Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C43H6_5
         (345 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17550974|ref|NP_508437.1| myotrophin (12.5 kD) (XD27) [Caenor...   229   8e-60
gi|39591101|emb|CAE58881.1| Hypothetical protein CBG02114 [Caeno...   201   4e-51
gi|48101284|ref|XP_395092.1| similar to CG31997-PA [Apis mellifera]   113   1e-24
gi|14041712|emb|CAC38782.1| Myol protein [Suberites domuncula]        113   1e-24
gi|24583364|ref|NP_723568.1| CG31715-PA [Drosophila melanogaster...   110   7e-24
gi|45361657|ref|NP_989406.1| hypothetical protein MGC76285 [Xeno...   101   4e-21
gi|18859653|ref|NP_573347.1| CG7423-PA [Drosophila melanogaster]...    98   5e-20
gi|33417150|gb|AAH56092.1| MGC69103 protein [Xenopus laevis]           95   3e-19
gi|12832737|dbj|BAB22235.1| unnamed protein product [Mus musculus]     94   9e-19
gi|45382431|ref|NP_990217.1| V1 protein homologue [Gallus gallus...    93   1e-18
gi|6679961|ref|NP_032124.1| myotrophin; granule cell differentia...    93   1e-18
gi|30385608|gb|AAP23872.1| myotrophin [Canis familiaris]               92   3e-18
gi|47085713|ref|NP_998137.1| myotrophin [Danio rerio] >gnl|BL_OR...    92   3e-18
gi|21956645|ref|NP_665807.1| myotrophin; granule cell differenti...    92   3e-18
gi|28189340|dbj|BAC56361.1| similar to myotrophin [Bos taurus]         79   3e-14
gi|42733602|ref|NP_976238.1| myotrophin [Bos taurus] >gnl|BL_ORD...    76   2e-13
gi|47226452|emb|CAG08468.1| unnamed protein product [Tetraodon n...    62   2e-09
gi|14424228|sp|Q9ULJ7|YB23_HUMAN Hypothetical protein KIAA1223 >...    62   3e-09
gi|41195096|ref|XP_048747.4| KIAA1223 protein [Homo sapiens]           62   3e-09
gi|34856863|ref|XP_215553.2| similar to Hypothetical protein KIA...    62   3e-09
gi|19353254|gb|AAH24725.1| KIAA1223 protein [Homo sapiens]             62   3e-09
gi|50746705|ref|XP_420618.1| PREDICTED: similar to Hypothetical ...    62   3e-09
gi|38076235|ref|XP_130845.2| RIKEN cDNA E430012K20 [Mus musculus]      62   3e-09
gi|34364722|emb|CAE45806.1| hypothetical protein [Homo sapiens]        62   3e-09
gi|34534435|dbj|BAC87007.1| unnamed protein product [Homo sapiens]     62   3e-09
gi|32408383|ref|XP_324673.1| hypothetical protein [Neurospora cr...    62   4e-09
gi|47211783|emb|CAF93751.1| unnamed protein product [Tetraodon n...    61   5e-09
gi|46132175|ref|ZP_00202842.1| COG0666: FOG: Ankyrin repeat [Ral...    61   5e-09
gi|29837359|gb|AAP05764.1| notch-like transmembrane receptor LIN...    61   6e-09
gi|7385113|gb|AAF61702.1| ankyrin 1 [Bos taurus]                       60   8e-09
gi|34862664|ref|XP_220047.2| similar to tankyrase, TRF1-interact...    60   8e-09
gi|13624297|ref|NP_112435.1| ankyrin 1, erythroid; normoblastic ...    60   8e-09
gi|10947036|ref|NP_065208.1| ankyrin 1 isoform 4; ankyrin-1, ery...    60   8e-09
gi|1360744|pir||B35049 ankyrin 1, erythrocyte splice form 3 - human    60   8e-09
gi|1845265|gb|AAB47805.1| ankyrin [Homo sapiens]                       60   8e-09
gi|38085055|ref|XP_129246.4| RIKEN cDNA 5430432P15 [Mus musculus]      60   8e-09
gi|10947042|ref|NP_065210.1| ankyrin 1 isoform 2; ankyrin-1, ery...    60   8e-09
gi|1168457|sp|Q02357|ANK1_MOUSE Ankyrin 1 (Erythrocyte ankyrin) ...    60   8e-09
gi|10947038|ref|NP_065209.1| ankyrin 1 isoform 1; ankyrin-1, ery...    60   8e-09
gi|226788|prf||1605244A erythrocyte ankyrin                            60   8e-09
gi|34879099|ref|XP_240464.2| similar to ankyrin [Rattus norvegicus]    60   8e-09
gi|105337|pir||A35049 ankyrin 1, erythrocyte splice form 2 - human     60   8e-09
gi|178646|gb|AAA51732.1| ankyrin                                       60   8e-09
gi|10947040|ref|NP_000028.2| ankyrin 1 isoform 3; ankyrin-1, ery...    60   8e-09
gi|50548207|ref|XP_501573.1| hypothetical protein [Yarrowia lipo...    60   1e-08
gi|45187629|ref|NP_983852.1| ADL244Wp [Eremothecium gossypii] >g...    60   1e-08
gi|31873714|emb|CAD97827.1| hypothetical protein [Homo sapiens]        60   1e-08
gi|50748758|ref|XP_421393.1| PREDICTED: similar to hypothetical ...    60   1e-08
gi|10947054|ref|NP_066187.1| ankyrin 2 isoform 2; ankyrin, noner...    60   1e-08
gi|26350249|dbj|BAC38764.1| unnamed protein product [Mus musculus]     60   1e-08
gi|4803663|emb|CAB42644.1| ankyrin B (440 kDa) [Homo sapiens]          60   1e-08
gi|31873945|emb|CAD97900.1| hypothetical protein [Homo sapiens]        60   1e-08
gi|3202046|gb|AAC34809.1| 190 kDa ankyrin isoform; AnkG190 [Ratt...    60   1e-08
gi|1841966|gb|AAB47551.1| ankyrin [Rattus norvegicus]                  60   1e-08
gi|26350949|dbj|BAC39111.1| unnamed protein product [Mus musculus]     60   1e-08
gi|34859981|ref|XP_342338.1| similar to hypothetical protein [Ra...    60   1e-08
gi|10947052|ref|NP_001139.2| ankyrin 2 isoform 1; ankyrin, noner...    60   1e-08
gi|32967601|ref|NP_066267.2| ankyrin 3 isoform 1; ankyrin-3, nod...    60   1e-08
gi|21759000|sp|Q12955|ANK3_HUMAN Ankyrin 3 (ANK-3) (Ankyrin G) >...    60   1e-08
gi|26336659|dbj|BAC32012.1| unnamed protein product [Mus musculus]     60   1e-08
gi|6322079|ref|NP_012154.1| Subunit of the Set3 complex, which i...    60   1e-08
gi|1703310|sp|Q01484|ANK2_HUMAN Ankyrin 2 (Brain ankyrin) (Ankyr...    60   1e-08
gi|28373837|pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat ...    59   2e-08
gi|42520181|ref|NP_966096.1| ankyrin repeat domain protein [Wolb...    59   2e-08
gi|39997987|ref|NP_953938.1| ankyrin-related protein [Geobacter ...    59   2e-08
gi|48772618|ref|ZP_00276960.1| COG0666: FOG: Ankyrin repeat [Ral...    59   2e-08
gi|10953952|gb|AAG25674.1| tankyrase-related protein [Homo sapiens]    59   2e-08
gi|13376842|ref|NP_079511.1| tankyrase, TRF1-interacting ankyrin...    59   2e-08
gi|25121952|ref|NP_733924.1| ankyrin 3, epithelial isoform a; an...    59   3e-08
gi|25121950|ref|NP_733791.1| ankyrin 3, epithelial isoform e; an...    59   3e-08
gi|48137938|ref|XP_396833.1| similar to RIKEN cDNA 9230102N17 [A...    59   3e-08
gi|48097897|ref|XP_393917.1| hypothetical protein XP_393917 [Api...    59   3e-08
gi|3885972|gb|AAC78143.1| 270 kDa ankyrin G isoform [Rattus norv...    59   3e-08
gi|22129770|ref|NP_666117.1| ankyrin 3, epithelial isoform b; an...    59   3e-08
gi|26354919|dbj|BAC41086.1| unnamed protein product [Mus musculus]     59   3e-08
gi|25121946|ref|NP_733789.1| ankyrin 3, epithelial isoform c; an...    59   3e-08
gi|25121948|ref|NP_733790.1| ankyrin 3, epithelial isoform d; an...    59   3e-08
gi|26338578|dbj|BAC32960.1| unnamed protein product [Mus musculus]     58   4e-08
gi|48838377|ref|ZP_00295321.1| COG0666: FOG: Ankyrin repeat [Met...    58   4e-08
gi|11358145|pir||T49159 hypothetical protein T20N10.110 - Arabid...    58   4e-08
gi|50746761|ref|XP_420642.1| PREDICTED: similar to ankyrin 2 iso...    58   4e-08
gi|42566034|ref|NP_567074.2| ankyrin protein kinase, putative [A...    58   4e-08
gi|31208307|ref|XP_313120.1| ENSANGP00000012854 [Anopheles gambi...    58   4e-08
gi|48104469|ref|XP_395788.1| similar to ENSANGP00000006233 [Apis...    57   7e-08
gi|38344540|emb|CAD40970.2| OSJNBa0027P08.8 [Oryza sativa (japon...    57   7e-08
gi|28373835|pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat ...    57   9e-08
gi|46112797|ref|XP_383076.1| hypothetical protein FG02900.1 [Gib...    57   9e-08
gi|28524070|ref|XP_129028.2| hypothetical protein XP_129028 [Mus...    57   1e-07
gi|30249048|ref|NP_841118.1| Ankyrin-repeat [Nitrosomonas europa...    57   1e-07
gi|48138442|ref|XP_393405.1| similar to CG10011-PA [Apis mellifera]    57   1e-07
gi|3929221|gb|AAC79842.1| TRF1-interacting ankyrin-related ADP-r...    56   2e-07
gi|39580279|emb|CAE73066.1| Hypothetical protein CBG20436 [Caeno...    56   2e-07
gi|4507613|ref|NP_003738.1| tankyrase, TRF1-interacting ankyrin-...    56   2e-07
gi|45383472|ref|NP_989672.1| tankyrase, TRF1-interacting ankyrin...    56   2e-07
gi|16553719|dbj|BAB71569.1| unnamed protein product [Homo sapiens]     56   2e-07
gi|39589109|emb|CAE57841.1| Hypothetical protein CBG00870 [Caeno...    56   2e-07
gi|27735121|ref|NP_775776.1| ankyrin repeat domain 29 [Homo sapi...    56   2e-07
gi|50750204|ref|XP_421911.1| PREDICTED: similar to Ankyrin repea...    56   2e-07
gi|28201974|ref|NP_780300.1| tankyrase, TRF1-interacting ankyrin...    56   2e-07
gi|37515252|gb|AAQ91911.1| Uncoordinated protein 44, isoform g [...    56   2e-07
gi|32565937|ref|NP_500900.2| UNCoordinated locomotion UNC-44, an...    56   2e-07
gi|39593211|emb|CAE64680.1| Hypothetical protein CBG09456 [Caeno...    56   2e-07
gi|21693935|gb|AAM75382.1| Uncoordinated protein 44, isoform e [...    56   2e-07
gi|47218162|emb|CAG10082.1| unnamed protein product [Tetraodon n...    56   2e-07
gi|32565939|ref|NP_500899.2| UNCoordinated locomotion UNC-44, an...    56   2e-07
gi|34980999|gb|AAH57370.1| Tnks protein [Mus musculus]                 56   2e-07
gi|32565935|ref|NP_500902.2| UNCoordinated locomotion UNC-44, an...    56   2e-07
gi|23820861|gb|AAA93447.2| Uncoordinated protein 44, isoform f [...    56   2e-07
gi|7494531|pir||T15347 ankyrin-related unc-44 - Caenorhabditis e...    56   2e-07
gi|34878711|ref|XP_224923.2| similar to tankyrase 2 [Rattus norv...    56   2e-07
gi|45383478|ref|NP_989671.1| tankyrase, TRF1-interacting ankyrin...    56   2e-07
gi|1208876|gb|AAA93446.1| Uncoordinated protein 44, isoform b [C...    56   2e-07
gi|50749238|ref|XP_421546.1| PREDICTED: similar to ankyrin 3 iso...    56   2e-07
gi|49129321|ref|XP_412904.1| hypothetical protein AN8767.2 [Aspe...    56   2e-07
gi|50729987|ref|XP_416738.1| PREDICTED: similar to probable dual...    56   2e-07
gi|790608|gb|AAA85854.1| UNC-44                                        56   2e-07
gi|47219311|emb|CAG10940.1| unnamed protein product [Tetraodon n...    55   3e-07
gi|48139639|ref|XP_397031.1| similar to ENSANGP00000023843 [Apis...    55   3e-07
gi|48121540|ref|XP_396483.1| similar to ENSANGP00000018360 [Apis...    55   3e-07
gi|28274844|gb|AAO25687.1| ankyrin repeat protein E2_5 [syntheti...    55   3e-07
gi|47216968|emb|CAG04910.1| unnamed protein product [Tetraodon n...    55   3e-07
gi|47224507|emb|CAG08757.1| unnamed protein product [Tetraodon n...    55   3e-07
gi|49092902|ref|XP_407912.1| hypothetical protein AN3775.2 [Aspe...    55   3e-07
gi|20129611|ref|NP_609933.1| CG17492-PA [Drosophila melanogaster...    55   3e-07
gi|23130191|ref|ZP_00112010.1| COG0666: FOG: Ankyrin repeat [Nos...    55   4e-07
gi|50507461|emb|CAH04695.1| Hypothetical protein C06C3.1d [Caeno...    55   4e-07
gi|17535267|ref|NP_495994.1| smooth muscle myosin phosphatase re...    55   4e-07
gi|50415115|gb|AAH77360.1| Unknown (protein for MGC:81366) [Xeno...    55   4e-07
gi|47125198|gb|AAH70744.1| MGC83745 protein [Xenopus laevis]           55   4e-07
gi|25809195|emb|CAD57685.1| Hypothetical protein C06C3.1b [Caeno...    55   4e-07
gi|25809196|emb|CAD57686.1| Hypothetical protein C06C3.1c [Caeno...    55   4e-07
gi|31746549|gb|AAF39969.3| Variable abnormal morphology protein ...    54   6e-07
gi|34189775|gb|AAH16985.2| Unknown (protein for MGC:21968) [Homo...    54   6e-07
gi|34783587|gb|AAH50586.2| Unknown (protein for IMAGE:6159555) [...    54   6e-07
gi|49086442|ref|XP_405267.1| hypothetical protein AN1130.2 [Aspe...    54   6e-07
gi|47225182|emb|CAF98809.1| unnamed protein product [Tetraodon n...    54   6e-07
gi|27574029|pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R An...    54   6e-07
gi|34875868|ref|XP_237153.2| similar to hypothetical protein DKF...    54   6e-07
gi|50310449|ref|XP_455244.1| unnamed protein product [Kluyveromy...    54   6e-07
gi|24233530|ref|NP_710181.1| hypothetical protein DKFZp434D2328 ...    54   6e-07
gi|40215790|gb|AAR82779.1| LD31436p [Drosophila melanogaster]          54   6e-07
gi|11359960|pir||T42691 hypothetical protein DKFZp434D2328.1 - h...    54   6e-07
gi|47124718|gb|AAH70641.1| MGC81501 protein [Xenopus laevis]           54   6e-07
gi|49522384|gb|AAH75392.1| Unknown (protein for MGC:89123) [Xeno...    54   6e-07
gi|28571865|ref|NP_788733.1| CG33106-PA [Drosophila melanogaster...    54   6e-07
gi|18251232|gb|AAL65911.1| multiple ankyrin repeat single KH dom...    54   6e-07
gi|37576203|gb|AAQ93811.1| ankyrin repeat protein mbp3_5 [synthe...    54   6e-07
gi|38105972|gb|EAA52335.1| hypothetical protein MG05027.4 [Magna...    54   6e-07
gi|39645579|gb|AAH63622.1| Unknown (protein for MGC:70444) [Homo...    54   6e-07
gi|17536411|ref|NP_494276.1| variable abnormal morphology protei...    54   6e-07
gi|45508599|ref|ZP_00160937.1| COG0666: FOG: Ankyrin repeat [Ana...    54   6e-07
gi|31197921|ref|XP_307908.1| ENSANGP00000006233 [Anopheles gambi...    54   8e-07
gi|34853462|ref|XP_215457.2| similar to ankyrin repeat, family A...    54   8e-07
gi|45506040|ref|ZP_00158402.1| COG0666: FOG: Ankyrin repeat [Ana...    54   8e-07
gi|34762548|ref|ZP_00143544.1| UNC-44 ANKYRINS [Fusobacterium nu...    54   8e-07
gi|47216108|emb|CAG11176.1| unnamed protein product [Tetraodon n...    54   8e-07
gi|46118594|ref|XP_384894.1| hypothetical protein FG04718.1 [Gib...    54   8e-07
gi|50285605|ref|XP_445231.1| unnamed protein product [Candida gl...    54   8e-07
gi|31208581|ref|XP_313257.1| ENSANGP00000010409 [Anopheles gambi...    54   8e-07
gi|31197923|ref|XP_307909.1| ENSANGP00000023843 [Anopheles gambi...    54   8e-07
gi|49121845|ref|XP_412441.1| hypothetical protein AN8304.2 [Aspe...    54   8e-07
gi|26349313|dbj|BAC38296.1| unnamed protein product [Mus musculus]     54   1e-06
gi|49116595|ref|XP_412156.1| hypothetical protein AN8019.2 [Aspe...    54   1e-06
gi|42406377|gb|AAH66113.1| Ankra2 protein [Mus musculus]               54   1e-06
gi|48894685|ref|ZP_00327794.1| COG0666: FOG: Ankyrin repeat [Tri...    54   1e-06
gi|28274846|gb|AAO25688.1| ankyrin repeat protein E2_17 [synthet...    54   1e-06
gi|50737181|ref|XP_426077.1| PREDICTED: similar to ankyrin repea...    54   1e-06
gi|50806270|ref|XP_424401.1| PREDICTED: similar to ankyrin [Gall...    54   1e-06
gi|12963689|ref|NP_075961.1| ankyrin repeat, family A (RFXANK-li...    54   1e-06
gi|28274852|gb|AAO25691.1| ankyrin repeat protein E4_2 [syntheti...    54   1e-06
gi|34864697|ref|XP_236353.2| similar to hypothetical protein [Ra...    53   1e-06
gi|37625031|gb|AAQ96339.1| putative ankyrin-repeat protein [Viti...    53   1e-06
gi|45552223|ref|NP_995634.1| CG11020-PB [Drosophila melanogaster...    53   1e-06
gi|50751670|ref|XP_422505.1| PREDICTED: similar to ankyrin [Gall...    53   1e-06
gi|46445449|gb|EAL04717.1| hypothetical protein CaO19.4729 [Cand...    53   1e-06
gi|46139775|ref|XP_391578.1| hypothetical protein FG11402.1 [Gib...    53   1e-06
gi|24663091|ref|NP_729778.1| CG32096-PB [Drosophila melanogaster...    53   1e-06
gi|17980214|gb|AAL50557.1| rolling pebbles isoform 7 [Drosophila...    53   1e-06
gi|16974690|gb|AAL32442.1| rolling pebbles isoform 7 [Drosophila...    53   1e-06
gi|47223787|emb|CAF98557.1| unnamed protein product [Tetraodon n...    53   1e-06
gi|38089945|ref|XP_357954.1| similar to hypothetical protein [Mu...    53   1e-06
gi|19703523|ref|NP_603085.1| UNC-44 ankyrins [Fusobacterium nucl...    53   1e-06
gi|17998549|ref|NP_523483.1| CG11020-PA [Drosophila melanogaster...    53   1e-06
gi|34785717|gb|AAH57317.1| Dapk1 protein [Mus musculus] >gnl|BL_...    53   1e-06
gi|46445251|gb|EAL04520.1| hypothetical protein CaO19.12191 [Can...    53   1e-06
gi|24663102|ref|NP_729780.1| CG32096-PC [Drosophila melanogaster...    53   1e-06
gi|17980216|gb|AAL50558.1| rolling pebbles isoform 6 [Drosophila...    53   1e-06
gi|41053899|ref|NP_956276.1| Unknown (protein for MGC:63531); wu...    53   1e-06
gi|50744999|ref|XP_419939.1| PREDICTED: similar to KIAA1250 prot...    53   1e-06
gi|21357681|ref|NP_648542.1| CG32096-PD [Drosophila melanogaster...    53   1e-06
gi|16974692|gb|AAL32443.1| rolling pebbles isoform 6 [Drosophila...    53   1e-06
gi|33284837|emb|CAE17588.1| SI:dZ119J18.2 (novel protein similar...    53   1e-06
gi|28274854|gb|AAO25692.1| ankyrin repeat protein E4_8 [syntheti...    53   1e-06
gi|19527661|gb|AAL89945.1| SD03956p [Drosophila melanogaster]          53   2e-06
gi|31239945|ref|XP_320386.1| ENSANGP00000009166 [Anopheles gambi...    53   2e-06
gi|37181416|gb|AAQ88521.1| CG3104 hlg [Homo sapiens]                   53   2e-06
gi|24650843|ref|NP_651624.2| CG10011-PA [Drosophila melanogaster...    53   2e-06
gi|29825683|gb|AAO91935.1| death-associated protein kinase-alpha...    53   2e-06
gi|17862878|gb|AAL39916.1| SD01389p [Drosophila melanogaster]          53   2e-06
gi|47226364|emb|CAG09332.1| unnamed protein product [Tetraodon n...    53   2e-06
gi|18204817|gb|AAH21490.1| Dapk1 protein [Mus musculus]                53   2e-06
gi|34222186|ref|NP_660278.2| fibronectin type 3 and ankyrin repe...    53   2e-06
gi|34883007|ref|XP_346239.1| similar to ankyrin 3, epithelial is...    53   2e-06
gi|42520607|ref|NP_966522.1| ankyrin repeat domain protein [Wolb...    53   2e-06
gi|47213338|emb|CAF92961.1| unnamed protein product [Tetraodon n...    53   2e-06
gi|37955184|gb|AAP20060.1| HSD13 [Homo sapiens]                        53   2e-06
gi|50746677|ref|XP_420605.1| PREDICTED: similar to ankyrin repea...    53   2e-06
gi|48099152|ref|XP_392578.1| similar to ENSANGP00000006233 [Apis...    53   2e-06
gi|32027990|gb|AAO91934.2| death-associated protein kinase-beta ...    53   2e-06
gi|38604743|sp|Q80YE7|DAK1_MOUSE Death-associated protein kinase...    53   2e-06
gi|21226147|ref|NP_632069.1| hypothetical protein MM0045 [Methan...    53   2e-06
gi|23115916|ref|ZP_00100747.1| COG0666: FOG: Ankyrin repeat [Des...    53   2e-06
gi|17861982|gb|AAL39468.1| LD04107p [Drosophila melanogaster]          52   2e-06
gi|48139684|ref|XP_393472.1| similar to Probable phenylalanyl-tR...    52   2e-06
gi|21356447|ref|NP_648148.1| CG7462-PC [Drosophila melanogaster]...    52   2e-06
gi|41023310|emb|CAE52564.1| putative ankyrin-repeat protein [Fow...    52   2e-06
gi|45551532|ref|NP_729285.2| CG7462-PB [Drosophila melanogaster]...    52   2e-06
gi|9634688|ref|NP_038981.1| ORF FPV018 Ankyrin repeat gene famil...    52   2e-06
gi|47230088|emb|CAG10502.1| unnamed protein product [Tetraodon n...    52   2e-06
gi|34876677|ref|XP_214012.2| similar to gene trap ankyrin repeat...    52   2e-06
gi|311822|emb|CAA48803.1| erythroid ankyrin [Mus musculus]             52   2e-06
gi|31234451|ref|XP_319063.1| ENSANGP00000013300 [Anopheles gambi...    52   3e-06
gi|31208389|ref|XP_313161.1| ENSANGP00000013346 [Anopheles gambi...    52   3e-06
gi|31207183|ref|XP_312558.1| ENSANGP00000014302 [Anopheles gambi...    52   3e-06
gi|47222986|emb|CAF99142.1| unnamed protein product [Tetraodon n...    52   3e-06
gi|11360207|pir||T46507 hypothetical protein DKFZp586M2121.1 - h...    52   3e-06
gi|6680768|ref|NP_031551.1| BRCA1 associated RING domain 1 [Mus ...    52   3e-06
gi|29826244|gb|AAO91862.1| TGB12K interacting protein 3 [Nicotia...    52   3e-06
gi|24637568|gb|AAN63819.1| ankyrin domain protein [Nicotiana tab...    52   3e-06
gi|48095512|ref|XP_392309.1| similar to CG11020-PB [Apis mellifera]    52   3e-06
gi|46140097|ref|XP_391739.1| hypothetical protein FG11563.1 [Gib...    52   3e-06
gi|50737139|ref|XP_419165.1| PREDICTED: similar to oxysterol-bin...    52   3e-06
gi|34879673|ref|XP_344278.1| similar to ankyrin repeat and SOCS ...    52   3e-06
gi|10443349|emb|CAC10514.1| outwardly rectifying potassium chann...    52   3e-06
gi|31241371|ref|XP_321116.1| ENSANGP00000018360 [Anopheles gambi...    52   3e-06
gi|46126065|ref|XP_387586.1| hypothetical protein FG07410.1 [Gib...    52   3e-06
gi|28196052|gb|AAN78090.2| putative AKT1-like potassium channel ...    52   3e-06
gi|15528712|dbj|BAB64778.1| putative ankyrin-like protein [Oryza...    52   3e-06
gi|18252778|ref|NP_057234.2| ankyrin repeat and SOCS box-contain...    52   3e-06
gi|34873590|ref|XP_225138.2| similar to Dapk1 protein [Rattus no...    52   4e-06
gi|50511093|dbj|BAD32532.1| mKIAA1758 protein [Mus musculus]           52   4e-06
gi|32266686|ref|NP_860718.1| hypothetical protein [Helicobacter ...    52   4e-06
gi|12746412|ref|NP_075526.1| ankyrin repeat, family A (RFXANK-li...    52   4e-06
gi|49093496|ref|XP_408209.1| hypothetical protein AN4072.2 [Aspe...    52   4e-06
gi|13310811|gb|AAK18619.1| ankyrin-repeat protein HBP1 [Nicotian...    52   4e-06
gi|50761665|ref|XP_424795.1| PREDICTED: similar to hypothetical ...    52   4e-06
gi|45523244|ref|ZP_00174627.1| COG0666: FOG: Ankyrin repeat [Cro...    52   4e-06
gi|12018308|ref|NP_072144.1| BRCA1-associated RING domain protei...    52   4e-06
gi|23507906|ref|NP_700576.1| hypothetical protein [Plasmodium fa...    52   4e-06
gi|29826242|gb|AAO91861.1| TGB12K interacting protein 2 [Nicotia...    52   4e-06
gi|38083691|ref|XP_289703.2| similar to cortactin binding protei...    52   4e-06
gi|26328183|dbj|BAC27832.1| unnamed protein product [Mus musculus]     52   4e-06
gi|50753260|ref|XP_413929.1| PREDICTED: similar to sex-determina...    52   4e-06
gi|34855002|ref|XP_342647.1| similar to cortactin binding protei...    51   5e-06
gi|23956122|ref|NP_075536.1| ankyrin repeat and SOCS box-contain...    51   5e-06
gi|24371219|ref|NP_083929.1| death associated protein kinase 1 [...    51   5e-06
gi|17488611|gb|AAL40377.1| Brain ankyrin 2 [Takifugu rubripes]         51   5e-06
gi|20151935|gb|AAM11327.1| GH01626p [Drosophila melanogaster]          51   5e-06
gi|19921030|ref|NP_609333.1| CG5846-PA [Drosophila melanogaster]...    51   5e-06
gi|50736155|ref|XP_419064.1| PREDICTED: similar to sterile alpha...    51   5e-06
gi|34859568|ref|XP_347231.1| similar to cortactin binding protei...    51   5e-06
gi|3478700|gb|AAC33264.1| AFT protein [Arabidopsis thaliana]           51   5e-06
gi|37537216|ref|NP_922911.1| putative ankyrin protein [Oryza sat...    51   5e-06
gi|8980338|emb|CAB96906.1| FRANK2 protein [Takifugu rubripes]          51   5e-06
gi|4205079|gb|AAD10949.1| ankyrin repeat-containing protein 2 [A...    51   5e-06
gi|49259167|pdb|1SVX|A Chain A, Crystal Structure Of A Designed ...    51   5e-06
gi|5069434|gb|AAD38809.2| ankyrin repeat-containing protein Asb-...    51   5e-06
gi|33589260|gb|AAQ22397.1| SD10882p [Drosophila melanogaster]          51   6e-06
gi|21732410|emb|CAD38571.1| hypothetical protein [Homo sapiens]        51   6e-06
gi|50795961|ref|XP_423822.1| PREDICTED: similar to ankyrin repea...    51   6e-06
gi|49117716|ref|XP_412222.1| hypothetical protein AN8085.2 [Aspe...    51   6e-06
gi|45551135|ref|NP_726059.3| CG30387-PB [Drosophila melanogaster...    51   6e-06
gi|12963869|gb|AAK07672.1| gene trap ankyrin repeat containing p...    51   6e-06
gi|47221525|emb|CAG08187.1| unnamed protein product [Tetraodon n...    51   6e-06
gi|30690372|ref|NP_849499.1| ankyrin repeat family protein / AFT...    51   6e-06
gi|49903184|gb|AAH76421.1| Zgc:101096 protein [Danio rerio]            51   6e-06
gi|38683816|ref|NP_942592.1| ankyrin repeat domain protein 17 is...    51   6e-06
gi|40549395|ref|NP_932127.2| ankyrin repeat domain protein 17 is...    51   6e-06
gi|33869762|gb|AAH04173.1| ANKRD17 protein [Homo sapiens]              51   6e-06
gi|50754353|ref|XP_414345.1| PREDICTED: similar to ankyrin repea...    51   6e-06
gi|28573593|ref|NP_726060.2| CG30387-PC [Drosophila melanogaster...    51   6e-06
gi|29250225|gb|EAA41722.1| GLP_554_17664_16207 [Giardia lamblia ...    51   6e-06
gi|17546507|ref|NP_519909.1| PROBABLE ANKYRIN REPEAT HARBORING S...    51   6e-06
gi|42519985|ref|NP_965900.1| ankyrin repeat domain protein [Wolb...    51   6e-06
gi|45550479|ref|NP_611574.3| CG30387-PA [Drosophila melanogaster...    51   6e-06
gi|32399035|emb|CAD98275.1| ankyrin-related protein, possible [C...    51   6e-06
gi|40549397|ref|NP_112148.2| ankyrin repeat domain protein 17 is...    51   6e-06
gi|38683807|ref|NP_115593.3| ankyrin repeat domain protein 17 is...    51   6e-06
gi|15237008|ref|NP_195270.1| ankyrin repeat family protein / AFT...    51   6e-06
gi|20521133|dbj|BAA31672.2| KIAA0697 protein [Homo sapiens]            51   6e-06
gi|28373666|pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin...    50   8e-06
gi|7110220|gb|AAF36832.1| AKT1-like potassium channel [Triticum ...    50   8e-06
gi|11359679|pir||T49868 related to suppressor protein SPT23 [imp...    50   8e-06
gi|42520409|ref|NP_966324.1| ankyrin repeat domain protein [Wolb...    50   8e-06
gi|47523973|ref|NP_998243.1| protein kinase PKK [Danio rerio] >g...    50   8e-06
gi|39585030|emb|CAE62681.1| Hypothetical protein CBG06826 [Caeno...    50   8e-06
gi|32415363|ref|XP_328161.1| hypothetical protein ( (AL356833) r...    50   8e-06
gi|15341604|gb|AAK16185.2| putative ankyrin [Oryza sativa (japon...    50   8e-06
gi|26343065|dbj|BAC35189.1| unnamed protein product [Mus musculus]     50   8e-06
gi|13385328|ref|NP_080126.1| fibronectin type 3 and ankyrin repe...    50   8e-06
gi|17505917|ref|NP_492534.1| ankyrin (33.0 kD) (1K133) [Caenorha...    50   8e-06
gi|47212723|emb|CAF90461.1| unnamed protein product [Tetraodon n...    50   8e-06
gi|17230240|ref|NP_486788.1| hypothetical protein [Nostoc sp. PC...    50   8e-06
gi|29837357|gb|AAP05763.1| notch-like transmembrane receptor LIN...    50   8e-06
gi|50750854|ref|XP_422174.1| PREDICTED: similar to KIAA1728 prot...    50   8e-06
gi|39585032|emb|CAE62683.1| Hypothetical protein CBG06829 [Caeno...    50   8e-06
gi|48847305|ref|ZP_00301562.1| COG0666: FOG: Ankyrin repeat [Geo...    50   8e-06
gi|3810676|emb|CAA11280.1| SKOR [Arabidopsis thaliana]                 50   1e-05
gi|15232991|ref|NP_186934.1| stelar K+ outward rectifier (SKOR) ...    50   1e-05
gi|7509429|pir||T26508 hypothetical protein Y17G7B.15 - Caenorha...    50   1e-05
gi|25295800|pir||T52046 potassium channel protein SKOR [validate...    50   1e-05
gi|28274850|gb|AAO25690.1| ankyrin repeat protein E3_19 [synthet...    50   1e-05
gi|4225944|emb|CAA10734.1| centaurin beta 1A [Caenorhabditis ele...    50   1e-05
gi|17536947|ref|NP_496569.1| CeNTaurin, beta (90.6 kD) (cnt-1) [...    50   1e-05
gi|42779705|ref|NP_976952.1| ankyrin repeat domain protein [Baci...    50   1e-05
gi|46118980|ref|ZP_00175910.2| COG0666: FOG: Ankyrin repeat [Cro...    50   1e-05
gi|10438501|dbj|BAB15260.1| unnamed protein product [Homo sapiens]     50   1e-05
gi|29248115|gb|EAA39657.1| GLP_217_12575_13492 [Giardia lamblia ...    50   1e-05
gi|38109002|gb|EAA54936.1| hypothetical protein MG05727.4 [Magna...    50   1e-05
gi|50728130|ref|XP_415996.1| PREDICTED: similar to ankyrin repea...    50   1e-05
gi|48894358|ref|ZP_00327467.1| COG0666: FOG: Ankyrin repeat [Tri...    50   1e-05
gi|42522697|ref|NP_968077.1| ankyrin domain protein [Bdellovibri...    50   1e-05
gi|39584744|emb|CAE67639.1| Hypothetical protein CBG13198 [Caeno...    50   1e-05
gi|9631574|ref|NP_048353.1| contains 4 ankyrin repeats; similar ...    50   1e-05
gi|49481543|ref|YP_034823.1| ankyrin repeat protein [Bacillus th...    50   1e-05
gi|30018751|ref|NP_830382.1| Ankyrin [Bacillus cereus ATCC 14579...    50   1e-05
gi|47567148|ref|ZP_00237864.1| ankyrin repeat domain protein [Ba...    50   1e-05
gi|28829101|gb|AAM34346.2| similar to Homo sapiens (Human). Anky...    50   1e-05
gi|6434439|emb|CAA19462.2| Hypothetical protein Y17G7B.15b [Caen...    50   1e-05
gi|21739783|emb|CAD38920.1| hypothetical protein [Homo sapiens]        50   1e-05
gi|16550160|dbj|BAB70922.1| unnamed protein product [Homo sapiens]     50   1e-05
gi|47123440|gb|AAH70234.1| ANKRD12 protein [Homo sapiens]              50   1e-05
gi|10437204|dbj|BAB15014.1| unnamed protein product [Homo sapiens]     50   1e-05
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib...    50   1e-05
gi|34875707|ref|XP_237094.2| similar to diabetes related ankyrin...    50   1e-05
gi|50753190|ref|XP_413894.1| PREDICTED: hypothetical protein XP_...    50   1e-05
gi|20521940|dbj|BAB13387.2| KIAA1561 protein [Homo sapiens]            50   1e-05
gi|42520050|ref|NP_965965.1| ankyrin repeat domain protein [Wolb...    50   1e-05
gi|27694396|gb|AAH43394.1| ANKRD17 protein [Homo sapiens]              50   1e-05
gi|12698061|dbj|BAB21849.1| KIAA1758 protein [Homo sapiens]            50   1e-05
gi|4972778|gb|AAD34784.1| unknown [Drosophila melanogaster]            50   1e-05
gi|21356741|ref|NP_651410.1| CG4719-PA [Drosophila melanogaster]...    50   1e-05
gi|39591489|emb|CAE73543.1| Hypothetical protein CBG21011 [Caeno...    50   1e-05
gi|34877946|ref|XP_237588.2| similar to KIAA0874 protein [Rattus...    50   1e-05
gi|16975496|ref|NP_219499.1| cortactin binding protein 2; cortac...    50   1e-05
gi|12060822|gb|AAG48253.1| serologically defined breast cancer a...    50   1e-05
gi|39579503|emb|CAE56868.1| Hypothetical protein CBG24701 [Caeno...    50   1e-05
gi|40556372|ref|NP_056023.2| ankyrin repeat domain 12 [Homo sapi...    50   1e-05
gi|11596412|gb|AAG38609.1| GAC-1 [Homo sapiens]                        50   1e-05
gi|28558750|ref|NP_787123.1| CG1651-PC [Drosophila melanogaster]...    50   1e-05
gi|7511809|pir||T13940 ankyrin - fruit fly (Drosophila melanogas...    50   1e-05
gi|39645226|gb|AAH07747.2| ANKRD17 protein [Homo sapiens]              50   1e-05
gi|22761298|dbj|BAC11532.1| unnamed protein product [Homo sapiens]     50   1e-05
gi|34785660|gb|AAH57225.1| ANKRD12 protein [Homo sapiens]              50   1e-05
gi|12856143|dbj|BAB30580.1| unnamed protein product [Mus musculus]     50   1e-05
gi|27720561|ref|XP_236321.1| similar to sex-determination protei...    50   1e-05
gi|6753840|ref|NP_034323.1| feminization 1 homolog b [Mus muscul...    50   1e-05
gi|13359098|dbj|BAB33298.1| mt-Fem [Mus musculus]                      50   1e-05
gi|38176294|ref|NP_874362.2| hypothetical protein LOC348094 [Hom...    50   1e-05
gi|7657265|ref|NP_056137.1| fem-1 homolog b; FEM-1-like death re...    50   1e-05
gi|21758842|dbj|BAC05399.1| unnamed protein product [Homo sapiens]     50   1e-05
gi|21398517|ref|NP_654502.1| ank, Ank repeat [Bacillus anthracis...    49   2e-05
gi|50728154|ref|XP_416008.1| PREDICTED: similar to ankyrin repea...    49   2e-05
gi|22208951|ref|NP_665862.1| ankyrin repeat and SOCS box-contain...    49   2e-05
gi|7022441|dbj|BAA91599.1| unnamed protein product [Homo sapiens]      49   2e-05
gi|48783925|ref|ZP_00280306.1| COG0666: FOG: Ankyrin repeat [Bur...    49   2e-05
gi|24308155|ref|NP_060473.1| uveal autoantigen with coiled-coil ...    49   2e-05
gi|49183559|ref|YP_026811.1| ankyrin repeat domain protein [Baci...    49   2e-05
gi|49115128|gb|AAH73194.1| Unknown (protein for MGC:80444) [Xeno...    49   2e-05
gi|15229331|ref|NP_187122.1| ankyrin repeat family protein [Arab...    49   2e-05
gi|21756491|dbj|BAC04888.1| unnamed protein product [Homo sapiens]     49   2e-05
gi|22208955|ref|NP_569059.2| ankyrin repeat and SOCS box-contain...    49   2e-05
gi|12240158|gb|AAG49576.1| uveal autoantigen [Bos taurus]              49   2e-05
gi|47220184|emb|CAG07325.1| unnamed protein product [Tetraodon n...    49   2e-05
gi|42767031|gb|AAS45545.1| ankyrin repeat-containing cofactor-2 ...    49   2e-05
gi|47220617|emb|CAG06539.1| unnamed protein product [Tetraodon n...    49   2e-05
gi|20531996|sp|Q8WXK4|AS12_HUMAN Ankyrin repeat and SOCS box con...    49   2e-05
gi|38102880|gb|EAA49663.1| hypothetical protein MG08578.4 [Magna...    49   2e-05
gi|41147190|ref|XP_293911.3| similar to ankyrin repeat domain 11...    49   2e-05
gi|7705831|ref|NP_057199.1| ankyrin repeat and SOCS box-containi...    49   2e-05
gi|31199003|ref|XP_308449.1| ENSANGP00000009480 [Anopheles gambi...    49   2e-05
gi|21757298|dbj|BAC05081.1| unnamed protein product [Homo sapiens]     49   2e-05
gi|29504780|gb|AAH50185.1| Similar to KIAA0874 protein [Mus musc...    49   2e-05
gi|32564605|ref|NP_496570.3| CeNTaurin, beta (81.4 kD) (cnt-1) [...    49   2e-05
gi|29249259|gb|EAA40775.1| GLP_608_66311_69673 [Giardia lamblia ...    49   2e-05
gi|6175871|gb|AAF05315.1| FEM-1-like death receptor binding prot...    49   2e-05
gi|37552420|ref|XP_212162.2| similar to CG3104-PA [Homo sapiens]       49   2e-05
gi|50754691|ref|XP_414473.1| PREDICTED: similar to sodium bicarb...    49   2e-05
gi|26335305|dbj|BAC31353.1| unnamed protein product [Mus musculus]     49   2e-05
gi|37620163|ref|NP_065741.3| MASK-4E-BP3 protein [Homo sapiens] ...    49   2e-05
gi|33151164|gb|AAL65263.1| hypothetical protein [Homo sapiens]         49   2e-05
gi|32169294|emb|CAD90767.1| Dysferlin-Interacting Protein 1 [Cra...    49   2e-05
gi|42656507|ref|XP_291015.3| likely homolog of rat kinase D-inte...    49   2e-05
gi|19526775|ref|NP_446247.1| kinase D-interacting substance of 2...    49   2e-05
gi|12231943|gb|AAG49316.1| notch-like transmembrane receptor [Ca...    49   2e-05
gi|47085879|ref|NP_998294.1| zgc:64138 [Danio rerio] >gnl|BL_ORD...    49   2e-05
gi|12231945|gb|AAG49317.1| notch-like transmembrane receptor [Ca...    49   2e-05
gi|38108597|gb|EAA54592.1| hypothetical protein MG05384.4 [Magna...    49   2e-05
gi|19718741|ref|NP_542164.2| oxysterol-binding protein-like 1A i...    49   2e-05
gi|17529999|gb|AAL40663.1| oxysterol-binding protein-like protei...    49   2e-05
gi|41054071|ref|NP_956168.1| ankyrin repeat and SOCS box-contain...    49   2e-05
gi|46139697|ref|XP_391539.1| hypothetical protein FG11363.1 [Gib...    49   2e-05
gi|19718743|ref|NP_579802.1| oxysterol-binding protein-like 1A i...    49   2e-05
gi|7020282|dbj|BAA91063.1| unnamed protein product [Homo sapiens]      49   2e-05
gi|10801612|dbj|BAB16723.1| hypothetical protein [Macaca fascicu...    49   2e-05
gi|28972688|dbj|BAC65760.1| mKIAA1250 protein [Mus musculus]           49   2e-05
gi|50787712|emb|CAH04411.1| ankyrin [Euplotes vannus]                  49   2e-05
gi|46519147|ref|NP_060217.1| multiple ankyrin repeats, single KH...    49   2e-05
gi|41117237|ref|XP_371359.1| similar to Ankrd3-prov protein [Hom...    49   2e-05
gi|28207761|gb|AAO32623.1| CR074 protein [Chlamydomonas reinhard...    49   2e-05
gi|14133247|dbj|BAA86564.2| KIAA1250 protein [Homo sapiens]            49   2e-05
gi|18676694|dbj|BAB84999.1| FLJ00246 protein [Homo sapiens]            49   2e-05
gi|24745936|dbj|BAC23047.1| ankyrin-like protein [Solanum tubero...    49   2e-05
gi|49090946|ref|XP_406934.1| hypothetical protein AN2797.2 [Aspe...    49   2e-05
gi|29250944|gb|EAA42431.1| GLP_137_115862_112509 [Giardia lambli...    49   2e-05
gi|11934689|gb|AAG41779.1| hypothetical protein [Homo sapiens]         49   2e-05
gi|19387842|ref|NP_076395.1| ankyrin repeat and SOCS box-contain...    49   2e-05
gi|20532001|sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box con...    49   2e-05
gi|18606485|gb|AAH23086.1| Ankyrin repeat and SOCS box-containin...    49   2e-05
gi|31240727|ref|XP_320777.1| ENSANGP00000008882 [Anopheles gambi...    49   2e-05
gi|26325282|dbj|BAC26395.1| unnamed protein product [Mus musculus]     49   2e-05
gi|24214558|ref|NP_712039.1| Ankyrin repeat proteins [Leptospira...    49   2e-05
gi|26332759|dbj|BAC30097.1| unnamed protein product [Mus musculus]     49   3e-05
gi|11359987|pir||T43458 hypothetical protein DKFZp434F0621.1 - h...    49   3e-05
gi|27807243|ref|NP_777112.1| ankyrin repeat and SOCS box-contain...    49   3e-05
gi|46120376|ref|XP_385011.1| hypothetical protein FG04835.1 [Gib...    49   3e-05
gi|27693740|gb|AAH30990.1| ZDHHC17 protein [Homo sapiens]              49   3e-05
gi|25282421|ref|NP_742020.1| oxysterol binding protein-like 1A [...    49   3e-05
gi|28972544|dbj|BAC65688.1| mKIAA0946 protein [Mus musculus]           49   3e-05
gi|7021863|dbj|BAA91417.1| unnamed protein product [Homo sapiens]      49   3e-05
gi|50420121|ref|XP_458593.1| unnamed protein product [Debaryomyc...    49   3e-05
gi|11414742|emb|CAC17380.1| guard cell outward rectifying K+ cha...    49   3e-05
gi|30693099|ref|NP_198566.2| guard cell outward rectifying K+ ch...    49   3e-05
gi|50746759|ref|XP_420641.1| PREDICTED: similar to Ankyrin 2 (Br...    49   3e-05
gi|27369784|ref|NP_766142.1| zinc finger, DHHC domain containing...    49   3e-05
gi|31455481|dbj|BAC77366.1| putative NFkB activating protein [Ho...    49   3e-05
gi|8980336|emb|CAB96904.1| FRANK1 protein [Takifugu rubripes] >g...    49   3e-05
gi|29244412|ref|NP_808503.1| hypothetical protein A130096K20 [Mu...    49   3e-05
gi|46395885|sp|Q8IUH5|HI14_HUMAN Huntingtin-interacting protein ...    49   3e-05
gi|46395762|sp|Q80TN5|HI14_MOUSE Huntingtin-interacting protein 14     49   3e-05
gi|50738628|ref|XP_426100.1| PREDICTED: similar to Ankyrin repea...    49   3e-05
gi|17488613|gb|AAL40379.1| Erythrocyte ankyrin 1 [Takifugu rubri...    49   3e-05
gi|26332745|dbj|BAC30090.1| unnamed protein product [Mus musculus]     49   3e-05
gi|10433360|dbj|BAB13958.1| unnamed protein product [Homo sapiens]     49   3e-05
gi|46519154|ref|NP_078944.2| multiple ankyrin repeats, single KH...    49   3e-05
gi|14602805|gb|AAH09909.1| FLJ20288 protein [Homo sapiens]             49   3e-05
gi|47215351|emb|CAG12585.1| unnamed protein product [Tetraodon n...    49   3e-05
gi|31807448|gb|AAH53220.1| LOC402845 protein [Danio rerio]             49   3e-05
gi|34864845|ref|XP_343208.1| similar to KIAA0946 protein [Rattus...    49   3e-05
gi|4589536|dbj|BAA76790.1| KIAA0946 protein [Homo sapiens]             49   3e-05
gi|17488602|gb|AAL40369.1| Erythrocyte ankyrin 1 [Takifugu rubri...    49   3e-05
gi|50728366|ref|XP_416109.1| PREDICTED: similar to Huntingtin-in...    49   3e-05
gi|37590143|gb|AAH58772.1| Zdhhc17 protein [Mus musculus]              49   3e-05
gi|15146306|gb|AAK83636.1| AT5g37500/mpa22_p_30 [Arabidopsis tha...    49   3e-05
gi|46519151|ref|NP_060448.1| multiple ankyrin repeats, single KH...    49   3e-05
gi|47847488|dbj|BAD21416.1| mFLJ00246 protein [Mus musculus]           48   4e-05
gi|48097710|ref|XP_391938.1| similar to CG12342-PA [Apis mellifera]    48   4e-05
gi|47203672|emb|CAG14604.1| unnamed protein product [Tetraodon n...    48   4e-05
gi|47209007|emb|CAF93429.1| unnamed protein product [Tetraodon n...    48   4e-05
gi|50762073|ref|XP_424927.1| PREDICTED: similar to ankyrin repea...    48   4e-05
gi|46249645|gb|AAH68925.1| MGC83166 protein [Xenopus laevis]           48   4e-05
gi|41055480|ref|NP_956524.1| similar to Gasz [Danio rerio] >gnl|...    48   4e-05
gi|48847003|ref|ZP_00301261.1| COG0666: FOG: Ankyrin repeat [Geo...    48   4e-05
gi|27883850|ref|NP_705722.2| diabetes related ankyrin repeat pro...    48   4e-05
gi|633040|dbj|BAA07202.1| 130 kDa myosin-binding subunit of smoo...    48   4e-05
gi|45384106|ref|NP_990454.1| 133kDa myosin-binding subunit of sm...    48   4e-05
gi|50417577|gb|AAH77603.1| Unknown (protein for MGC:84513) [Xeno...    48   4e-05
gi|32403722|ref|XP_322474.1| hypothetical protein [Neurospora cr...    48   4e-05
gi|34882732|ref|XP_346212.1| similar to RIKEN cDNA 4921537P18 [R...    48   4e-05
gi|17554212|ref|NP_499007.1| abnormal cell LINeage LIN-12, notch...    48   4e-05
gi|10944718|emb|CAC14169.1| C3VS protein [Canis familiaris]            48   4e-05
gi|50513467|pdb|1S70|B Chain B, Complex Between Protein SerTHR P...    48   4e-05
gi|34876505|ref|XP_225480.2| similar to RIKEN cDNA 4921537P18 [R...    48   4e-05
gi|31211399|ref|XP_314669.1| ENSANGP00000005014 [Anopheles gambi...    48   4e-05
gi|48095074|ref|XP_392232.1| similar to CG10249-PA [Apis mellifera]    48   4e-05
gi|7445894|pir||T03939 potassium channel protein - maize >gnl|BL...    48   4e-05
gi|728859|sp|Q06527|ANKH_CHRVI Ankyrin homolog precursor >gnl|BL...    48   4e-05
gi|42520262|ref|NP_966177.1| ankyrin repeat domain protein [Wolb...    48   4e-05
gi|38049418|ref|XP_126866.5| kinase D-interacting substance of 2...    48   4e-05
gi|11321435|gb|AAG34167.1| ankyrin repeat-rich membrane-spanning...    48   4e-05
gi|47213886|emb|CAF93568.1| unnamed protein product [Tetraodon n...    48   5e-05
gi|23508388|ref|NP_701057.1| hypothetical protein [Plasmodium fa...    48   5e-05
gi|31194775|ref|XP_306335.1| ENSANGP00000001960 [Anopheles gambi...    48   5e-05
gi|46120398|ref|XP_385022.1| hypothetical protein FG04846.1 [Gib...    48   5e-05
gi|50758641|ref|XP_417350.1| PREDICTED: similar to CAAX box prot...    48   5e-05
gi|50725679|dbj|BAD33145.1| putative ankyrin domain protein [Ory...    48   5e-05
gi|29248254|gb|EAA39793.1| GLP_36_54719_58159 [Giardia lamblia A...    48   5e-05
gi|41055896|ref|NP_956444.1| hypothetical protein MGC55925 [Dani...    48   5e-05
gi|25742846|ref|NP_446342.1| myosin phosphatase, target subunit ...    48   5e-05
gi|38090710|ref|XP_137239.3| protein phosphatase 1, regulatory (...    48   5e-05
gi|19076063|ref|NP_588563.1| hypothetical ankyrin-repeat protein...    48   5e-05
gi|46126877|ref|XP_387992.1| hypothetical protein FG07816.1 [Gib...    48   5e-05
gi|41017406|sp|Q9DBR7|MPT1_MOUSE Protein phosphatase 1 regulator...    48   5e-05
gi|50796994|ref|XP_423909.1| PREDICTED: similar to RIKEN cDNA 27...    48   5e-05
gi|37181056|gb|AAQ88438.1| myosin phosphatase target subunit 1 v...    48   5e-05
gi|47223711|emb|CAF99320.1| unnamed protein product [Tetraodon n...    48   5e-05
gi|7513459|pir||JG0197 myosin-light-chain-phosphatase (EC 3.1.3....    48   5e-05
gi|34857490|ref|XP_230385.2| similar to RIKEN cDNA 4930430A15 [R...    48   5e-05
gi|41017251|sp|Q10728|MPT1_RAT Protein phosphatase 1 regulatory ...    48   5e-05
gi|34861136|ref|XP_219418.2| similar to RIKEN cDNA 1700007B22 [R...    48   5e-05


>gi|17550974|ref|NP_508437.1| myotrophin (12.5 kD) (XD27)
           [Caenorhabditis elegans]
 gi|7497357|pir||T29992 hypothetical protein C43H6.3 -
           Caenorhabditis elegans
 gi|1255326|gb|AAA96086.1| Hypothetical protein C43H6.3
           [Caenorhabditis elegans]
          Length = 114

 Score =  229 bits (585), Expect = 8e-60
 Identities = 114/114 (100%), Positives = 114/114 (100%)
 Frame = +1

Query: 1   MSVAWNVQNGEIDAVKQSVNEKNVHEIYNGRTAIQIAADYGQTSIIAYLISIGANIQDKD 180
           MSVAWNVQNGEIDAVKQSVNEKNVHEIYNGRTAIQIAADYGQTSIIAYLISIGANIQDKD
Sbjct: 1   MSVAWNVQNGEIDAVKQSVNEKNVHEIYNGRTAIQIAADYGQTSIIAYLISIGANIQDKD 60

Query: 181 KYGITPLLSAVWEGHRDAVKLLLQNGADRSIHAPDGTALIDCTEEEDIRELLKN 342
           KYGITPLLSAVWEGHRDAVKLLLQNGADRSIHAPDGTALIDCTEEEDIRELLKN
Sbjct: 61  KYGITPLLSAVWEGHRDAVKLLLQNGADRSIHAPDGTALIDCTEEEDIRELLKN 114




[DB home][top]