... 50 6e-05
gi|2506484|sp|P49217|ML1A_PHOSU Melatonin receptor type 1A (Mel-... 50 6e-05
gi|226699|prf||1603358A D2 dopamine receptor 2in 50 6e-05
gi|27806647|ref|NP_776468.1| dopamine receptor D2 [Bos taurus] >... 50 6e-05
gi|2144114|pir||I48095 A2 adenosine receptor - guinea pig >gnl|B... 50 6e-05
gi|50731175|ref|XP_417201.1| PREDICTED: similar to Mel-1b melato... 50 6e-05
gi|2494922|sp|Q64264|5H1A_MOUSE 5-hydroxytryptamine 1A receptor ... 50 6e-05
gi|31542972|ref|NP_032334.2| 5-hydroxytryptamine (serotonin) rec... 50 6e-05
gi|26329619|dbj|BAC28548.1| unnamed protein product [Mus musculus] 50 6e-05
gi|2494934|sp|Q25414|5HT_LYMST 5-HYDROXYTRYPTAMINE RECEPTOR (5-H... 50 7e-05
gi|17367264|sp|Q9Y5N1|HH3R_HUMAN Histamine H3 receptor (HH3R) (G... 50 7e-05
gi|6005782|ref|NP_009163.1| histamine receptor H3; G protein-cou... 50 7e-05
gi|14270361|emb|CAC39434.1| histamine H3 receptor [Homo sapiens] 50 7e-05
gi|29124991|gb|AAO63757.1| histamine receptor H3 [Macaca mulatta] 50 7e-05
gi|11022653|dbj|BAB17030.1| G-protein coupled receptor [Homo sap... 50 7e-05
gi|50753763|ref|XP_425117.1| PREDICTED: similar to SI:bZ34G2.4 (... 50 7e-05
gi|22760363|dbj|BAC11167.1| unnamed protein product [Homo sapiens] 50 7e-05
gi|1351830|sp|P47745|AA1R_CAVPO Adenosine A1 receptor >gnl|BL_OR... 50 7e-05
gi|27753985|ref|NP_766400.1| 5-hydroxytryptamine (serotonin) rec... 50 7e-05
gi|8393583|ref|NP_058950.1| 5-hydroxytryptamine (serotonin) rece... 50 7e-05
gi|112299|pir||A34863 serotonin receptor 2 - rat 50 7e-05
gi|92749|pir||S02011 serotonin receptor 2 - rat >gnl|BL_ORD_ID|3... 50 7e-05
gi|18461387|gb|AAL71914.1| histamine H3 receptor isoform 4 [Homo... 50 7e-05
gi|16751917|ref|NP_444508.1| G protein-coupled receptor 102 [Hom... 50 7e-05
gi|13937082|gb|AAK50040.1| histamine receptor H3S [Homo sapiens]... 50 7e-05
gi|37499136|gb|AAQ91625.1| dopamine D1/beta receptor [Branchiost... 50 1e-04
gi|19527066|ref|NP_598610.1| histamine receptor H 3 [Mus musculu... 50 1e-04
gi|2137123|pir||I48931 adenosine receptor subtype - mouse (fragm... 50 1e-04
gi|345733|pir||A45121 alpha-1B adrenergic receptor - human 50 1e-04
gi|1168245|sp|P35368|A1AB_HUMAN Alpha-1B adrenergic receptor (Al... 50 1e-04
gi|17366878|sp|Q9JI35|HH3R_CAVPO Histamine H3 receptor (HH3R) >g... 50 1e-04
gi|71942|pir||DYHUD4 dopamine receptor D4 - human >gnl|BL_ORD_ID... 50 1e-04
gi|32483397|ref|NP_000788.2| dopamine receptor D4; D(2C) dopamin... 50 1e-04
gi|21928798|dbj|BAC05985.1| seven transmembrane helix receptor [... 50 1e-04
gi|6002906|gb|AAF00191.1| melatonin receptor Mel1a [Oncorhynchus... 50 1e-04
gi|6981054|ref|NP_036717.1| 5-hydroxytryptamine (serotonin) rece... 50 1e-04
gi|48429211|sp|P08588|B1AR_HUMAN Beta-1 adrenergic receptor (Bet... 50 1e-04
gi|50731215|ref|XP_425628.1| PREDICTED: similar to 5-hydroxytryp... 50 1e-04
gi|22137512|gb|AAH28947.1| Hrh3 protein [Mus musculus] 50 1e-04
gi|50749504|ref|XP_421666.1| PREDICTED: similar to serotonin 5-h... 50 1e-04
gi|17508713|ref|NP_491954.1| SERotonin/octopamine receptor subun... 50 1e-04
gi|20141278|sp|Q60612|AA1R_MOUSE Adenosine A1 receptor >gnl|BL_O... 50 1e-04
gi|45331206|ref|NP_033759.1| adenosine A1 receptor [Mus musculus... 50 1e-04
gi|26332821|dbj|BAC30128.1| unnamed protein product [Mus musculus] 50 1e-04
gi|2827766|sp|P25099|AA1R_RAT Adenosine A1 receptor >gnl|BL_ORD_... 50 1e-04
gi|47523012|ref|NP_999266.1| 5-HT1F receptor [Sus scrofa] >gnl|B... 50 1e-04
gi|1345939|sp|P21917|D4DR_HUMAN D(4) dopamine receptor (D(2C) do... 50 1e-04
gi|48101926|ref|XP_395249.1| similar to 5-hydroxytryptamine rece... 50 1e-04
gi|112870|sp|P11615|A1AB_CANFA Alpha-1B adrenergic receptor (Alp... 50 1e-04
gi|8745525|gb|AAF78950.1| histamine H3 receptor H3S isoform [Cav... 50 1e-04
gi|11878213|gb|AAG40849.1| thyrotropin-releasing hormone recepto... 50 1e-04
gi|22531335|emb|CAD12658.1| thyrotropin-releasing hormone recept... 50 1e-04
gi|547221|gb|AAB31164.1| alpha adrenergic receptor subtype alpha... 50 1e-04
gi|20072999|gb|AAH26602.1| Adora1 protein [Mus musculus] 50 1e-04
gi|47217541|emb|CAG02468.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|6981044|ref|NP_037097.1| histamine receptor H 2; Histamine H2... 49 1e-04
gi|21309892|gb|AAM46088.1| G-protein-coupled 5-hydroxytryptamine... 49 1e-04
gi|48113331|ref|XP_396348.1| similar to ENSANGP00000018804 [Apis... 49 1e-04
gi|39595802|emb|CAE67305.1| Hypothetical protein CBG12758 [Caeno... 49 1e-04
gi|20857625|ref|XP_136993.1| similar to trace amine receptor 4 [... 49 1e-04
gi|48119433|ref|XP_396445.1| similar to CG6919-PA [Apis mellifera] 49 1e-04
gi|461912|sp|P34973|D2D2_XENLA D(2) DOPAMINE RECEPTOR 2 >gnl|BL_... 49 1e-04
gi|28212240|ref|NP_783174.1| trace amine receptor 4 [Rattus norv... 49 1e-04
gi|38014514|gb|AAH60426.1| MGC68724 protein [Xenopus laevis] 49 1e-04
gi|112936|sp|P11617|AA2A_CANFA Adenosine A2a receptor >gnl|BL_OR... 49 1e-04
gi|31206149|ref|XP_312026.1| ENSANGP00000018804 [Anopheles gambi... 49 1e-04
gi|46518508|ref|NP_997520.1| adrenergic, alpha-2A-, receptor [Da... 49 1e-04
gi|10719976|sp|O73810|D2DR_MELGA D(2) dopamine receptor >gnl|BL_... 49 1e-04
gi|123119|sp|P17124|HH2R_CANFA Histamine H2 receptor (H2R) (Gast... 49 1e-04
gi|47210163|emb|CAF95187.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|50760224|ref|XP_425811.1| PREDICTED: similar to D2 dopamine r... 49 1e-04
gi|17864132|ref|NP_524599.1| CG12073-PA [Drosophila melanogaster... 49 1e-04
gi|103373|pir||A38271 serotonin receptor 7 - fruit fly (Drosophi... 49 1e-04
gi|21322664|emb|CAC87883.2| alpha2 b2 adrenergic receptor [Takif... 49 1e-04
gi|16758264|ref|NP_445958.1| histamine receptor H3 [Rattus norve... 49 2e-04
gi|30584307|gb|AAP36402.1| Homo sapiens adenosine A2a receptor [... 49 2e-04
gi|1857133|gb|AAB48391.1| Mel-1c(b) melatonin receptor [Xenopus ... 49 2e-04
gi|3023201|sp|O08892|5H1B_CAVPO 5-hydroxytryptamine 1B receptor ... 49 2e-04
gi|6681589|dbj|BAA88767.1| G protein-coupled receptor [Rattus no... 49 2e-04
gi|477410|pir||A48978 adenosine receptor A2a - human >gnl|BL_ORD... 49 2e-04
gi|47212818|emb|CAF93441.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|5921992|ref|NP_000666.2| adenosine A2a receptor; adenosine A2... 49 2e-04
gi|6678954|ref|NP_032665.1| melatonin receptor 1A; Mel1a recepto... 49 2e-04
gi|461445|sp|P34970|AA1R_RABIT Adenosine A1 receptor >gnl|BL_ORD... 49 2e-04
gi|1345606|sp|P49145|5H1D_RABIT 5-hydroxytryptamine 1D receptor ... 49 2e-04
gi|2148993|gb|AAB58466.1| 5-HT1D alpha receptor 49 2e-04
gi|47522982|ref|NP_999250.1| serotonin 5-hydroxytryptamine 7-a r... 49 2e-04
gi|177892|gb|AAA58356.1| adenosine receptor 49 2e-04
gi|6681590|dbj|BAA88768.1| G protein-coupled receptor [Rattus no... 49 2e-04
gi|6224982|sp|O42385|5H1A_FUGRU 5-hydroxytryptamine 1A-alpha rec... 49 2e-04
gi|37962670|gb|AAR05654.1| serotonin receptor [Cavia porcellus] 49 2e-04
gi|8885888|gb|AAF80280.1| alpha 1b adrenoceptor [Oryctolagus cun... 49 2e-04
gi|5921171|sp|Q28998|B1AR_PIG Beta-1 adrenergic receptor (Beta-1... 49 2e-04
gi|6754258|ref|NP_034612.1| 5-hydroxytryptamine (serotonin) rece... 49 2e-04
gi|47226641|emb|CAG07800.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|13430410|gb|AAK25827.1| serotonin receptor 5HT1B [Mesocricetu... 49 2e-04
gi|11560016|ref|NP_071561.1| 5-hydroxytryptamine (serotonin) rec... 49 2e-04
gi|9789727|sp|P56971|CB1R_POEGU Cannabinoid receptor 1 (CB1) (CB... 49 2e-04
gi|33439700|gb|AAP12469.1| 5-HT1B receptor [Canis familiaris] >g... 49 2e-04
gi|33439698|gb|AAP12468.1| 5-HT1B receptor; serotonin receptor 1... 49 2e-04
gi|45331303|gb|AAS57919.1| type 2 serotonin receptor [Panulirus ... 49 2e-04
gi|7441613|pir||S71323 alpha-1A adrenergic receptor - Japanese m... 49 2e-04
gi|50759025|ref|XP_425705.1| PREDICTED: similar to histamine H3 ... 49 2e-04
gi|28212264|ref|NP_783191.1| trace amine receptor 7 [Rattus norv... 49 2e-04
gi|2494929|sp|Q91559|5H7_XENLA 5-hydroxytryptamine 7 receptor (5... 49 2e-04
gi|10567524|gb|AAG18471.1| melatonin receptor [Rattus norvegicus] 49 2e-04
gi|6680321|ref|NP_032336.1| 5-hydroxytryptamine (serotonin) rece... 49 2e-04
gi|111409|pir||S12591 beta-1-adrenergic receptor - rat 49 2e-04
gi|34850746|ref|NP_919242.1| adrenergic, beta-1-, receptor [Bos ... 49 2e-04
gi|6226559|sp|Q28927|B1AR_SHEEP Beta-1 adrenergic receptor (Beta... 49 2e-04
gi|12643864|sp|Q9TT96|B1AR_BOVIN Beta-1 adrenergic receptor (Bet... 49 2e-04
gi|45382489|ref|NP_990692.1| Mel-1c melatonin receptor [Gallus g... 49 2e-04
gi|1438750|gb|AAB36304.1| beta 1-adrenergic receptor [Ovis aries] 49 2e-04
gi|12858052|dbj|BAB31185.1| unnamed protein product [Mus musculus] 49 2e-04
gi|38090436|ref|XP_137001.2| similar to trace amine receptor 10 ... 49 2e-04
gi|2494939|sp|Q91175|A1AA_ORYLA Alpha-1A adrenergic receptor (Al... 49 2e-04
gi|7592933|dbj|BAA94457.1| 5-hydroxytryptamine (serotonin) recep... 49 2e-04
gi|4504533|ref|NP_000854.1| 5-hydroxytryptamine (serotonin) rece... 49 2e-04
gi|50747652|ref|XP_420947.1| PREDICTED: similar to D4B Dopamine ... 49 2e-04
gi|4505477|ref|NP_002522.1| neurotensin receptor 1 [Homo sapiens... 49 2e-04
gi|38016885|gb|AAR07901.1| neurotensin receptor 1 [Homo sapiens] 49 2e-04
gi|12313997|emb|CAC12747.1| dJ885L7.1.1 (neurotensin receptor 1 ... 49 2e-04
gi|6680666|ref|NP_031445.1| adrenergic receptor, beta 1; beta 1-... 49 2e-04
gi|4504537|ref|NP_000856.1| 5-hydroxytryptamine (serotonin) rece... 49 2e-04
gi|220671|dbj|BAA00527.1| beta-1 adrenergic receptor [Rattus nor... 49 2e-04
gi|6978459|ref|NP_036833.1| adrenergic receptor, beta 1; Adrener... 49 2e-04
gi|4504531|ref|NP_000515.1| 5-hydroxytryptamine (serotonin) rece... 49 2e-04
gi|225717|prf||1311340A G protein coupled receptor 49 2e-04
gi|38503207|sp|Q9N2B6|5H1E_PANTR 5-hydroxytryptamine 1E receptor... 49 2e-04
gi|7592942|dbj|BAA94461.1| 5-hydroxytryptamine (serotonin) recep... 49 2e-04
gi|4504547|ref|NP_000863.1| 5-hydroxytryptamine receptor 7 isofo... 48 3e-04
gi|50744958|ref|XP_426191.1| PREDICTED: similar to CB1 cannabino... 48 3e-04
gi|602290|gb|AAA57202.1| brain-type cannabinoid receptor [Mus mu... 48 3e-04
gi|6978673|ref|NP_036916.1| cannabinoid receptor 1 [Rattus norve... 48 3e-04
gi|6724315|ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus ... 48 3e-04
gi|38683844|ref|NP_057167.2| central cannabinoid receptor isofor... 48 3e-04
gi|3121835|sp|O02777|CB1R_FELCA Cannabinoid receptor 1 (CB1) (CB... 48 3e-04
gi|4959367|gb|AAD34320.1| central cannabinoid receptor [Homo sap... 48 3e-04
gi|10880131|ref|NP_062874.1| 5-hydroxytryptamine receptor 7 isof... 48 3e-04
gi|10880129|ref|NP_062873.1| 5-hydroxytryptamine receptor 7 isof... 48 3e-04
gi|2340857|emb|CAA74973.1| D1B Dopamine receptor [Cyprinus carpio] 48 3e-04
gi|37622423|gb|AAQ95277.1| type 1 serotonin receptor 5HT-1Hel [H... 48 3e-04
gi|238377|gb|AAB20242.1| 5-HT2 receptor=serotoninergic receptor ... 48 3e-04
gi|112806|sp|P18599|5H2A_CRIGR 5-hydroxytryptamine 2A receptor (... 48 3e-04
gi|48098493|ref|XP_392074.1| dopamine receptor type D2 [Apis mel... 48 3e-04
gi|3023200|sp|O08890|5H1F_CAVPO 5-hydroxytryptamine 1F receptor ... 48 3e-04
gi|47216298|emb|CAF96594.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|45382491|ref|NP_990693.1| Mel-1a melatonin receptor [Gallus g... 48 3e-04
gi|37625043|gb|AAQ95734.1| dopamine receptor D4 [Mustela putoriu... 48 3e-04
gi|48098558|ref|XP_394102.1| similar to CG18208-PA [Apis mellifera] 48 3e-04
gi|10441571|gb|AAG17109.1| P2.6 melatonin receptor Mel-1B [Esox ... 48 3e-04
gi|42539178|gb|AAS18607.1| type 1 serotonin receptor [Panulirus ... 48 3e-04
gi|10257395|gb|AAG15397.1| 5-hydroxytryptamine 1B receptor [Sus ... 48 3e-04
gi|6815243|dbj|BAA90456.1| 5-hydroxytryptamine (serotonin) recep... 48 3e-04
gi|15208648|ref|NP_149421.1| central cannabinoid receptor isofor... 48 3e-04
gi|3023218|sp|O02667|AA3R_RABIT Adenosine A3 receptor >gnl|BL_OR... 48 3e-04
gi|38090430|ref|XP_136991.2| similar to trace amine receptor 2 [... 48 4e-04
gi|18033259|gb|AAL57042.1| SPPR-1 [Homo sapiens] 48 4e-04
gi|45383518|ref|NP_989647.1| adenosine A1 receptor [Gallus gallu... 48 4e-04
gi|17555606|ref|NP_497452.1| SERotonin/octopamine receptor subun... 48 4e-04
gi|3023205|sp|P56496|5H1B_SPAEH 5-hydroxytryptamine 1B receptor ... 48 4e-04
gi|4102984|gb|AAD01634.1| histamine H2 receptor [Mus musculus] >... 48 4e-04
gi|8477168|gb|AAB29946.2| thyrotropin-releasing hormone receptor... 48 4e-04
gi|2137020|pir||S68422 serotonin receptor 1D beta - rabbit >gnl|... 48 4e-04
gi|28173558|ref|NP_778237.1| trace amine receptor 4 [Homo sapien... 48 4e-04
gi|13540517|ref|NP_110387.1| endothelial differentiation, sphing... 48 4e-04
gi|1857129|gb|AAB48389.1| Mel-1c(a) melatonin receptor [Xenopus ... 48 4e-04
gi|8474088|gb|AAB29945.2| thyrotropin-releasing hormone receptor... 48 4e-04
gi|1346551|sp|P49219|ML1C_XENLA MELATONIN RECEPTOR TYPE 1C (MEL-... 48 4e-04
gi|4758468|ref|NP_004215.1| G protein-coupled receptor 50 [Homo ... 48 4e-04
gi|20070961|gb|AAH26340.1| ADORA1 protein [Homo sapiens] 48 4e-04
gi|4501959|ref|NP_000670.1| alpha-1B-adrenergic receptor; adrene... 48 4e-04
gi|24646326|ref|NP_731719.1| CG31350-PA [Drosophila melanogaster... 48 4e-04
gi|440548|emb|CAA54288.1| adenosine receptor A3 [Homo sapiens] 48 4e-04
gi|12829871|gb|AAK01971.1| EDG1 [Tamias striatus] 48 4e-04
gi|1345605|sp|P49144|5H1B_RABIT 5-hydroxytryptamine 1B receptor ... 48 4e-04
gi|7673007|gb|AAF66698.1| adenosine A3 receptor [Oryctolagus cun... 48 4e-04
gi|12860788|dbj|BAB32044.1| unnamed protein product [Mus musculus] 48 4e-04
gi|47222385|emb|CAG05134.1| unnamed protein product [Tetraodon n... 48 4e-04
gi|31201281|ref|XP_309588.1| ENSANGP00000010994 [Anopheles gambi... 48 4e-04
gi|47222969|emb|CAF99125.1| unnamed protein product [Tetraodon n... 48 4e-04
gi|28212246|ref|NP_783180.1| trace amine receptor 14 [Rattus nor... 47 5e-04
gi|6680275|ref|NP_032312.1| histamine receptor H 2 [Mus musculus... 47 5e-04
gi|28212238|ref|NP_783173.1| trace amine receptor 2 [Rattus norv... 47 5e-04
gi|38090432|ref|XP_136994.2| similar to trace amine receptor 8 [... 47 5e-04
gi|28212244|ref|NP_783177.1| trace amine receptor 6 [Rattus norv... 47 5e-04
gi|2981633|gb|AAC06330.1| beta 1 adrenergic protein [Sus scrofa] 47 5e-04
gi|5174595|ref|NP_005950.1| melatonin receptor 1B; melatonin rec... 47 5e-04
gi|33636340|emb|CAD71264.1| 5HT2B serotonin receptor [Xenopus la... 47 5e-04
gi|50761579|ref|XP_429136.1| PREDICTED: similar to 5-hydroxytryp... 47 5e-04
gi|6681223|ref|NP_031904.1| dopamine receptor 4 [Mus musculus] >... 47 5e-04
gi|26336416|dbj|BAC31893.1| unnamed protein product [Mus musculus] 47 5e-04
gi|1911570|gb|AAB50730.1| dopamine D4 receptor; D4 receptor [Mus... 47 5e-04
gi|30802171|gb|AAH51421.1| Drd4 protein [Mus musculus] 47 5e-04
gi|1703011|sp|P50407|5H7_CAVPO 5-hydroxytryptamine 7 receptor (5... 47 5e-04
gi|39586015|emb|CAE69091.1| Hypothetical protein CBG15112 [Caeno... 47 5e-04
gi|42662203|dbj|BAD11157.1| tyramine receptor [Bombyx mori] 47 5e-04
gi|2495004|sp|Q17232|OAR_BOMMO OCTOPAMINE RECEPTOR >gnl|BL_ORD_I... 47 5e-04
gi|34098950|ref|NP_898891.1| dopamine receptor D2a [Danio rerio]... 47 5e-04
gi|461440|sp|P32305|5H7_RAT 5-hydroxytryptamine 7 receptor (5-HT... 47 5e-04
gi|50747453|ref|XP_420880.1| PREDICTED: similar to serotonin rec... 47 5e-04
gi|12829900|gb|AAK01985.1| EDG1 [Ochotona hyperborea] 47 5e-04
gi|11177900|ref|NP_068629.1| 5-hydroxytryptamine (serotonin) rec... 47 5e-04
gi|476956|pir||A47385 serotonin receptor 1E - rat 47 5e-04
gi|50729860|ref|XP_425535.1| PREDICTED: similar to 5-hydroxytryp... 47 5e-04
gi|18875348|ref|NP_573465.1| thyrotropin releasing hormone recep... 47 5e-04
gi|47228536|emb|CAG05356.1| unnamed protein product [Tetraodon n... 47 5e-04
gi|112818|sp|P11614|5H1D_CANFA 5-hydroxytryptamine 1D receptor (... 47 5e-04
gi|12621102|ref|NP_075227.1| 5-hydroxytryptamine (serotonin) rec... 47 5e-04
>gi|17565624|ref|NP_506608.1| g-protein-linked acetylcholine receptor,
muscarinic (66.5 kD) (gar-3) [Caenorhabditis elegans]
gi|34922243|sp|Q9U7D5|ACM3_CAEEL Muscarinic acetylcholine receptor
gar-3 (G-protein linked acetylcholine receptor 3)
gi|5730928|gb|AAD48771.1| muscarinic acetylcholine receptor
[Caenorhabditis elegans]
gi|14530397|emb|CAC42272.1| Hypothetical protein Y40H4A.1a
[Caenorhabditis elegans]
gi|14530625|emb|CAA22301.2| Hypothetical protein Y40H4A.1a
[Caenorhabditis elegans]
Length = 585
Score = 527 bits (1357), Expect = e-148
Identities = 261/311 (83%), Positives = 261/311 (83%)
Frame = -3
Query: 936 SMKRDVXXXXXXXXXXSMRKKNNQDGYVEDSVTPCTSSRNSKRKSWLRNCTGKXXXXXXX 757
SMKRDV SMRKKNNQDGYVEDSVTPCTSSRNSKRKSWLRNCTGK
Sbjct: 275 SMKRDVSSTSIIKSSGSMRKKNNQDGYVEDSVTPCTSSRNSKRKSWLRNCTGKSNSSSED 334
Query: 756 XXEAVAMNLDDTXXXXXXXXXXXSRRRNISPPCTPMPTNFEDEEQTDAGASMRNGSARFR 577
EAVAMNLDDT SRRRNISPPCTPMPTNFEDEEQTDAGASMRNGSARFR
Sbjct: 335 SSEAVAMNLDDTSLSSSHFALSGSRRRNISPPCTPMPTNFEDEEQTDAGASMRNGSARFR 394
Query: 576 SRPSDTGKNNNSDTYTVLIELNDEGSRPSVRLSSCEPYLDEPISTRNRSKSDCNSEIDER 397
SRPSDTGKNNNSDTYTVLIELNDEGSRPSVRLSSCEPYLDEPISTRNRSKSDCNSEIDER
Sbjct: 395 SRPSDTGKNNNSDTYTVLIELNDEGSRPSVRLSSCEPYLDEPISTRNRSKSDCNSEIDER 454
Query: 396 RHSLLNKQSPFKNGRILKNFXXXXXXXXXXXXXXXXXXXXKAAKTLSAILCAFIATWTPY 217
RHSLLNKQSPFKNGRILKNF KAAKTLSAILCAFIATWTPY
Sbjct: 455 RHSLLNKQSPFKNGRILKNFSSQERKSEKEQRKNERKQESKAAKTLSAILCAFIATWTPY 514
Query: 216 NLIVCWEAFFPNTVPNVLWTFSYFLCYINSTINPLCYALCNARFRHTYMRILRCKFKAER 37
NLIVCWEAFFPNTVPNVLWTFSYFLCYINSTINPLCYALCNARFRHTYMRILRCKFKAER
Sbjct: 515 NLIVCWEAFFPNTVPNVLWTFSYFLCYINSTINPLCYALCNARFRHTYMRILRCKFKAER 574
Query: 36 PTMNQGYVRRN 4
PTMNQGYVRRN
Sbjct: 575 PTMNQGYVRRN 585
>gi|33186643|gb|AAP97492.1| muscarinic acetylcholine receptor large
isoform; GAR-3a [Caenorhabditis elegans]
gi|35210144|emb|CAE47465.1| Hypothetical protein Y40H4A.1b
[Caenorhabditis elegans]
gi|35210313|emb|CAE47471.1| Hypothetical protein Y40H4A.1b
[Caenorhabditis elegans]
Length = 611
Score = 527 bits (1357), Expect = e-148
Identities = 261/311 (83%), Positives = 261/311 (83%)
Frame = -3
Query: 936 SMKRDVXXXXXXXXXXSMRKKNNQDGYVEDSVTPCTSSRNSKRKSWLRNCTGKXXXXXXX 757
SMKRDV SMRKKNNQDGYVEDSVTPCTSSRNSKRKSWLRNCTGK
Sbjct: 301 SMKRDVSSTSIIKSSGSMRKKNNQDGYVEDSVTPCTSSRNSKRKSWLRNCTGKSNSSSED 360
Query: 756 XXEAVAMNLDDTXXXXXXXXXXXSRRRNISPPCTPMPTNFEDEEQTDAGASMRNGSARFR 577
EAVAMNLDDT SRRRNISPPCTPMPTNFEDEEQTDAGASMRNGSARFR
Sbjct: 361 SSEAVAMNLDDTSLSSSHFALSGSRRRNISPPCTPMPTNFEDEEQTDAGASMRNGSARFR 420
Query: 576 SRPSDTGKNNNSDTYTVLIELNDEGSRPSVRLSSCEPYLDEPISTRNRSKSDCNSEIDER 397
SRPSDTGKNNNSDTYTVLIELNDEGSRPSVRLSSCEPYLDEPISTRNRSKSDCNSEIDER
Sbjct: 421 SRPSDTGKNNNSDTYTVLIELNDEGSRPSVRLSSCEPYLDEPISTRNRSKSDCNSEIDER 480
Query: 396 RHSLLNKQSPFKNGRILKNFXXXXXXXXXXXXXXXXXXXXKAAKTLSAILCAFIATWTPY 217
RHSLLNKQSPFKNGRILKNF KAAKTLSAILCAFIATWTPY
Sbjct: 481 RHSLLNKQSPFKNGRILKNFSSQERKSEKEQRKNERKQESKAAKTLSAILCAFIATWTPY 540
Query: 216 NLIVCWEAFFPNTVPNVLWTFSYFLCYINSTINPLCYALCNARFRHTYMRILRCKFKAER 37
NLIVCWEAFFPNTVPNVLWTFSYFLCYINSTINPLCYALCNARFRHTYMRILRCKFKAER
Sbjct: 541 NLIVCWEAFFPNTVPNVLWTFSYFLCYINSTINPLCYALCNARFRHTYMRILRCKFKAER 600
Query: 36 PTMNQGYVRRN 4
PTMNQGYVRRN
Sbjct: 601 PTMNQGYVRRN 611