Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C39E9_4
(927 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539078|ref|NP_502507.1| COLlagen structural gene (col-131) ... 419 e-116
gi|39585299|emb|CAE61621.1| Hypothetical protein CBG05547 [Caeno... 341 1e-92
gi|17535069|ref|NP_496535.1| COLlagen structural gene (col-84) [... 91 5e-17
gi|39597161|emb|CAE59388.1| Hypothetical protein CBG02745 [Caeno... 89 1e-16
gi|39583250|emb|CAE60042.1| Hypothetical protein CBG03553 [Caeno... 88 3e-16
gi|17553572|ref|NP_498086.1| collagen alpha precursor, DumPY : s... 87 4e-16
gi|25395729|pir||H88449 protein F54D8.1 [imported] - Caenorhabdi... 87 4e-16
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ... 86 2e-15
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno... 85 3e-15
gi|39585781|emb|CAE59983.1| Hypothetical protein CBG03475 [Caeno... 80 8e-14
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 74 6e-12
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ... 74 6e-12
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [... 72 2e-11
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 72 2e-11
gi|17570601|ref|NP_509692.1| COLlagen structural gene (28.7 kD) ... 72 2e-11
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno... 72 2e-11
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno... 72 2e-11
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno... 71 3e-11
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno... 70 7e-11
gi|39596974|emb|CAE59201.1| Hypothetical protein CBG02512 [Caeno... 70 7e-11
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ... 70 9e-11
gi|17538077|ref|NP_495159.1| COLlagen structural gene (col-74) [... 70 9e-11
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ... 69 1e-10
gi|25385147|pir||A88640 protein C34H4.4 [imported] - Caenorhabdi... 69 1e-10
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ... 69 2e-10
gi|39594542|emb|CAE72120.1| Hypothetical protein CBG19216 [Caeno... 68 3e-10
gi|39590997|emb|CAE58777.1| Hypothetical protein CBG01972 [Caeno... 68 3e-10
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno... 68 3e-10
gi|17569903|ref|NP_508386.1| COLlagen structural gene (38.6 kD) ... 68 3e-10
gi|17535735|ref|NP_496421.1| SQuaT SQT-1, ROLler: helically twis... 68 3e-10
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 68 3e-10
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno... 67 4e-10
gi|115410|sp|P12114|CCS1_CAEEL Cuticle collagen sqt-1 >gnl|BL_OR... 67 4e-10
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 67 7e-10
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 67 7e-10
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno... 66 1e-09
gi|17542824|ref|NP_501756.1| COLlagen structural gene (col-123) ... 66 1e-09
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ... 66 1e-09
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno... 65 2e-09
gi|39593522|emb|CAE61814.1| Hypothetical protein CBG05782 [Caeno... 65 2e-09
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ... 65 3e-09
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ... 65 3e-09
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ... 64 4e-09
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [... 64 4e-09
gi|39593742|emb|CAE62035.1| Hypothetical protein CBG06051 [Caeno... 64 4e-09
gi|39594543|emb|CAE72121.1| Hypothetical protein CBG19217 [Caeno... 64 5e-09
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ... 64 5e-09
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [... 64 6e-09
gi|7494765|pir||T29837 hypothetical protein B0222.6 - Caenorhabd... 63 8e-09
gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10) [... 63 8e-09
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno... 63 8e-09
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ... 63 8e-09
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ... 63 1e-08
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno... 63 1e-08
gi|17557220|ref|NP_505647.1| COLlagen structural gene (col-150) ... 62 1e-08
gi|33285196|gb|AAF99925.2| Collagen protein 111 [Caenorhabditis ... 62 1e-08
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C... 62 1e-08
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ... 62 1e-08
gi|17557278|ref|NP_505375.1| COLlagen structural gene (28.8 kD) ... 62 2e-08
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno... 62 2e-08
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col... 62 2e-08
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno... 62 2e-08
gi|17542298|ref|NP_501532.1| COLlagen structural gene (col-118) ... 61 4e-08
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ... 60 5e-08
gi|39593739|emb|CAE62032.1| Hypothetical protein CBG06046 [Caeno... 60 5e-08
gi|39595659|emb|CAE67161.1| Hypothetical protein CBG12587 [Caeno... 60 5e-08
gi|39597664|emb|CAE68355.1| Hypothetical protein CBG14092 [Caeno... 60 7e-08
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno... 60 9e-08
gi|17540620|ref|NP_502115.1| COLlagen structural gene (col-126) ... 59 1e-07
gi|17540622|ref|NP_502116.1| predicted CDS, COLlagen structural ... 59 1e-07
gi|17508941|ref|NP_491800.1| COLlagen structural gene (col-56) [... 59 1e-07
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno... 59 2e-07
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno... 59 2e-07
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [... 58 3e-07
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita] 58 3e-07
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (... 58 3e-07
gi|3242649|dbj|BAA29028.1| alpha 1 type I collagen [Rana catesbe... 58 3e-07
gi|17508175|ref|NP_491106.1| COLlagen structural gene (col-49) [... 58 3e-07
gi|39581950|emb|CAE73812.1| Hypothetical protein CBG21362 [Caeno... 58 3e-07
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ... 58 3e-07
gi|17507511|ref|NP_492619.1| COLlagen structural gene (col-64) [... 57 4e-07
gi|9453886|dbj|BAB03287.1| pro-alpha 1 type V/XI collagen [Pagru... 57 4e-07
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno... 57 6e-07
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno... 57 6e-07
gi|551558|gb|AAA62386.1| type V collagen 57 6e-07
gi|1071999|pir||A55047 collagen alpha 1(V) - chicken (fragment) 57 6e-07
gi|50757087|ref|XP_429250.1| PREDICTED: hypothetical protein XP_... 57 6e-07
gi|46048885|ref|NP_990121.1| alpha 1 (V) collagen [Gallus gallus... 57 6e-07
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ... 57 8e-07
gi|39589826|emb|CAE67061.1| Hypothetical protein CBG12469 [Caeno... 56 1e-06
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno... 56 1e-06
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [... 56 1e-06
gi|20065816|ref|NP_612899.1| hypothetical protein Stx2Ip020 [Stx... 56 1e-06
gi|7656989|ref|NP_056534.1| collagen, type V, alpha 3 preproprot... 55 2e-06
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ... 55 2e-06
gi|17506859|ref|NP_491822.1| predicted CDS, COLlagen structural ... 55 2e-06
gi|19745166|ref|NP_604447.1| collagen, type V, alpha 1 [Rattus n... 55 2e-06
gi|191151|gb|AAA37002.1| pro-alpha-1 type V collagen 55 2e-06
gi|7441219|pir||S18803 collagen alpha 1(V) chain - hamster 55 2e-06
gi|7656987|ref|NP_056549.1| procollagen, type V, alpha 1; pro-al... 55 2e-06
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno... 55 3e-06
gi|49481374|ref|YP_038772.1| collagen-like protein [Bacillus thu... 55 3e-06
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C... 55 3e-06
gi|115404|sp|P18833|CC08_CAEEL Cuticle collagen 8 precursor >gnl... 55 3e-06
gi|11120710|ref|NP_068528.1| collagen, type V, alpha 3; procolla... 55 3e-06
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno... 55 3e-06
gi|15021422|gb|AAK77699.1| ORF30, putative collagen [shrimp whit... 55 3e-06
gi|17158634|ref|NP_477523.1| wsv001 [shrimp white spot syndrome ... 55 3e-06
gi|11096151|gb|AAG30215.1| collagen-like surface protein [Strept... 54 4e-06
gi|17539040|ref|NP_501123.1| COLlagen structural gene (35.6 kD) ... 54 4e-06
gi|8393173|ref|NP_058615.1| procollagen, type V, alpha 3; Pro-al... 54 4e-06
gi|9632525|ref|NP_049519.1| putative tail fiber protein [Bacteri... 54 4e-06
gi|7649887|dbj|BAA94165.1| tail fiber protein [Escherichia coli ... 54 4e-06
gi|17506643|ref|NP_492948.1| predicted CDS, COLlagen structural ... 54 4e-06
gi|6753482|ref|NP_034056.1| procollagen, type XI, alpha 2 [Mus m... 54 5e-06
gi|30316381|sp|Q64739|CA2B_MOUSE Collagen alpha 2(XI) chain prec... 54 5e-06
gi|48140714|ref|XP_393523.1| similar to ENSANGP00000019179 [Apis... 54 5e-06
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 54 5e-06
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno... 54 5e-06
gi|17531393|ref|NP_496311.1| nematode cuticle collagen, BLIstere... 54 5e-06
gi|37619788|emb|CAA86755.2| Hypothetical protein C09G5.6 [Caenor... 54 5e-06
gi|841122|gb|AAA67751.1| putative collagen alpha-2 (XI) chain [M... 54 5e-06
gi|115313|sp|P20908|CA15_HUMAN Collagen alpha 1(V) chain precurs... 54 5e-06
gi|1360669|pir||CGHU1V collagen alpha 1(V) chain precursor - hum... 54 5e-06
gi|16554579|ref|NP_000084.2| alpha 1 type V collagen preproprote... 54 5e-06
gi|47214275|emb|CAG01332.1| unnamed protein product [Tetraodon n... 54 6e-06
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ... 54 6e-06
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 54 6e-06
gi|47222238|emb|CAG11117.1| unnamed protein product [Tetraodon n... 54 6e-06
gi|18201917|ref|NP_542411.1| alpha 2 type XI collagen isoform 1 ... 53 8e-06
gi|13432104|sp|P13942|CA2B_HUMAN Collagen alpha 2(XI) chain prec... 53 8e-06
gi|3820987|emb|CAA20240.1| dJ1033B10.12 (collagen, type XI, alph... 53 8e-06
gi|1000746|gb|AAC50214.1| Pro-a2(XI) >gnl|BL_ORD_ID|593459 gi|15... 53 8e-06
gi|18201919|ref|NP_542412.1| alpha 2 type XI collagen isoform 2 ... 53 8e-06
gi|1000745|gb|AAC50213.1| Pro-a2(XI) 53 8e-06
gi|1360671|pir||CGHU2E collagen alpha 2(XI) chain precursor - hu... 53 8e-06
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno... 53 8e-06
gi|1000747|gb|AAC50215.1| Pro-a2(XI) 53 8e-06
gi|18201915|ref|NP_542410.1| alpha 2 type XI collagen isoform 3 ... 53 8e-06
gi|180715|gb|AAA52034.1| alpha-2 type XI collagen 53 8e-06
gi|18157524|dbj|BAB83839.1| collagen type XI alpha 2~partially s... 53 8e-06
gi|7619739|emb|CAB88203.1| putative cuticular collagen [Globoder... 53 1e-05
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd... 53 1e-05
gi|24210303|emb|CAD54661.1| SI:dZ12F11.3 (collagen type XI alpha... 53 1e-05
gi|39597193|emb|CAE59420.1| Hypothetical protein CBG02789 [Caeno... 53 1e-05
gi|23112832|ref|ZP_00098266.1| COG3468: Type V secretory pathway... 52 1e-05
gi|47551001|ref|NP_999674.1| alpha-1 collagen [Strongylocentrotu... 52 1e-05
gi|4519617|dbj|BAA75668.1| collagen pro alpha-chain [Haliotis di... 52 1e-05
gi|5360532|dbj|BAA82043.1| alpha1 type II collagen [Cynops pyrrh... 52 1e-05
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 52 1e-05
gi|17481334|dbj|BAB79229.1| type I collagen alpha 2 chain [Oncor... 52 1e-05
gi|30354436|gb|AAH52161.1| Procollagen, type XI, alpha 1 [Mus mu... 52 1e-05
gi|6680958|ref|NP_031755.1| procollagen, type XI, alpha 1; pro-a... 52 1e-05
gi|17481338|dbj|BAB79230.1| type I collagen alpha 2 chain [Oncor... 52 1e-05
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno... 52 1e-05
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-... 52 1e-05
gi|39579352|emb|CAE56520.1| Hypothetical protein CBG24243 [Caeno... 52 2e-05
gi|34852201|ref|XP_215342.2| similar to Collagen alpha 2(XI) cha... 52 2e-05
gi|47087124|ref|NP_997693.1| procollagen, type XI, alpha 2; coll... 52 2e-05
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 52 2e-05
gi|28895851|ref|NP_802201.1| SclB protein [Streptococcus pyogene... 52 2e-05
gi|22832760|gb|AAH13626.1| Col3a1 protein [Mus musculus] 52 2e-05
gi|31340542|gb|AAO33039.2| alpha 1 type II procollagen [Gallus g... 52 2e-05
gi|20380522|gb|AAH28248.1| Col3a1 protein [Mus musculus] 52 2e-05
gi|2119163|pir||S59856 collagen alpha 1(III) chain precursor - m... 52 2e-05
gi|26334217|dbj|BAC30826.1| unnamed protein product [Mus musculus] 52 2e-05
gi|5921190|sp|P08121|CA13_MOUSE Collagen alpha 1(III) chain prec... 52 2e-05
gi|33859526|ref|NP_034060.1| procollagen, type III, alpha 1; min... 52 2e-05
gi|26339398|dbj|BAC33370.1| unnamed protein product [Mus musculus] 52 2e-05
gi|23308589|ref|NP_690850.1| collagen, type XXIV, alpha 1 [Homo ... 52 2e-05
gi|45383309|ref|NP_989757.1| alpha 1 type IIA collagen precursor... 52 2e-05
gi|33417124|gb|AAH56052.1| Colec11-prov protein [Xenopus laevis] 51 3e-05
gi|39597388|emb|CAE59617.1| Hypothetical protein CBG03026 [Caeno... 51 3e-05
gi|11875612|gb|AAG40729.1| type IV collagen alpha 1 chain precur... 51 3e-05
gi|6680980|ref|NP_031769.1| procollagen, type I, alpha 2; osteog... 51 3e-05
gi|45361285|ref|NP_989220.1| hypothetical protein MGC75588 [Xeno... 51 3e-05
gi|3641655|dbj|BAA33379.1| alpha 2 type I collagen [Oncorhynchus... 51 3e-05
gi|2134839|pir||A61262 collagen alpha 1(XVII) chain - human (fra... 51 3e-05
gi|283868|pir||S28791 collagen alpha 1(XI) chain - chicken (frag... 51 3e-05
gi|17865659|sp|Q01149|CA21_MOUSE Collagen alpha 2(I) chain precu... 51 3e-05
gi|18641354|ref|NP_000485.2| alpha 1 type XVII collagen; collage... 51 3e-05
gi|9588138|emb|CAC00589.1| bA16H23.2 (collagen, type XVII, alpha... 51 3e-05
gi|41688524|sp|Q9UMD9|CA1G_HUMAN Collagen alpha 1(XVII) chain (B... 51 3e-05
gi|179521|gb|AAA51839.1| BPAG2 51 3e-05
gi|6165882|gb|AAF04725.1| collagen type XI alpha-1 isoform A [Ho... 51 3e-05
gi|21542396|sp|P12107|CA1B_HUMAN Collagen alpha 1(XI) chain prec... 51 3e-05
gi|50751232|ref|XP_422303.1| PREDICTED: similar to alpha-1 type ... 51 3e-05
gi|6165883|gb|AAF04726.1| collagen type XI alpha-a isoform B [Ho... 51 3e-05
gi|18202250|sp|O93484|CA21_ONCMY Collagen alpha 2(I) chain precu... 51 3e-05
gi|7532790|gb|AAF63232.1| ORF-401-like protein [prophage P-EibA] 51 3e-05
gi|1222642|emb|CAA63070.1| collagen [Brugia pahangi] 51 3e-05
gi|2143429|pir||I57012 alpha 2(XI) collagen - mouse (fragment) >... 51 3e-05
gi|6165881|gb|AAF04724.1| collagen type XI alpha-1 [Homo sapiens] 51 3e-05
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p... 51 3e-05
gi|13235596|emb|CAC33780.1| SclB protein [Streptococcus pyogenes] 51 4e-05
gi|2645088|dbj|BAA23626.1| collagen [Hydra vulgaris] 51 4e-05
gi|39597098|emb|CAE59325.1| Hypothetical protein CBG02667 [Caeno... 51 4e-05
gi|115290|sp|P04258|CA13_BOVIN Collagen alpha 1(III) chain >gnl|... 51 4e-05
gi|39597300|emb|CAE59528.1| Hypothetical protein CBG02923 [Caeno... 51 4e-05
gi|39582634|emb|CAE73738.1| Hypothetical protein CBG21264 [Caeno... 51 4e-05
gi|47194287|emb|CAG13419.1| unnamed protein product [Tetraodon n... 50 5e-05
gi|39582788|emb|CAE74251.1| Hypothetical protein CBG21938 [Caeno... 50 5e-05
gi|17550712|ref|NP_510630.1| COLlagen structural gene (col-187) ... 50 5e-05
gi|39587723|emb|CAE58661.1| Hypothetical protein CBG01830 [Caeno... 50 5e-05
gi|17540820|ref|NP_500070.1| COLlagen structural gene (28.0 kD) ... 50 5e-05
gi|39587623|emb|CAE58561.1| Hypothetical protein CBG01723 [Caeno... 50 5e-05
gi|47229883|emb|CAG07079.1| unnamed protein product [Tetraodon n... 50 5e-05
gi|18375518|ref|NP_001845.2| alpha 1 type XI collagen isoform A ... 50 5e-05
gi|1360670|pir||CGHU1E collagen alpha 1(XI) chain precursor - hu... 50 5e-05
gi|84432|pir||JS0170 collagen col-19 - Caenorhabditis elegans >g... 50 5e-05
gi|18375520|ref|NP_542196.1| alpha 1 type XI collagen isoform B ... 50 5e-05
gi|18375522|ref|NP_542197.1| alpha 1 type XI collagen isoform C ... 50 5e-05
gi|32566102|ref|NP_508100.2| COLlagen structural gene (col-19) [... 50 5e-05
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >... 50 5e-05
gi|50731940|ref|XP_418425.1| PREDICTED: similar to collagen, typ... 47 6e-05
gi|31231753|ref|XP_318588.1| ENSANGP00000021001 [Anopheles gambi... 50 7e-05
gi|31195073|ref|XP_306484.1| ENSANGP00000014653 [Anopheles gambi... 50 7e-05
gi|495866|gb|AAA58965.1| collagen type VII [Homo sapiens] 50 7e-05
gi|50750041|ref|XP_421846.1| PREDICTED: similar to procollagen t... 50 7e-05
gi|41688514|sp|Q9JMH4|CA1G_MESAU Collagen alpha 1(XVII) chain (B... 50 7e-05
gi|33598924|ref|NP_057324.2| scavenger receptor class A, member ... 50 7e-05
gi|39593374|emb|CAE64844.1| Hypothetical protein CBG09640 [Caeno... 50 7e-05
gi|17557218|ref|NP_505646.1| COLlagen structural gene (30.6 kD) ... 50 9e-05
gi|39595642|emb|CAE67144.1| Hypothetical protein CBG12567 [Caeno... 50 9e-05
gi|11096149|gb|AAG30214.1| collagen-like surface protein [Strept... 50 9e-05
gi|39596361|emb|CAE69999.1| Hypothetical protein CBG16406 [Caeno... 50 9e-05
gi|17539090|ref|NP_502514.1| COLlagen structural gene (col-132) ... 50 9e-05
gi|11096155|gb|AAG30217.1| collagen-like surface protein [Strept... 50 9e-05
gi|29179577|gb|AAH49287.1| Col1a2-prov protein [Xenopus laevis] 50 9e-05
gi|47218941|emb|CAF98139.1| unnamed protein product [Tetraodon n... 50 9e-05
gi|15149948|emb|CAC51022.1| collagen type I alpha 3 chain [Danio... 50 9e-05
gi|179594|gb|AAB59373.1| alpha-1 type I collagen 50 9e-05
gi|13235606|emb|CAC33782.1| SclB protein [Streptococcus pyogenes] 50 9e-05
gi|42780654|ref|NP_977901.1| hypothetical protein BCE1581 [Bacil... 49 1e-04
gi|37589348|gb|AAH59289.1| LOC398739 protein [Xenopus laevis] 49 1e-04
gi|476846|pir||A45748 collagen alpha 1(VII) chain - mouse (fragm... 49 1e-04
gi|6680972|ref|NP_031764.1| procollagen, type VII, alpha 1 [Mus ... 49 1e-04
gi|17540078|ref|NP_500607.1| COLlagen structural gene (col-111) ... 49 1e-04
gi|211607|gb|AAA69962.1| alpha-2 type I collagen [Gallus gallus] 49 1e-04
gi|5921192|sp|P02467|CA21_CHICK Collagen alpha 2(I) chain precursor 49 1e-04
gi|47201130|emb|CAF87406.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|39586155|emb|CAE69231.1| Hypothetical protein CBG15273 [Caeno... 49 1e-04
gi|47198224|emb|CAF87674.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|47216869|emb|CAG11676.1| unnamed protein product [Tetraodon n... 49 1e-04
gi|33149359|gb|AAO64414.1| type VII collagen [Canis familiaris] 49 1e-04
gi|6230372|dbj|BAA86201.1| CSR1 [Homo sapiens] 49 1e-04
gi|13235584|emb|CAC33775.1| SclB protein [Streptococcus pyogenes] 49 1e-04
gi|38454234|ref|NP_942042.1| collagen, type XXVII, alpha 1; coll... 49 1e-04
gi|38683736|gb|AAR26912.1| FirrV-1-B37 precursor [Feldmannia irr... 49 1e-04
gi|34866357|ref|XP_238554.2| similar to type VII collagen [Rattu... 49 1e-04
gi|1235974|emb|CAA65474.1| collagen [Globodera pallida] 49 1e-04
gi|50732501|ref|XP_418665.1| PREDICTED: similar to alpha-2 type ... 49 1e-04
gi|37498977|gb|AAQ91579.1| collagen-like protein 3 [Streptococcu... 49 2e-04
gi|48895223|ref|ZP_00328207.1| COG4675: Microcystin-dependent pr... 49 2e-04
gi|930045|emb|CAA33387.1| alpha-1 (III) collagen [Homo sapiens] 49 2e-04
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno... 49 2e-04
gi|3641659|dbj|BAA33381.1| alpha 3 type I collagen [Oncorhynchus... 49 2e-04
gi|4379341|emb|CAA08789.1| fibrillar collagen [Podocoryne carnea] 49 2e-04
gi|50749759|ref|XP_421744.1| PREDICTED: similar to novel collage... 49 2e-04
gi|17539868|ref|NP_501416.1| predicted CDS, COLlagen structural ... 49 2e-04
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno... 49 2e-04
gi|48762667|ref|NP_892013.2| collagen, type I, alpha 2 [Danio re... 49 2e-04
gi|47229594|emb|CAG06790.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|115328|sp|P20909|CA1B_RAT COLLAGEN ALPHA 1(XI) CHAIN >gnl|BL_... 49 2e-04
gi|1070603|pir||CGHU7L collagen alpha 1(III) chain precursor - h... 49 2e-04
gi|47217758|emb|CAG05980.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|4502951|ref|NP_000081.1| alpha 1 type III collagen; Collagen ... 49 2e-04
gi|20380052|gb|AAH28178.1| COL3A1 protein [Homo sapiens] 49 2e-04
gi|26788083|emb|CAD58730.1| SI:bY143E18.1 (novel protein similar... 49 2e-04
gi|450048|prf||1920343A fibrillar collagen 49 2e-04
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ... 49 2e-04
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno... 49 2e-04
gi|41688505|sp|Q90584|CA1G_CHICK Collagen alpha 1(XVII) chain (B... 49 2e-04
gi|29290626|emb|CAD83046.1| bM6H1.4.1 (novel collagen triple hel... 49 2e-04
gi|37202117|ref|NP_079961.2| procollagen, type XXVII, alpha 1 [M... 49 2e-04
gi|34875814|ref|XP_343565.1| collagen, type V, alpha 2 [Rattus n... 49 2e-04
gi|13128972|ref|NP_076932.1| collectin sub-family member 11 isof... 49 2e-04
gi|28422462|gb|AAH46861.1| LOC398560 protein [Xenopus laevis] 49 2e-04
gi|11096153|gb|AAG30216.1| collagen-like surface protein [Strept... 49 2e-04
gi|47220201|emb|CAF98966.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|47229302|emb|CAG04054.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|627406|pir||A54849 collagen alpha 1(VII) chain precursor - human 49 2e-04
gi|1888409|emb|CAA67261.1| collagen type I alpha 1 [Homo sapiens] 49 2e-04
gi|4502945|ref|NP_000079.1| alpha 1 type I collagen preproprotei... 49 2e-04
gi|2144803|pir||CGHU1S collagen alpha 1(I) chain precursor - human 49 2e-04
gi|22328092|gb|AAH36531.1| Alpha 1 type I collagen, preproprotei... 49 2e-04
gi|447094|prf||1913392A bullous pemphigoid antigen 49 2e-04
gi|115269|sp|P02452|CA11_HUMAN Collagen alpha 1(I) chain precursor 49 2e-04
gi|15831485|ref|NP_310258.1| putative tail fiber protein [Escher... 49 2e-04
gi|6680970|ref|NP_031763.1| procollagen, type V, alpha 2 [Mus mu... 49 2e-04
gi|32822777|gb|AAH55077.1| Procollagen, type V, alpha 2 [Mus mus... 49 2e-04
gi|49477241|ref|YP_035673.1| collagen-like protein [Bacillus thu... 49 2e-04
gi|6680964|ref|NP_031758.1| procollagen, type XVII, alpha 1 [Mus... 49 2e-04
gi|4755085|gb|AAB94054.2| pro alpha 1(I) collagen [Homo sapiens] 49 2e-04
gi|31240941|ref|XP_320884.1| ENSANGP00000019179 [Anopheles gambi... 49 2e-04
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno... 49 2e-04
gi|34860941|ref|XP_217693.2| similar to alpha 1 type XXIV collag... 49 2e-04
gi|13182888|gb|AAK14972.1| collagen type I alpha 1 [Macaca mulatta] 49 2e-04
gi|30016|emb|CAA30731.1| unnamed protein product [Homo sapiens] ... 49 2e-04
gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79) [... 49 2e-04
gi|41688459|sp|Q07563|CA1G_MOUSE Collagen alpha 1(XVII) chain (B... 49 2e-04
gi|39593314|emb|CAE64784.1| Hypothetical protein CBG09577 [Caeno... 49 2e-04
gi|49479306|ref|YP_036570.1| possible exosporium protein H [Baci... 48 3e-04
gi|20178621|gb|AAL50184.1| collagen-like protein 2 [Streptococcu... 48 3e-04
gi|40548420|ref|NP_954705.1| collectin sub-family member 11 isof... 48 3e-04
gi|13560496|gb|AAK30077.1| collagen-like protein B [Streptococcu... 48 3e-04
gi|31239123|ref|XP_319975.1| ENSANGP00000016783 [Anopheles gambi... 48 3e-04
gi|37498970|gb|AAQ91576.1| collagen-like protein 3 [Streptococcu... 48 3e-04
gi|17505428|ref|NP_492035.1| COLlagen structural gene (col-61) [... 48 3e-04
gi|223760|prf||0910139A collagen alpha1(I)CN8 48 3e-04
gi|179698|gb|AAA51859.1| collagen type V alpha-2 precursor 48 3e-04
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 48 3e-04
gi|27734650|sp||P02453_2 [Segment 2 of 2] Collagen alpha 1(I) chain 48 3e-04
gi|28556885|dbj|BAC57521.1| collagen XVIII homologue [Ciona inte... 48 3e-04
gi|47551003|ref|NP_999675.1| alpha-2 collagen [Strongylocentrotu... 48 3e-04
gi|48097742|ref|XP_391942.1| similar to ENSANGP00000021001 [Apis... 48 3e-04
gi|4519619|dbj|BAA75669.1| collagen pro alpha-chain [Haliotis di... 48 3e-04
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [... 48 3e-04
gi|19263347|ref|NP_597714.1| putative emu2; collagen, type XXVI,... 48 3e-04
gi|476420|pir||CGBO1S collagen alpha 1(I) chain - bovine (tentat... 48 3e-04
gi|4502959|ref|NP_000384.1| alpha 2 type V collagen preproprotei... 48 3e-04
gi|14164349|dbj|BAB55662.1| collagen a3(I) [Oncorhynchus mykiss] 48 3e-04
gi|4502961|ref|NP_000085.1| alpha 1 type VII collagen precursor;... 48 3e-04
gi|16197600|gb|AAL13166.1| type V preprocollagen alpha 2 chain [... 48 3e-04
gi|39597391|emb|CAE59620.1| Hypothetical protein CBG03029 [Caeno... 48 3e-04
gi|11096157|gb|AAG30218.1| collagen-like surface protein [Strept... 48 4e-04
gi|37537826|sp|Q96A84|EMU1_HUMAN Emu1 protein precursor (Emilin ... 48 4e-04
gi|11276913|pir||T45467 collagen alpha 1(II) chain precursor [im... 48 4e-04
gi|38173761|gb|AAH60753.1| MGC69046 protein [Xenopus laevis] 48 4e-04
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno... 48 4e-04
gi|6677921|ref|NP_033186.1| surfactant associated protein D [Mus... 48 4e-04
gi|13560500|gb|AAK30078.1| collagen-like protein B [Streptococcu... 48 4e-04
gi|50737082|ref|XP_419148.1| PREDICTED: similar to collectin sub... 48 4e-04
gi|109679|pir||B41182 collagen alpha 1(II) chain precursor (long... 48 4e-04
gi|38490686|emb|CAE53096.1| alpha-5 collagen [Paracentrotus livi... 48 4e-04
gi|200217|gb|AAA68101.1| pro-alpha-1 type II collagen 48 4e-04
gi|115288|sp|P28481|CA12_MOUSE Collagen alpha 1(II) chain precur... 48 4e-04
gi|10947027|gb|AAC62178.2| type IIA procollagen [Canis familiaris] 48 4e-04
gi|47216524|emb|CAG02175.1| unnamed protein product [Tetraodon n... 48 4e-04
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [... 48 4e-04
gi|13624305|ref|NP_112440.1| procollagen, type II, alpha 1; disp... 48 4e-04
gi|200216|gb|AAA68102.1| pro-alpha-1 type II collagen 48 4e-04
gi|26390235|dbj|BAC25865.1| unnamed protein product [Mus musculus] 48 4e-04
gi|28204822|gb|AAH46358.1| EMI domain containing 1 [Homo sapiens] 48 4e-04
gi|50511941|ref|NP_597712.2| EMI domain containing 1; putative e... 48 4e-04
gi|109680|pir||A41182 collagen alpha 1(II) chain precursor - mouse 48 4e-04
gi|30410850|gb|AAH51383.1| Col2a1 protein [Mus musculus] 48 4e-04
gi|6978677|ref|NP_037061.1| procollagen, type II, alpha 1; Proco... 48 4e-04
gi|50733060|ref|XP_426008.1| PREDICTED: similar to alpha 3 type ... 48 4e-04
gi|30353888|gb|AAH52326.1| Col2a1 protein [Mus musculus] 48 4e-04
gi|48112109|ref|XP_396317.1| similar to CG33171-PC [Apis mellifera] 48 4e-04
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno... 48 4e-04
gi|47565152|ref|ZP_00236195.1| hypothetical protein membrane Spa... 48 4e-04
gi|47086095|ref|NP_998429.1| zgc:85892 [Danio rerio] >gnl|BL_ORD... 48 4e-04
gi|48104621|ref|XP_392960.1| similar to alpha 1 type IX collagen... 48 4e-04
gi|50752016|ref|XP_422615.1| PREDICTED: similar to alpha 4 colla... 48 4e-04
gi|21410158|gb|AAH30913.1| Col2a1 protein [Mus musculus] 48 4e-04
gi|34875214|ref|XP_344422.1| similar to RIKEN cDNA C130058N24 [R... 47 5e-04
gi|47564495|ref|ZP_00235540.1| collagen-like triple helix repeat... 47 5e-04
gi|20988703|gb|AAH29697.1| Procollagen, type IX, alpha 2 [Mus mu... 47 5e-04
gi|34870917|ref|XP_342903.1| similar to procollagen, type IX, al... 47 5e-04
gi|27696688|gb|AAH43613.1| COL5A2 protein [Homo sapiens] 47 5e-04
gi|27502806|gb|AAH42428.1| COL23A1 protein [Homo sapiens] 47 5e-04
gi|50744818|ref|XP_419889.1| PREDICTED: similar to alpha(IX) col... 47 5e-04
gi|27882587|gb|AAH43696.1| Similar to procollagen, type V, alpha... 47 5e-04
gi|17535687|ref|NP_495858.1| ROLler: helically twisted, animals ... 47 5e-04
gi|30041|emb|CAA34683.1| COL2A1 [Homo sapiens] 47 5e-04
gi|15149479|ref|NP_149162.1| alpha 1 type II collagen isoform 2,... 47 5e-04
gi|115287|sp|P02458|CA12_HUMAN Collagen alpha 1(II) chain precur... 47 5e-04
gi|258774|gb|AAB23914.1| type II collagen alpha 1 chain, COL2A1 ... 47 5e-04
gi|1072000|pir||S18251 collagen alpha 1(XI) chain - bovine (frag... 47 5e-04
gi|180811|gb|AAA52038.1| type II collagen 47 5e-04
gi|42783914|ref|NP_981161.1| collagen triple helix repeat domain... 47 5e-04
gi|930050|emb|CAA32030.1| alpha-1 type 2 collagen (714 AA) [Homo... 47 5e-04
gi|39586931|emb|CAE62866.1| Hypothetical protein CBG07049 [Caeno... 47 5e-04
gi|42658209|ref|XP_295195.4| similar to Matn2-prov protein [Homo... 47 5e-04
gi|33642143|gb|AAQ24490.1| type XVII collagen [Sus scrofa] 47 5e-04
gi|47220033|emb|CAG12181.1| unnamed protein product [Tetraodon n... 47 5e-04
gi|22477176|gb|AAH36669.1| COL25A1 protein [Homo sapiens] 47 5e-04
gi|2833342|sp|Q28083|CA1B_BOVIN Collagen alpha 1(XI) chain >gnl|... 47 5e-04
gi|5354049|gb|AAD42346.1| type II collagen cyanogen bromide frag... 47 5e-04
gi|18640526|ref|NP_570367.1| collagen alpha 1(I) chain precursor... 47 5e-04
gi|3164123|emb|CAA12180.1| collagen alpha 2 type V [Rattus norve... 47 5e-04
gi|13235588|emb|CAC33777.1| SclB protein [Streptococcus pyogenes] 47 5e-04
gi|13435125|ref|NP_001835.2| alpha 1 type II collagen isoform 1;... 47 5e-04
gi|1070602|pir||CGHU6C collagen alpha 1(II) chain precursor [val... 47 5e-04
gi|47223062|emb|CAG07149.1| unnamed protein product [Tetraodon n... 47 5e-04
gi|34859865|ref|XP_342326.1| similar to type XI collagen alpha-1... 47 5e-04
gi|31239129|ref|XP_319978.1| ENSANGP00000016652 [Anopheles gambi... 47 5e-04
gi|41222035|ref|XP_371874.1| similar to Matn2-prov protein [Homo... 47 5e-04
gi|41393113|ref|NP_958886.1| collagen, type I, alpha 3 [Danio re... 47 5e-04
gi|29436389|gb|AAH49829.1| Col1a1-prov protein [Xenopus laevis] 47 5e-04
gi|180396|gb|AAA51997.1| collagen alpha-1(II) 47 5e-04
gi|2137076|pir||I48103 type VII collagen - Chinese hamster (frag... 47 5e-04
gi|29725624|ref|NP_775736.2| collagen, type XXIII, alpha 1; proc... 47 5e-04
gi|7670050|dbj|BAA94972.1| type I collagen alpha 1 [Xenopus laevis] 47 5e-04
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ... 47 5e-04
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno... 47 5e-04
gi|17539786|ref|NP_502175.1| COLlagen structural gene (45.3 kD) ... 47 6e-04
gi|34875146|ref|XP_344415.1| similar to Hypothetical protein MGC... 47 6e-04
gi|30983559|gb|AAN85822.1| exosporium protein [Bacillus cereus] ... 47 6e-04
gi|47222288|emb|CAG05037.1| unnamed protein product [Tetraodon n... 47 6e-04
gi|1418930|emb|CAA98969.1| prepro-alpha2(I) collagen [Homo sapiens] 47 6e-04
gi|48256849|gb|AAT41626.1| collagen type IX-like [Ciona intestin... 47 6e-04
gi|8134352|sp|O46392|CA21_CANFA Collagen alpha 2(I) chain precur... 47 6e-04
gi|42542708|gb|AAH66384.1| Collagen, type I, alpha 3 [Danio rerio] 47 6e-04
gi|47568416|ref|ZP_00239117.1| BclA protein [Bacillus cereus G92... 47 6e-04
gi|50751366|ref|XP_422363.1| PREDICTED: similar to collagen, typ... 47 6e-04
gi|49184150|ref|YP_027402.1| conserved hypothetical protein [Bac... 47 6e-04
gi|47218418|emb|CAG12689.1| unnamed protein product [Tetraodon n... 47 6e-04
gi|28475233|emb|CAD56876.1| BclA protein [Bacillus anthracis] 47 6e-04
gi|28475223|emb|CAD56871.1| BclA protein [Bacillus anthracis] 47 6e-04
gi|21105301|gb|AAM34600.1| precollagen-P [Mytilus galloprovincia... 47 6e-04
gi|214044|gb|AAA49679.1| alpha-1 type II' collagen 47 6e-04
gi|47222135|emb|CAG11561.1| unnamed protein product [Tetraodon n... 47 6e-04
gi|180392|gb|AAA51995.1| alpha 1 (I) chain propeptide 47 6e-04
gi|50759812|ref|XP_417793.1| PREDICTED: similar to Brain-specifi... 47 6e-04
gi|28475221|emb|CAD56870.1| BclA protein [Bacillus anthracis] 47 6e-04
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ... 47 6e-04
gi|15777923|dbj|BAB68504.1| adipocyte-specific protein 6 [Mus mu... 47 6e-04
gi|627830|pir||A61396 collagen alpha 1(II) chain - golden hamste... 47 6e-04
gi|29789010|ref|NP_034066.1| procollagen, type IX, alpha 3 [Mus ... 47 6e-04
gi|27806257|ref|NP_776945.1| collagen, type I, alpha 2 [Bos taur... 47 6e-04
gi|28475225|emb|CAD56872.1| BclA protein [Bacillus anthracis] 47 6e-04
gi|47228931|emb|CAG09446.1| unnamed protein product [Tetraodon n... 47 6e-04
gi|30021453|ref|NP_833084.1| Collagen-like triple helix repeat p... 47 6e-04
gi|17534889|ref|NP_495294.1| COLlagen structural gene (col-75) [... 47 6e-04
gi|18028926|gb|AAL56219.1| alpha-3 type IX collagen [Mus musculus] 47 6e-04
gi|21399133|ref|NP_655118.1| hypothetical protein predicted by G... 47 6e-04
gi|85719|pir||A40333 collagen alpha 1'(II) chain precursor - Afr... 47 6e-04
gi|30020696|ref|NP_832327.1| Collagen triple helix repeat protei... 47 8e-04
gi|39593808|emb|CAE62101.1| Hypothetical protein CBG06131 [Caeno... 47 8e-04
gi|50732527|ref|XP_418677.1| PREDICTED: similar to matrilin 3 pr... 47 8e-04
gi|12859657|dbj|BAB31724.1| unnamed protein product [Mus musculus] 47 8e-04
gi|1340175|emb|CAA28454.1| unnamed protein product [Homo sapiens] 47 8e-04
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 47 8e-04
gi|28574366|ref|NP_788471.1| CG33171-PC [Drosophila melanogaster... 47 8e-04
gi|15209312|emb|CAC51030.1| procollagen type I alpha 2 chain [Da... 47 8e-04
gi|39583705|emb|CAE63809.1| Hypothetical protein CBG08355 [Caeno... 47 8e-04
gi|39936655|ref|NP_948931.1| Collagen triple helix repeat:Antifr... 47 8e-04
gi|30023|emb|CAA68709.1| unnamed protein product [Homo sapiens] 47 8e-04
gi|27924402|gb|AAH44962.1| LOC397739 protein [Xenopus laevis] 47 8e-04
gi|45552074|ref|NP_788472.2| CG33171-PE [Drosophila melanogaster... 47 8e-04
gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54) [... 47 8e-04
gi|17550832|ref|NP_509555.1| COLlagen structural gene (28.5 kD) ... 47 8e-04
gi|2388555|gb|AAB69977.1| alpha2(I) collagen [Homo sapiens] 47 8e-04
gi|39595378|emb|CAE60416.1| Hypothetical protein CBG04022 [Caeno... 47 8e-04
gi|29387355|gb|AAH48221.1| COL2A1 protein [Xenopus laevis] 47 8e-04
gi|214042|gb|AAA49678.1| alpha-1 type II collagen 47 8e-04
gi|104010|pir||B40333 collagen alpha 1(II) chain precursor - Afr... 47 8e-04
gi|21105299|gb|AAM34599.1| precollagen-NG [Mytilus galloprovinci... 47 8e-04
gi|47220653|emb|CAG06575.1| unnamed protein product [Tetraodon n... 47 8e-04
gi|975685|emb|CAA62496.1| alpha 1 type XI collagen [Mus musculus] 47 8e-04
gi|30054|emb|CAA29886.1| alpha1 (III) collagen [Homo sapiens] 47 8e-04
gi|38014150|gb|AAH08760.3| COL5A1 protein [Homo sapiens] 47 8e-04
gi|47212700|emb|CAF92367.1| unnamed protein product [Tetraodon n... 47 8e-04
gi|34864197|ref|XP_219976.2| similar to collagen type XVII [Ratt... 47 8e-04
gi|1070605|pir||CGHU2S collagen alpha 2(I) chain precursor - human 47 8e-04
gi|32451581|gb|AAH54498.1| Alpha 2 type I collagen [Homo sapiens... 47 8e-04
gi|2735715|gb|AAB93981.1| pro-alpha 2(I) collagen [Homo sapiens] 47 8e-04
gi|179596|gb|AAB59374.1| pre-pro-alpha-2 type I collagen [Homo s... 47 8e-04
gi|48762934|ref|NP_000080.2| alpha 2 type I collagen; Collagen I... 47 8e-04
gi|19855162|sp|P08123|CA21_HUMAN Collagen alpha 2(I) chain precu... 47 8e-04
gi|3513512|gb|AAC33847.1| nongradient byssal precursor [Mytilus ... 47 8e-04
gi|180428|gb|AAA52007.1| human collagen type V alpha-2 chain 47 8e-04
gi|39591910|emb|CAE75130.1| Hypothetical protein CBG23058 [Caeno... 47 8e-04
gi|15675046|ref|NP_269220.1| putative collagen-like protein [Str... 46 0.001
gi|29466645|dbj|BAC66788.1| collagen like protein ClgA [Streptoc... 46 0.001
gi|50758084|ref|XP_415753.1| PREDICTED: similar to putative emu2... 46 0.001
gi|47569234|ref|ZP_00239920.1| hypothetical protein membrane Spa... 46 0.001
gi|20072300|gb|AAH26446.1| Scara3 protein [Mus musculus] 46 0.001
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder... 46 0.001
gi|3171998|emb|CAA06510.1| collagen alpha 1 (III) [Rattus norveg... 46 0.001
gi|31745150|ref|NP_853667.1| procollagen, type XXIII, alpha 1 [R... 46 0.001
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 46 0.001
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 46 0.001
gi|71405|pir||CGCH1S collagen alpha 1(I) chain - chicken (tentat... 46 0.001
gi|17540094|ref|NP_499869.1| predicted CDS, COLlagen structural ... 46 0.001
gi|34877879|ref|XP_341575.1| similar to collectin placenta 1 [Ra... 46 0.001
gi|543912|sp|P13941|CA13_RAT Collagen alpha 1(III) chain >gnl|BL... 46 0.001
gi|37589303|gb|AAH59281.1| Col1a1 protein [Mus musculus] 46 0.001
gi|32140760|ref|NP_116277.2| collagen, type XXVII, alpha 1 [Homo... 46 0.001
gi|17402879|ref|NP_478055.1| alpha 2 type VI collagen isoform 2C... 46 0.001
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [... 46 0.001
gi|16758080|ref|NP_445808.1| procollagen, type I, alpha 2 [Rattu... 46 0.001
gi|86224|pir||A05269 collagen alpha 1(III) chain precursor - chi... 46 0.001
gi|50603950|gb|AAH77461.1| Unknown (protein for MGC:82441) [Xeno... 46 0.001
gi|26335321|dbj|BAC31361.1| unnamed protein product [Mus musculus] 46 0.001
gi|31746645|gb|AAC19194.2| Collagen protein 99 [Caenorhabditis e... 46 0.001
gi|115268|sp|P02457|CA11_CHICK Collagen alpha 1(I) chain precursor 46 0.001
gi|11096141|gb|AAG30210.1| collagen-like surface protein [Strept... 46 0.001
gi|2506305|sp|P11087|CA11_MOUSE Collagen alpha 1(I) chain precur... 46 0.001
gi|41350923|gb|AAH65509.1| Alpha 2 type VI collagen, isoform 2C2... 46 0.001
gi|21901969|dbj|BAC05523.1| collectin placenta 1 [Mus musculus] ... 46 0.001
gi|2894106|emb|CAB01633.1| Collagen alpha1 [Rattus norvegicus] 46 0.001
gi|18485494|ref|NP_569716.1| collectin sub-family member 12 [Mus... 46 0.001
gi|27688933|ref|XP_213440.1| similar to Collagen alpha1 [Rattus ... 46 0.001
gi|27808647|sp|P12110|CA26_HUMAN Collagen alpha 2(VI) chain prec... 46 0.001
gi|17402875|ref|NP_001840.2| alpha 2 type VI collagen isoform 2C... 46 0.001
gi|34328108|ref|NP_031768.2| procollagen, type I, alpha 1 [Mus m... 46 0.001
>gi|17539078|ref|NP_502507.1| COLlagen structural gene (col-131)
[Caenorhabditis elegans]
gi|7497221|pir||T19846 hypothetical protein C39E9.3 -
Caenorhabditis elegans
gi|3874838|emb|CAA94329.1| Hypothetical protein C39E9.3
[Caenorhabditis elegans]
Length = 308
Score = 419 bits (1077), Expect = e-116
Identities = 224/308 (72%), Positives = 224/308 (72%)
Frame = -1
Query: 927 MSSEILVIGTXXXXXXXXXXXXLQTKNDLDQVWAEFDQEVQEVTVLREASWNTLRNLATA 748
MSSEILVIGT LQTKNDLDQVWAEFDQEVQEVTVLREASWNTLRNLATA
Sbjct: 1 MSSEILVIGTSLFVFLSVLVFVLQTKNDLDQVWAEFDQEVQEVTVLREASWNTLRNLATA 60
Query: 747 KKIPIERSKRQSYYEKVADSYALPPSLGVEAHAPSISPXXXXXXXXXXCPAGPSGPKGLP 568
KKIPIERSKRQSYYEKVADSYALPPSLGVEAHAPSISP CPAGPSGPKGLP
Sbjct: 61 KKIPIERSKRQSYYEKVADSYALPPSLGVEAHAPSISPECNCNLENNNCPAGPSGPKGLP 120
Query: 567 GQDGAPGEPGPAGKMGQNTGDVQTMHVDPGCQYCXXXXXXXXXXXGKIGPRGQRGQSXXX 388
GQDGAPGEPGPAGKMGQNTGDVQTMHVDPGCQYC GKIGPRGQRGQS
Sbjct: 121 GQDGAPGEPGPAGKMGQNTGDVQTMHVDPGCQYCPAGEMGPPGAPGKIGPRGQRGQSGGA 180
Query: 387 XXXXXXXXXXXXGELXXXXXXXXXXXXXXXXXXGMDTVREKXXXXXXXXXXXXXXXXXXG 208
GEL GMDTVREK G
Sbjct: 181 GTPGNNGAPGHNGELGPCGQAGPPGPAGAIGRRGMDTVREKGVRGPIGAPGPVGPVGMEG 240
Query: 207 DRGNRGGLGVDGPLGSIGLQGPPGRTGSTGDVGESGPIGPNGQDALYCPCPKRVADGAGG 28
DRGNRGGLGVDGPLGSIGLQGPPGRTGSTGDVGESGPIGPNGQDALYCPCPKRVADGAGG
Sbjct: 241 DRGNRGGLGVDGPLGSIGLQGPPGRTGSTGDVGESGPIGPNGQDALYCPCPKRVADGAGG 300
Query: 27 GVYQPYKQ 4
GVYQPYKQ
Sbjct: 301 GVYQPYKQ 308