Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C34F11_2
(2685 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17532317|ref|NP_494971.1| protein kinase with SH2 and coiled-... 1107 0.0
gi|39596836|emb|CAE59063.1| Hypothetical protein CBG02348 [Caeno... 491 e-137
gi|39595643|emb|CAE67145.1| Hypothetical protein CBG12568 [Caeno... 140 2e-31
gi|17540892|ref|NP_501818.1| fer oncogene Related Kinase (44.6 k... 137 1e-30
gi|40714572|gb|AAR88544.1| RE17878p [Drosophila melanogaster] 130 1e-28
gi|18150824|dbj|BAA81712.3| protein tyrosine kinase [Ephydatia f... 130 2e-28
gi|2967840|gb|AAC05835.1| c-Src kinase [Xenopus laevis] 130 2e-28
gi|66802|pir||TVFFDS protein-tyrosine kinase (EC 2.7.1.112) src2... 128 8e-28
gi|17136510|ref|NP_476745.1| CG8049-PB [Drosophila melanogaster]... 127 1e-27
gi|2723313|dbj|BAA24064.1| Dsrc29A type 2 protein [Drosophila me... 127 1e-27
gi|2723311|dbj|BAA24063.1| Dsrc29A type 1 protein [Drosophila me... 127 1e-27
gi|17136512|ref|NP_476746.1| CG8049-PA [Drosophila melanogaster]... 127 1e-27
gi|2827464|gb|AAB99858.1| TEC29 [Drosophila melanogaster] 127 1e-27
gi|48139059|ref|XP_396962.1| similar to ENSANGP00000008377 [Apis... 125 4e-27
gi|31222210|ref|XP_317149.1| ENSANGP00000006704 [Anopheles gambi... 124 9e-27
gi|45382211|ref|NP_990756.1| src kinase [Gallus gallus] >gnl|BL_... 124 1e-26
gi|33304159|gb|AAQ02587.1| c-src tyrosine kinase [synthetic cons... 123 2e-26
gi|31201161|ref|XP_309528.1| ENSANGP00000008377 [Anopheles gambi... 123 2e-26
gi|31560712|ref|NP_031809.2| c-src tyrosine kinase [Mus musculus... 123 2e-26
gi|4758078|ref|NP_004374.1| c-src tyrosine kinase [Homo sapiens]... 123 2e-26
gi|34863591|ref|XP_236290.2| similar to Tyrosine-protein kinase ... 123 2e-26
gi|18150842|dbj|BAA81721.3| protein tyrosine kinase [Ephydatia f... 123 3e-26
gi|729888|sp|P41241|CSK_MOUSE Tyrosine-protein kinase CSK (C-SRC... 123 3e-26
gi|17508233|ref|NP_492004.1| tyrosine kinase (kin-14) [Caenorhab... 122 3e-26
gi|37926803|pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhes... 122 5e-26
gi|20988799|gb|AAH30180.1| Ptk2 protein [Mus musculus] 122 5e-26
gi|6981440|ref|NP_037213.1| protein tyrosine kinase 2; Protein t... 122 5e-26
gi|27886593|ref|NP_005598.3| PTK2 protein tyrosine kinase 2 isof... 122 5e-26
gi|27529716|dbj|BAC53890.1| focal adhesion kinase spliced varian... 122 5e-26
gi|26348235|dbj|BAC37757.1| unnamed protein product [Mus musculus] 122 5e-26
gi|7446401|pir||JC5494 protein-tyrosine kinase (EC 2.7.1.112) - rat 122 5e-26
gi|21754176|dbj|BAC04470.1| unnamed protein product [Homo sapiens] 122 5e-26
gi|6679741|ref|NP_032008.1| PTK2 protein tyrosine kinase 2; foca... 122 5e-26
gi|24476013|ref|NP_722560.1| PTK2 protein tyrosine kinase 2 isof... 122 5e-26
gi|22654236|sp|P34152|FAK1_MOUSE Focal adhesion kinase 1 (FADK 1... 122 5e-26
gi|23273417|gb|AAH35404.1| PTK2 protein [Homo sapiens] 122 5e-26
gi|22382094|gb|AAH28733.1| PTK2 protein [Homo sapiens] 122 5e-26
gi|50761018|ref|XP_418206.1| PREDICTED: similar to Tyrosine-prot... 122 6e-26
gi|50416266|gb|AAH77883.1| Unknown (protein for MGC:80670) [Xeno... 122 6e-26
gi|17541454|ref|NP_501761.1| tyrosine kinase family member (kin-... 122 6e-26
gi|47507478|gb|AAH71046.1| MGC83487 protein [Xenopus laevis] 121 8e-26
gi|33303803|gb|AAQ02415.1| BMX non-receptor tyrosine kinase [syn... 121 8e-26
gi|4502435|ref|NP_001712.1| BMX non-receptor tyrosine kinase [Ho... 121 1e-25
gi|3002963|gb|AAC08966.1| Etk/Bmx cytosolic tyrosine kinase [Hom... 121 1e-25
gi|20141440|sp|Q91738|FAK1_XENLA Focal adhesion kinase 1 (FADK 1... 120 1e-25
gi|1362692|pir||JC4200 protein-tyrosine kinase (EC 2.7.1.112) - ... 120 1e-25
gi|345664|pir||A45388 protein-tyrosine kinase (EC 2.7.1.112) - c... 120 2e-25
gi|45382167|ref|NP_990766.1| focal adhesion kinase [Gallus gallu... 120 2e-25
gi|39580736|emb|CAE64122.1| Hypothetical protein CBG08738 [Caeno... 119 3e-25
gi|6753196|ref|NP_033889.1| BMX non-receptor tyrosine kinase [Mu... 119 4e-25
gi|47220802|emb|CAG00009.1| unnamed protein product [Tetraodon n... 118 7e-25
gi|251793|gb|AAB22579.1| srk1 protein kinase=src-related tyrosin... 118 9e-25
gi|39595195|emb|CAE60232.1| Hypothetical protein CBG03803 [Caeno... 118 9e-25
gi|39595711|emb|CAE67214.1| Hypothetical protein CBG12650 [Caeno... 117 1e-24
gi|18858661|ref|NP_571871.1| protein tyrosine kinase 2.1; PTK2 p... 117 1e-24
gi|38488741|ref|NP_942114.1| protein tyrosine kinase 2.2; protei... 117 1e-24
gi|546693|gb|AAB30743.1| ZAP-70=protein tyrosine kinase Syk homo... 117 2e-24
gi|31981916|ref|NP_033565.2| zeta-chain (TCR) associated protein... 116 2e-24
gi|33304179|gb|AAQ02597.1| tec protein tyrosine kinase [syntheti... 116 2e-24
gi|26453338|dbj|BAC43746.1| truncated ZAP kinase [Mus musculus] 116 2e-24
gi|15020806|emb|CAC44628.1| tyrosine protein kinase BTK [Takifug... 116 2e-24
gi|17537903|ref|NP_494994.1| tyrosine kinase (2F585) [Caenorhabd... 116 3e-24
gi|4507429|ref|NP_003206.1| tec protein tyrosine kinase [Homo sa... 116 3e-24
gi|48098662|ref|XP_394128.1| similar to ENSANGP00000006704 [Apis... 116 3e-24
gi|47224486|emb|CAG08736.1| unnamed protein product [Tetraodon n... 116 3e-24
gi|1177045|sp|P43404|ZA70_MOUSE Tyrosine-protein kinase ZAP-70 (... 115 4e-24
gi|40215698|gb|AAR82769.1| LP09923p [Drosophila melanogaster] 115 4e-24
gi|32563673|ref|NP_492594.2| protein kinase transforming protein... 115 4e-24
gi|47211144|emb|CAF96564.1| unnamed protein product [Tetraodon n... 115 4e-24
gi|17538768|ref|NP_501081.1| SH2 motif and protein kinase family... 115 4e-24
gi|24646022|ref|NP_731607.1| CG17309-PB [Drosophila melanogaster... 115 4e-24
gi|7499927|pir||T21417 hypothetical protein F26E4.5 - Caenorhabd... 115 4e-24
gi|45550738|ref|NP_650097.2| CG17309-PA [Drosophila melanogaster... 115 4e-24
gi|47086347|ref|NP_998008.1| spleen tyrosine kinase; spleen prot... 115 6e-24
gi|41352677|gb|AAS01047.1| Src family kinase [Asterina miniata] 115 6e-24
gi|33304173|gb|AAQ02594.1| TXK tyrosine kinase [synthetic constr... 115 6e-24
gi|31076339|dbj|BAC76831.1| CSK-1 [Caenorhabditis elegans] >gnl|... 115 7e-24
gi|47217374|emb|CAG00734.1| unnamed protein product [Tetraodon n... 115 7e-24
gi|17508235|ref|NP_493502.1| src family, fyn and suppressor of p... 115 7e-24
gi|47229377|emb|CAF99365.1| unnamed protein product [Tetraodon n... 115 7e-24
gi|49899860|gb|AAH76889.1| Unknown (protein for MGC:88962) [Xeno... 114 9e-24
gi|18146650|dbj|BAB82422.1| protein tyrosine kinase [Ephydatia f... 114 9e-24
gi|47220919|emb|CAG03126.1| unnamed protein product [Tetraodon n... 114 9e-24
gi|34880173|ref|XP_347278.1| similar to protein tyrosine kinase ... 114 1e-23
gi|34877399|ref|XP_223365.2| similar to Txk [Rattus norvegicus] 114 1e-23
gi|31216963|ref|XP_316335.1| ENSANGP00000005994 [Anopheles gambi... 114 1e-23
gi|31377435|gb|AAN38839.1| focal adhesion kinase [Lytechinus var... 114 1e-23
gi|4507743|ref|NP_003319.1| TXK tyrosine kinase; PTK4 protein ty... 114 2e-23
gi|6382058|ref|NP_009297.1| v-abl Abelson murine leukemia viral ... 114 2e-23
gi|4885045|ref|NP_005148.1| v-abl Abelson murine leukemia viral ... 114 2e-23
gi|1161364|gb|AAB60412.1| tyrosine kinase 113 2e-23
gi|40796142|ref|NP_955595.1| ABL [Abelson murine leukemia virus]... 113 2e-23
gi|5912560|emb|CAB56204.1| unnamed protein product [Abelson muri... 113 2e-23
gi|1684833|gb|AAB36538.1| tyrosine kinase [Mus musculus] 113 2e-23
gi|9626954|ref|NP_057866.1| p120 polyprotein [Abelson murine leu... 113 2e-23
gi|3560565|gb|AAC35011.1| non-receptor protein-tyrosine kinase C... 113 2e-23
gi|37590684|gb|AAH59260.1| Abl1 protein [Mus musculus] 113 2e-23
gi|125137|sp|P00520|ABL1_MOUSE Proto-oncogene tyrosine-protein k... 113 2e-23
gi|33859504|ref|NP_033724.1| v-abl Abelson murine leukemia oncog... 113 2e-23
gi|61488|emb|CAA24781.1| oncogene v-abl [Abelson murine leukemia... 113 2e-23
gi|1174826|sp|P42682|TXK_MOUSE Tyrosine-protein kinase TXK (PTK-... 113 3e-23
gi|7305601|ref|NP_038726.1| TXK tyrosine kinase [Mus musculus] >... 113 3e-23
gi|50757306|ref|XP_415463.1| PREDICTED: similar to Proto-oncogen... 113 3e-23
gi|514268|gb|AAB60393.1| proto-oncogene tyrosine-protein kinase ... 113 3e-23
gi|2144425|pir||TVHUA protein-tyrosine kinase (EC 2.7.1.112) abl... 113 3e-23
gi|514267|gb|AAB60394.1| proto-oncogene tyrosine-protein kinase ... 113 3e-23
gi|125135|sp|P00519|ABL1_HUMAN Proto-oncogene tyrosine-protein k... 113 3e-23
gi|13924736|gb|AAK49117.1| spleen protein tyrosine kinase [Cypri... 112 4e-23
gi|6435671|pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal... 112 4e-23
gi|34555808|emb|CAA92623.2| Hypothetical protein W01B6.5 [Caenor... 112 4e-23
gi|39595891|emb|CAE67394.1| Hypothetical protein CBG12879 [Caeno... 112 4e-23
gi|5453033|gb|AAD43406.1| protein tyrosine kinase TecIII [Mus mu... 112 5e-23
gi|34877298|ref|XP_341209.1| similar to protein tyrosine kinase ... 112 5e-23
gi|5453029|gb|AAD43402.1| protein tyrosine kinase TecIV [Mus mus... 112 5e-23
gi|38566061|gb|AAH62884.1| Tec protein [Mus musculus] 112 5e-23
gi|24657846|gb|AAH39039.1| ZAP70 protein [Homo sapiens] 112 6e-23
gi|39584908|emb|CAE64332.1| Hypothetical protein CBG09015 [Caeno... 112 6e-23
gi|38073524|ref|XP_136360.2| v-abl Abelson murine leukemia viral... 112 6e-23
gi|125134|sp|P10447|ABL_FSVHY Tyrosine-protein kinase transformi... 112 6e-23
gi|46488944|ref|NP_997402.1| zeta-chain associated protein kinas... 112 6e-23
gi|625609|pir||A26132 gag-abl-pol polyprotein - feline sarcoma v... 112 6e-23
gi|346421|pir||A44266 protein-tyrosine kinase (EC 2.7.1.112) ZAP... 112 6e-23
gi|31455611|ref|NP_001070.2| zeta-chain associated protein kinas... 112 6e-23
gi|39580840|emb|CAE73101.1| Hypothetical protein CBG20481 [Caeno... 111 8e-23
gi|30749934|pdb|1OPK|A Chain A, Structural Basis For The Auto-In... 111 8e-23
gi|18146648|dbj|BAB82421.1| protein tyrosine kinase [Ephydatia f... 111 1e-22
gi|7305569|ref|NP_038717.1| cytoplasmic tyrosine kinase, Dscr28C... 111 1e-22
gi|50744566|ref|XP_419779.1| PREDICTED: similar to src related t... 111 1e-22
gi|26332200|dbj|BAC29830.1| unnamed protein product [Mus musculus] 111 1e-22
gi|34875595|ref|XP_217382.2| similar to Zap70 protein [Rattus no... 111 1e-22
gi|212713|gb|AAA49081.1| c-tkl tyrosine kinase (EC 2.7.1.112) 111 1e-22
gi|30749935|pdb|1OPL|A Chain A, Structural Basis For The Auto-In... 111 1e-22
gi|42406387|gb|AAH65912.1| ABL2 protein [Homo sapiens] 111 1e-22
gi|1071850|pir||A39939 protein-tyrosine kinase (EC 2.7.1.112) tk... 111 1e-22
gi|6382062|ref|NP_009298.1| v-abl Abelson murine leukemia viral ... 111 1e-22
gi|6382060|ref|NP_005149.2| v-abl Abelson murine leukemia viral ... 111 1e-22
gi|1170731|sp|P42683|LCK_CHICK Proto-oncogene tyrosine-protein k... 111 1e-22
gi|31874804|emb|CAD98092.1| hypothetical protein [Homo sapiens] 111 1e-22
gi|41352671|gb|AAS01044.1| C-terminal Src kinase [Asterina miniata] 111 1e-22
gi|220614|dbj|BAA03129.1| tyrosine kinase [Mus musculus] >gnl|BL... 111 1e-22
gi|18858911|ref|NP_571179.1| IL2-inducible T-cell kinase; tec-fa... 111 1e-22
gi|6754386|ref|NP_034713.1| IL2-inducible T-cell kinase [Mus mus... 111 1e-22
gi|17506773|ref|NP_490975.1| SH2 motif and protein kinase family... 110 1e-22
gi|1174439|sp|P42690|SRK4_SPOLA Tyrosine-protein kinase isoform ... 110 1e-22
gi|40352731|gb|AAH64688.1| MGC69056 protein [Xenopus laevis] 110 1e-22
gi|17544448|ref|NP_503024.1| protein kinase and SH2 motif family... 110 2e-22
gi|17544472|ref|NP_503039.1| protein kinase and SH2 motif family... 110 2e-22
gi|57582|emb|CAA44218.1| protein-tyrosine kinase [Rattus rattus] 110 2e-22
gi|47225646|emb|CAG07989.1| unnamed protein product [Tetraodon n... 110 2e-22
gi|50754979|ref|XP_414568.1| PREDICTED: similar to IL2-inducible... 110 2e-22
gi|24665444|ref|NP_524843.2| CG4032-PA [Drosophila melanogaster]... 110 2e-22
gi|3550651|emb|CAA76605.1| tyrosine kinase [Sycon raphanus] 110 2e-22
gi|31212217|ref|XP_315093.1| ENSANGP00000002451 [Anopheles gambi... 110 2e-22
gi|125133|sp|P00522|ABL_DROME Tyrosine-protein kinase Abl (D-ash... 110 2e-22
gi|30145800|emb|CAB55139.2| Hypothetical protein Y116A8C.38 [Cae... 110 2e-22
gi|32264368|gb|AAP78682.1| MBSRC1 [Monosiga brevicollis] 110 2e-22
gi|34871240|ref|XP_343881.1| similar to tyrosine kinase [Rattus ... 110 2e-22
gi|50751126|ref|XP_422269.1| PREDICTED: similar to v-abl Abelson... 110 2e-22
gi|5453034|gb|AAD43407.1| protein tyrosine kinase TecIIA [Mus mu... 109 3e-22
gi|91867|pir||JU0215 protein-tyrosine kinase (EC 2.7.1.112) tec,... 109 3e-22
gi|157176|gb|AAA28443.1| dash peptide 109 3e-22
gi|5453032|gb|AAD43405.1| protein tyrosine kinase TecIIB [Mus mu... 109 3e-22
gi|24657868|ref|NP_524934.2| CG7524-PB [Drosophila melanogaster]... 109 3e-22
gi|158501|gb|AAA28913.1| c-src tyrosine kinase 109 3e-22
gi|38079278|ref|XP_355556.1| similar to Txk [Mus musculus] 109 3e-22
gi|1174631|sp|P24604|TEC_MOUSE Tyrosine-protein kinase Tec >gnl|... 109 3e-22
gi|7506130|pir||T23832 protein-tyrosine kinase (EC 2.7.1.112) ab... 109 4e-22
gi|25147104|ref|NP_509778.2| related to oncogene ABL (138.3 kD) ... 109 4e-22
gi|47226186|emb|CAG08333.1| unnamed protein product [Tetraodon n... 109 4e-22
gi|552072|gb|AAA28129.1| abl-like putative oncogene; putative [C... 109 4e-22
gi|47213587|emb|CAF93490.1| unnamed protein product [Tetraodon n... 109 4e-22
gi|7503796|pir||T22405 protein-tyrosine kinase (EC 2.7.1.112) F4... 109 4e-22
gi|7495093|pir||T18802 hypothetical protein C01C7.1 - Caenorhabd... 109 4e-22
gi|18146654|dbj|BAB82424.1| protein tyrosine kinase [Ephydatia f... 109 4e-22
gi|8393032|ref|NP_059014.1| protein tyrosine kinase 2 beta; cell... 109 4e-22
gi|3182998|sp|P70600|FAK2_RAT Protein tyrosine kinase 2 beta (Fo... 109 4e-22
gi|25147108|ref|NP_509777.2| related to oncogene ABL (abl-1) [Ca... 109 4e-22
gi|9837322|gb|AAG00530.1| TEC kinase [Rattus norvegicus] 109 4e-22
gi|346326|pir||PC1225 protein-tyrosine kinase (EC 2.7.1.112) FAK... 109 4e-22
gi|1174436|sp|P42686|SRK1_SPOLA Tyrosine-protein kinase isoform ... 109 4e-22
gi|125709|sp|P14085|SRC_AVIST Tyrosine-protein kinase transformi... 109 4e-22
gi|25147111|ref|NP_509779.2| related to oncogene ABL (abl-1) [Ca... 109 4e-22
gi|125706|sp|P15054|SRC_AVIS2 Tyrosine-protein kinase transformi... 109 4e-22
gi|17538188|ref|NP_502418.1| A Ras-regulating Kinase ARK-1, Regu... 109 4e-22
gi|31208911|ref|XP_313422.1| ENSANGP00000020160 [Anopheles gambi... 108 5e-22
gi|34880098|ref|XP_346303.1| similar to protein tyrosine kinase ... 108 5e-22
gi|7504726|pir||T29911 hypothetical protein F59A3.8 - Caenorhabd... 108 5e-22
gi|125714|sp|P00524|SRC_RSVSR Tyrosine-protein kinase transformi... 108 5e-22
gi|17539772|ref|NP_503111.1| met onco (49.0 kD) (4S388) [Caenorh... 108 5e-22
gi|1165219|gb|AAC05330.1| cell adhesion kinase beta [Homo sapiens] 108 5e-22
gi|25141286|ref|NP_491620.2| fps oncogene analog family member (... 108 5e-22
gi|39587901|emb|CAE67920.1| Hypothetical protein CBG13518 [Caeno... 108 5e-22
gi|13242263|ref|NP_077344.1| src related tyrosine kinase [Rattus... 108 5e-22
gi|39585234|emb|CAE57477.1| Hypothetical protein CBG00445 [Caeno... 108 5e-22
gi|48106047|ref|XP_396043.1| similar to ENSANGP00000005994 [Apis... 108 5e-22
gi|39595514|emb|CAE60552.1| Hypothetical protein CBG04179 [Caeno... 108 5e-22
gi|50747015|ref|XP_420720.1| PREDICTED: similar to Tyrosine-prot... 108 5e-22
gi|1245415|gb|AAA93470.1| tyrosine kinase [Drosophila melanogaster] 108 7e-22
gi|1708153|sp|P50545|HCK_RAT Tyrosine-protein kinase HCK (p56-HC... 108 7e-22
gi|34734058|ref|NP_037317.2| hemopoietic cell kinase; hemopoieti... 108 7e-22
gi|31077218|gb|EAA46344.1| GLP_165_55627_54044 [Giardia lamblia ... 108 7e-22
gi|249851|gb|AAB96845.1| tsUP1 Src [Rous sarcoma virus] 108 7e-22
gi|34784998|gb|AAH36651.1| PTK2B protein tyrosine kinase 2 beta,... 108 7e-22
gi|27886584|ref|NP_004094.3| PTK2B protein tyrosine kinase 2 bet... 108 7e-22
gi|1082034|gb|AAB47217.1| focal adhesion kinase [Homo sapiens] >... 108 7e-22
gi|27886588|ref|NP_775267.1| PTK2B protein tyrosine kinase 2 bet... 108 7e-22
gi|39587880|emb|CAE67898.1| Hypothetical protein CBG13495 [Caeno... 108 7e-22
gi|34535707|dbj|BAC87404.1| unnamed protein product [Homo sapiens] 108 7e-22
gi|66841|pir||OKFFPS protein-tyrosine kinase (EC 2.7.1.112), fps... 108 7e-22
gi|10835731|pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase ... 108 9e-22
gi|210271|gb|AAA42585.1| pp60v-src protein 108 9e-22
gi|49617830|gb|AAT67598.1| Src tyrosine kinase 3 [Suberites domu... 108 9e-22
gi|30411071|gb|AAH51270.1| SRC protein [Homo sapiens] 107 1e-21
gi|2392337|pdb|1FMK| Crystal Structure Of Human Tyrosine-Protei... 107 1e-21
gi|5729678|gb|AAC60250.2| protein tyrosine kinase [Raja eglanteria] 107 1e-21
gi|625219|pir||TVHUSC protein-tyrosine kinase (EC 2.7.1.112) src... 107 1e-21
gi|17541450|ref|NP_501793.1| SH2 motif and protein kinase family... 107 1e-21
gi|4885609|ref|NP_005408.1| proto-oncogene tyrosine-protein kina... 107 1e-21
gi|47086887|ref|NP_997735.1| protein tyrosine kinase 2 beta; pro... 107 1e-21
gi|18150826|dbj|BAA81713.3| protein tyrosine kinase [Ephydatia f... 107 1e-21
gi|347052|gb|AAC37877.1| protein-tyrosine kinase 107 1e-21
gi|48138570|ref|XP_396908.1| similar to ENSANGP00000010020 [Apis... 107 2e-21
gi|66788|pir||TVMSHC protein-tyrosine kinase (EC 2.7.1.112) hck ... 107 2e-21
gi|31217951|ref|XP_316537.1| ENSANGP00000010020 [Anopheles gambi... 107 2e-21
gi|34734056|ref|NP_034537.2| hemopoietic cell kinase isoform p59... 107 2e-21
gi|957296|gb|AAB33566.1| nonreceptor protein-tyrosine kinase [Mu... 107 2e-21
gi|15718680|ref|NP_005537.3| IL2-inducible T-cell kinase; homolo... 107 2e-21
gi|7705029|gb|AAB28072.2| EMT [Homo sapiens] 107 2e-21
gi|20138411|sp|Q9QVP9|FAK2_MOUSE Protein tyrosine kinase 2 beta ... 107 2e-21
gi|27369678|ref|NP_766086.1| PTK2 protein tyrosine kinase 2 beta... 107 2e-21
gi|12851035|dbj|BAB28926.1| unnamed protein product [Mus musculus] 107 2e-21
gi|1524143|emb|CAA58806.1| HYL tyrosine kinase [Mus musculus] 107 2e-21
gi|2117810|pir||I48926 protein-tyrosine kinase (EC 2.7.1.112) Ct... 107 2e-21
gi|639859|dbj|BAA08199.1| ctk [Mus musculus] 107 2e-21
gi|33304019|gb|AAQ02517.1| IL2-inducible T-cell kinase [syntheti... 107 2e-21
gi|1345852|sp|P41242|MATK_MOUSE Megakaryocyte-associated tyrosin... 107 2e-21
gi|6754646|ref|NP_034898.1| megakaryocyte-associated tyrosine ki... 107 2e-21
gi|2117804|pir||I49552 protein-tyrosine kinase (EC 2.7.1.112) bs... 107 2e-21
gi|17541902|ref|NP_500644.1| fps oncogene analog family member (... 107 2e-21
gi|21450844|ref|NP_647611.1| megakaryocyte-associated tyrosine k... 107 2e-21
gi|47226821|emb|CAG06663.1| unnamed protein product [Tetraodon n... 107 2e-21
gi|39582584|emb|CAE63903.1| Hypothetical protein CBG08474 [Caeno... 107 2e-21
gi|24645334|ref|NP_731342.1| CG8874-PC [Drosophila melanogaster]... 107 2e-21
gi|45549219|ref|NP_524288.3| CG8874-PA [Drosophila melanogaster]... 107 2e-21
gi|66791|pir||TVFV60 protein-tyrosine kinase (EC 2.7.1.112) src ... 107 2e-21
gi|625220|pir||TVCHS protein-tyrosine kinase (EC 2.7.1.112) src ... 107 2e-21
gi|223627|prf||0903255A protein v-src 107 2e-21
gi|6808457|emb|CAB70906.1| hypothetical protein [Homo sapiens] 107 2e-21
gi|16197923|gb|AAL13726.1| LD03455p [Drosophila melanogaster] 107 2e-21
gi|21450846|ref|NP_647612.1| megakaryocyte-associated tyrosine k... 107 2e-21
gi|24645336|ref|NP_731343.1| CG8874-PD [Drosophila melanogaster]... 107 2e-21
gi|21450842|ref|NP_002369.2| megakaryocyte-associated tyrosine k... 107 2e-21
gi|33303945|gb|AAQ02480.1| megakaryocyte-associated tyrosine kin... 107 2e-21
gi|24645330|ref|NP_731341.1| CG8874-PB [Drosophila melanogaster]... 107 2e-21
gi|736264|emb|CAA88658.1| intestinal tyrosine kinase [Mus musculus] 107 2e-21
gi|12229808|sp|Q91735|EPB3_XENLA Ephrin type-B receptor 3 precur... 107 2e-21
gi|39595860|emb|CAE67363.1| Hypothetical protein CBG12830 [Caeno... 107 2e-21
gi|25059027|gb|AAH39953.1| Src protein [Mus musculus] 106 3e-21
gi|40642787|emb|CAD58837.1| ephrin receptor epsilon [Ciona intes... 106 3e-21
gi|38605719|sp|P54763|EPB2_MOUSE Ephrin type-B receptor 2 precur... 106 3e-21
gi|17975765|ref|NP_059145.1| ephrin receptor EphB2 isoform 1 pre... 106 3e-21
gi|12644190|sp|P29323|EPB2_HUMAN Ephrin type-B receptor 2 precur... 106 3e-21
gi|31746497|gb|AAP68901.1| Fes-like tyrosine kinase protein [Sch... 106 3e-21
gi|2780916|pdb|2PTK| Chicken Src Tyrosine Kinase 106 3e-21
gi|49114324|gb|AAH43088.1| Ephb2 protein [Mus musculus] 106 3e-21
gi|11177904|ref|NP_068631.1| non-receptor protein kinase protein... 106 3e-21
gi|38614379|gb|AAH62924.1| Ephb2 protein [Mus musculus] 106 3e-21
gi|12314010|emb|CAC10350.1| dJ74M1.1.1 (tyrosine kinase isoform ... 106 3e-21
gi|14010835|ref|NP_114183.1| tyrosine protein kinase pp60-c-src ... 106 3e-21
gi|34872119|ref|XP_233574.2| similar to Ephrin type-B receptor 2... 106 3e-21
gi|20151029|pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosin... 106 3e-21
gi|39582132|emb|CAE60809.1| Hypothetical protein CBG04507 [Caeno... 106 3e-21
gi|6175046|sp|P00523|SRC_CHICK Proto-oncogene tyrosine-protein k... 106 3e-21
gi|210226|gb|AAA42573.1| tyrosine-specific protein kinase 106 3e-21
gi|33304127|gb|AAQ02571.1| fyn-related kinase [synthetic construct] 106 3e-21
gi|15988071|pdb|1JPA|A Chain A, Crystal Structure Of Unphosphory... 106 3e-21
gi|12314011|emb|CAC10351.1| dJ74M1.1.2 (tyrosine kinase isosform... 106 3e-21
gi|6678129|ref|NP_033297.1| Rous sarcoma oncogene [Mus musculus]... 106 3e-21
gi|48138377|ref|XP_393399.1| similar to CG17309-PB [Apis mellifera] 106 3e-21
gi|4503787|ref|NP_002022.1| fyn-related kinase; tyrosine-protein... 106 3e-21
gi|732528|gb|AAC50116.1| Rak 106 3e-21
gi|414594|gb|AAA72411.1| Nuk receptor tyrosine kinase [Mus muscu... 106 3e-21
gi|41352675|gb|AAS01046.1| Src family kinase [Asterina miniata] 106 3e-21
gi|17136690|ref|NP_476849.1| CG7873-PA [Drosophila melanogaster]... 106 3e-21
gi|1536790|dbj|BAA07705.1| Dsrc41 [Drosophila melanogaster] 106 3e-21
gi|2137701|pir||I48760 protein-tyrosine kinase (EC 2.7.1.112) se... 106 3e-21
gi|1100110|gb|AAA99310.1| protein-tyrosine kinase >gnl|BL_ORD_ID... 106 3e-21
gi|21396504|ref|NP_004433.2| ephrin receptor EphB2 isoform 2 pre... 106 3e-21
gi|49904060|gb|AAH76773.1| Unknown (protein for MGC:83457) [Xeno... 106 3e-21
gi|38078900|ref|XP_204072.3| Eph receptor B2 [Mus musculus] >gnl... 106 3e-21
gi|5542349|pdb|1QCF|A Chain A, Crystal Structure Of Hck In Compl... 106 3e-21
gi|30795229|ref|NP_002101.2| hemopoietic cell kinase isoform p61... 106 3e-21
gi|12655286|emb|CAC27542.1| bA702N8.1 (fyn-related kinase) [Homo... 106 3e-21
gi|33304207|gb|AAQ02611.1| hemopoietic cell kinase [synthetic co... 106 3e-21
gi|39586256|emb|CAE66667.1| Hypothetical protein CBG12006 [Caeno... 106 3e-21
gi|306832|gb|AAA52643.1| protein-tyrosine kinase 106 3e-21
gi|2144421|pir||TVHUHC protein-tyrosine kinase (EC 2.7.1.112) hc... 106 3e-21
gi|17539452|ref|NP_500846.1| fer (fps/fes related) tyrosine prot... 106 3e-21
gi|47222126|emb|CAG11552.1| unnamed protein product [Tetraodon n... 105 4e-21
gi|34871627|ref|XP_232763.2| lymphocyte-specific protein tyrosin... 105 4e-21
gi|28175414|gb|AAH45134.1| Src-prov protein [Xenopus laevis] 105 4e-21
gi|125708|sp|P14084|SRC_AVISS Tyrosine-protein kinase transformi... 105 4e-21
gi|8134704|sp|Q9WUD9|SRC_RAT Proto-oncogene tyrosine-protein kin... 105 4e-21
gi|7434435|pir||I78842 receptor protein-tyrosine kinase - human ... 105 4e-21
gi|45383660|ref|NP_989564.1| Bruton agammaglobulinemia tyrosine ... 105 4e-21
gi|31542823|ref|NP_034367.2| fyn-related kinase; B-cell src-homo... 105 4e-21
gi|5174647|ref|NP_005966.1| PTK6 protein tyrosine kinase 6; brea... 105 5e-21
gi|33304137|gb|AAQ02576.1| Bruton agammaglobulinemia tyrosine ki... 105 6e-21
gi|2136054|pir||A57174 protein-tyrosine kinase (EC 2.7.1.112) er... 105 6e-21
gi|41400367|gb|AAS07035.1| scTCR-28-Zeta-Lck [synthetic construct] 105 6e-21
gi|41400371|gb|AAS07037.1| scTCR-Cbeta-28-Zeta-Lck [synthetic co... 105 6e-21
gi|33859570|ref|NP_034823.1| lymphocyte protein tyrosine kinase ... 105 6e-21
gi|41400363|gb|AAS07033.1| scTCR-Zeta-28-Lck [synthetic construct] 105 6e-21
gi|495678|dbj|BAA06506.1| tyrosine kinase precursor [Homo sapiens] 105 6e-21
gi|4557377|ref|NP_000052.1| Bruton agammaglobulinemia tyrosine k... 105 6e-21
gi|77260|pir||S15582 protein-tyrosine kinase (EC 2.7.1.112) src ... 105 6e-21
gi|210247|gb|AAA42581.1| phosphoprotein p60 105 6e-21
gi|48101228|ref|XP_392652.1| similar to CG4032-PA [Apis mellifera] 105 6e-21
gi|18150844|dbj|BAB83688.1| protein tyrosine kinase [Ephydatia f... 105 7e-21
gi|109465|pir||S20808 protein-tyrosine kinase (EC 2.7.1.112) src... 105 7e-21
gi|125712|sp|P25020|SRC_RSVH1 Tyrosine-protein kinase transformi... 105 7e-21
gi|125707|sp|P00525|SRC_AVISR Tyrosine-protein kinase transformi... 105 7e-21
gi|400155|sp|P31693|SRC_RSVPA Tyrosine-protein kinase transformi... 105 7e-21
gi|32450904|gb|AAP82507.1| Bruton's tyrosine kinase-like protein... 105 7e-21
gi|125705|sp|P13116|SRC2_XENLA Tyrosine-protein kinase SRC-2 (p6... 104 1e-20
gi|104122|pir||A34104 protein-tyrosine kinase (EC 2.7.1.112) src... 104 1e-20
gi|39590755|emb|CAE65127.1| Hypothetical protein CBG09992 [Caeno... 104 1e-20
gi|49617834|gb|AAT67600.1| Src tyrosine kinase 2 [Suberites domu... 104 1e-20
gi|40796163|ref|NP_955616.1| pp60 SRC [Rous sarcoma virus] 104 1e-20
gi|1082750|pir||A49865 protein-tyrosine kinase (EC 2.7.1.112) ma... 104 1e-20
gi|17505883|ref|NP_492826.1| SH2 motif and protein kinase family... 104 1e-20
gi|9626200|ref|NP_056888.1| p60 src [Rous sarcoma virus] >gnl|BL... 104 1e-20
gi|31204949|ref|XP_311423.1| ENSANGP00000000570 [Anopheles gambi... 104 1e-20
gi|39582590|emb|CAE63909.1| Hypothetical protein CBG08480 [Caeno... 104 1e-20
gi|575890|gb|AAC51347.1| Bruton's agammaglobulinemia tyrosine ki... 104 1e-20
gi|18146652|dbj|BAB82423.1| protein tyrosine kinase [Ephydatia f... 104 1e-20
gi|47124936|gb|AAH70804.1| Unknown (protein for MGC:83871) [Xeno... 104 1e-20
gi|1708331|sp|P53356|HT16_HYDAT Tyrosine-protein kinase HTK16 >g... 104 1e-20
gi|7018398|emb|CAB75606.1| dJ836N17.1 (hemopoietic cell kinase) ... 104 1e-20
gi|6689572|emb|CAB65513.1| eph receptor tyrosine kinase [Xenopus... 104 1e-20
gi|975277|gb|AAA75166.1| p72 104 1e-20
gi|20152059|gb|AAM11389.1| LP03070p [Drosophila melanogaster] 104 1e-20
gi|21358251|ref|NP_652600.1| CG8250-PA [Drosophila melanogaster]... 104 1e-20
gi|31240083|ref|XP_320455.1| ENSANGP00000009228 [Anopheles gambi... 104 1e-20
gi|6981620|ref|NP_036890.1| spleen tyrosine kinase [Rattus norve... 104 1e-20
gi|1363318|pir||A56707 protein-tyrosine kinase (EC 2.7.1.112) sy... 104 1e-20
gi|18858599|ref|NP_571489.1| eph receptor B4a; eph-like receptor... 104 1e-20
gi|17539630|ref|NP_501934.1| SH2 motif and protein kinase family... 103 2e-20
gi|46395489|ref|NP_996834.1| embryo kinase 5 protein [Gallus gal... 103 2e-20
gi|4758284|ref|NP_004432.1| ephrin receptor EphB1 precursor; eph... 103 2e-20
gi|15706312|dbj|BAB68344.1| EPH receptor tyrosine kinase [Ciona ... 103 2e-20
gi|2507603|sp|P35991|BTK_MOUSE Tyrosine-protein kinase BTK (Brut... 103 2e-20
gi|7709994|ref|NP_038510.1| Bruton agammaglobulinemia tyrosine k... 103 2e-20
gi|2117867|pir||I50618 c-fps proto oncogene - chicken >gnl|BL_OR... 103 2e-20
gi|30145713|emb|CAB02882.2| Hypothetical protein F01D4.3 [Caenor... 103 2e-20
gi|125366|sp|P00541|FPS_AVISP Tyrosine-protein kinase transformi... 103 2e-20
gi|20138127|sp|Q95M30|HCK_MACFA Tyrosine-protein kinase HCK (p56... 103 2e-20
gi|47225664|emb|CAG08007.1| unnamed protein product [Tetraodon n... 103 2e-20
gi|2194103|pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Com... 103 2e-20
gi|209722|gb|AAA42415.1| gag-fps polyprotein 103 2e-20
gi|12230900|sp|P28693|EPB2_CHICK Ephrin type-B receptor 2 precur... 103 2e-20
gi|3003004|gb|AAC08990.1| src tyrosine kinase [Rous sarcoma virus] 103 2e-20
gi|2833209|sp|Q07497|EPB5_CHICK Ephrin type-B receptor 5 precurs... 103 2e-20
gi|50729483|ref|XP_416531.1| PREDICTED: similar to Chicken embry... 103 2e-20
gi|4104413|gb|AAD02031.1| Eph-like receptor tyrosine kinase hEph... 103 2e-20
gi|21361553|ref|NP_003168.2| spleen tyrosine kinase [Homo sapien... 103 3e-20
gi|7506080|pir||T23792 hypothetical protein M176.9 - Caenorhabdi... 103 3e-20
gi|24308430|ref|NP_571170.1| eph-like kinase 1; eph-like recepto... 103 3e-20
gi|47551197|ref|NP_999783.1| src-family protein tyrosine kinase ... 103 3e-20
gi|7508153|pir||T15135 hypothetical protein T21G5.1 - Caenorhabd... 103 3e-20
gi|41352673|gb|AAS01045.1| Src family tyrosine kinase [Asterina ... 103 3e-20
gi|496900|emb|CAA82737.1| protein-tyrosine kinase [Homo sapiens]... 103 3e-20
gi|32563677|ref|NP_491966.2| protein tyrosine kinase similar to ... 103 3e-20
gi|515871|emb|CAA51970.1| protein tyrosin kinase [Homo sapiens] 103 3e-20
gi|448916|prf||1918215A protein Tyr kinase 103 3e-20
gi|4758282|ref|NP_004431.1| ephrin receptor EphA7; ephrin type-A... 102 4e-20
gi|19705437|ref|NP_599158.1| EphA7 [Rattus norvegicus] >gnl|BL_O... 102 4e-20
gi|21264520|sp|P13115|SRC1_XENLA Tyrosine-protein kinase SRC-1 (... 102 4e-20
gi|47207768|emb|CAF90506.1| unnamed protein product [Tetraodon n... 102 4e-20
gi|26331180|dbj|BAC29320.1| unnamed protein product [Mus musculus] 102 4e-20
gi|4104411|gb|AAD02030.1| Eph-like receptor tyrosine kinase hEph... 102 4e-20
gi|27721289|ref|XP_217250.1| similar to Ephrin type-B receptor 1... 102 4e-20
gi|39583828|emb|CAE74901.1| Hypothetical protein CBG22767 [Caeno... 102 4e-20
gi|31419802|gb|AAH53392.1| Btk protein [Mus musculus] 102 4e-20
gi|416153|gb|AAA42308.1| tyrosine kinase receptor 102 4e-20
gi|40675709|gb|AAH65121.1| Spleen tyrosine kinase [Mus musculus] 102 4e-20
gi|1711636|sp|P48025|KSYK_MOUSE Tyrosine-protein kinase SYK (Spl... 102 4e-20
gi|20137014|gb|AAL74247.2| gla-like protein [Halocynthia roretzi] 102 4e-20
gi|5804911|emb|CAA41565.2| tyrosine kinase [Homo sapiens] 102 4e-20
gi|10439296|dbj|BAB15482.1| unnamed protein product [Homo sapiens] 102 4e-20
gi|56095|emb|CAA31777.1| elk protein [Rattus rattus] 102 4e-20
gi|2842679|sp|Q90344|EPB2_COTJA Ephrin type-B receptor 2 precurs... 102 4e-20
gi|17975768|ref|NP_004434.2| ephrin receptor EphB3 precursor; EP... 102 5e-20
gi|1708164|sp|P54753|EPB3_HUMAN Ephrin type-B receptor 3 precurs... 102 5e-20
gi|26326477|dbj|BAC26982.1| unnamed protein product [Mus musculus] 102 5e-20
gi|8134450|sp|Q91736|EPBB_XENLA Ephrin type-B receptor 1B (Tyros... 102 5e-20
gi|20070702|gb|AAH26153.1| Epha7 protein [Mus musculus] 102 5e-20
gi|1708165|sp|P54754|EPB3_MOUSE Ephrin type-B receptor 3 precurs... 102 5e-20
gi|33859548|ref|NP_034273.1| Eph receptor B3 [Mus musculus] >gnl... 102 5e-20
gi|34861104|ref|XP_345486.1| similar to Src-related intestinal k... 102 5e-20
gi|556789|emb|CAA57224.1| Embryo Brain Kinase [Mus musculus] 102 5e-20
gi|6755706|ref|NP_035648.1| spleen tyrosine kinase [Mus musculus... 102 5e-20
gi|50730275|ref|XP_425573.1| PREDICTED: similar to Brutons tyros... 102 5e-20
gi|422678|pir||S33506 protein-tyrosine kinase (EC 2.7.1.112) Cek... 102 5e-20
gi|34328170|ref|NP_034271.2| Eph receptor A7 [Mus musculus] >gnl... 102 6e-20
gi|31221876|ref|XP_317101.1| ENSANGP00000019506 [Anopheles gambi... 102 6e-20
gi|18150838|dbj|BAA81719.3| protein tyrosine kinase [Ephydatia f... 102 6e-20
gi|125475|sp|P06240|LCK_MOUSE Proto-oncogene tyrosine-protein ki... 102 6e-20
gi|8134448|sp|Q07494|EPB1_CHICK Ephrin type-B receptor 1 (Tyrosi... 102 6e-20
gi|29467133|dbj|BAC67015.1| Truncated ZAP Kinase-2 [Mus musculus] 102 6e-20
gi|49617828|gb|AAT67597.1| Src tyrosine kinase 2 [Suberites domu... 102 6e-20
gi|45384174|ref|NP_990414.1| Eph-like receptor tyrosine kinase [... 102 6e-20
gi|2134387|pir||I50612 protein-tyrosine kinase (EC 2.7.1.112) Ce... 102 6e-20
gi|39583248|emb|CAE60040.1| Hypothetical protein CBG03551 [Caeno... 102 6e-20
gi|17542722|ref|NP_501826.1| protein kinase and SH2 motif family... 102 6e-20
gi|3387870|gb|AAC28629.1| protein-tyrosine kinase HTK98 [Hydra v... 101 8e-20
gi|628312|pir||S26420 protein-tyrosine kinase (EC 2.7.1.112) src... 101 8e-20
gi|462471|sp|Q02977|YRK_CHICK Proto-oncogene tyrosine-protein ki... 101 8e-20
gi|21730412|pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Ty... 101 1e-19
gi|20428652|ref|NP_005347.2| lymphocyte-specific protein tyrosin... 101 1e-19
gi|125474|sp|P06239|LCK_HUMAN Proto-oncogene tyrosine-protein ki... 101 1e-19
gi|49609372|emb|CAF06181.1| protein-tyrosine kinase [Danio rerio] 101 1e-19
gi|7504091|pir||T29030 hypothetical protein F53G12.6 - Caenorhab... 101 1e-19
gi|47215899|emb|CAG12291.1| unnamed protein product [Tetraodon n... 101 1e-19
gi|6984209|gb|AAF34794.1| tyrosine kinase LCK [Homo sapiens] 101 1e-19
gi|266436|sp|Q00655|KSYK_PIG Tyrosine-protein kinase SYK (Spleen... 101 1e-19
gi|2137692|pir||I49071 protein kinase - mouse (fragment) >gnl|BL... 101 1e-19
gi|38303921|gb|AAH61936.1| MGC68754 protein [Xenopus laevis] 101 1e-19
gi|19526270|gb|AAL89664.1| lymphocyte-specific c-src family prot... 101 1e-19
gi|11596416|gb|AAG38611.1| src-family tyrosine kinase SCK [Salmo... 101 1e-19
gi|49617826|gb|AAT67596.1| Src tyrosine kinase 1 [Suberites domu... 101 1e-19
gi|24655701|ref|NP_523793.2| CG10023-PA [Drosophila melanogaster... 101 1e-19
gi|6525023|gb|AAF15292.1| focal adhesion kinase homolog FAK56 [D... 101 1e-19
gi|6409130|gb|AAF07854.1| focal adhesion kinase homolog DFak56 [... 101 1e-19
gi|6016830|dbj|BAA85188.1| focal adhesion kinase [Drosophila mel... 101 1e-19
gi|17508735|ref|NP_490680.1| defective SPErmatogenesis SPE-8, pr... 101 1e-19
gi|45382555|ref|NP_990562.1| tyrosine kinase receptor [Gallus ga... 100 1e-19
gi|14627118|emb|CAC44027.1| lck protein [Hylobates sp.] 100 1e-19
gi|50417446|gb|AAH77278.1| Unknown (protein for MGC:80052) [Xeno... 100 1e-19
gi|37776869|emb|CAE51198.1| src tyrosine kinase [Schistosoma man... 100 1e-19
gi|221014|dbj|BAA01500.1| tyrosine kinase [Rous sarcoma virus] 100 1e-19
gi|3005933|emb|CAA06303.1| Eph-like receptor tyrosine kinase rtk... 100 1e-19
gi|50660338|gb|AAT80893.1| tyrosine kinase receptor [Taeniopygia... 100 1e-19
gi|18146640|dbj|BAA81723.2| protein tyrosine kinase [Ephydatia f... 100 1e-19
gi|17549929|ref|NP_510783.1| protein kinase 25 family member (ki... 100 2e-19
gi|26338474|dbj|BAC32908.1| unnamed protein product [Mus musculus] 100 2e-19
gi|3005905|emb|CAA06301.1| Eph-like receptor tyrosine kinase rtk... 100 2e-19
gi|32566312|ref|NP_872245.1| protein kinase 25 family member (ki... 100 2e-19
gi|17549931|ref|NP_510784.1| protein kinase and SH3 domain conta... 100 2e-19
gi|559594|gb|AAB30995.1| leukocyte carboxyl-terminal src kinase ... 100 2e-19
gi|28894851|gb|AAO44918.2| Protein kinase protein 25, isoform b ... 100 2e-19
gi|17541456|ref|NP_501309.1| SH2 motif and protein kinase family... 100 2e-19
gi|49617832|gb|AAT67599.1| Src tyrosine kinase 1 [Suberites domu... 100 2e-19
gi|26340060|dbj|BAC33693.1| unnamed protein product [Mus musculus] 100 2e-19
gi|13492036|gb|AAK28051.1| Ephrin type-B receptor 4 precursor >g... 100 2e-19
gi|47059093|ref|NP_034274.3| Eph receptor B4 [Mus musculus] >gnl... 100 2e-19
gi|50752377|ref|XP_422762.1| PREDICTED: similar to Cek10 protein... 100 2e-19
gi|1072767|pir||S52313 protein-tyrosine kinase (EC 2.7.1.112) sr... 100 2e-19
gi|6689570|emb|CAB65512.1| eph receptor tyrosine kinase [Xenopus... 100 2e-19
gi|16209620|gb|AAL14195.1| receptor protein tyrosine kinase vari... 100 2e-19
gi|39597066|emb|CAE59293.1| Hypothetical protein CBG02628 [Caeno... 100 2e-19
gi|13279062|gb|AAH04264.1| Similar to EphB4 [Homo sapiens] 100 2e-19
gi|18150840|dbj|BAA81720.2| protein tyrosine kinase [Ephydatia f... 100 2e-19
gi|6002423|dbj|BAA84730.1| EphC2 [Eptatretus burgeri] 100 2e-19
gi|31127085|gb|AAH52804.1| Ephrin receptor EphB4, precursor [Hom... 100 2e-19
gi|495473|gb|AAA20598.1| tyrosine kinase 100 2e-19
gi|2137278|pir||I48953 eph-related receptor protein tyrosine kin... 100 2e-19
gi|32528301|ref|NP_004435.3| ephrin receptor EphB4 precursor; he... 100 2e-19
gi|12229805|sp|Q07498|EPB3_CHICK Ephrin type-B receptor 3 (Tyros... 100 2e-19
gi|1072768|pir||S52314 protein-tyrosine kinase (EC 2.7.1.112) sr... 100 3e-19
gi|50761846|ref|XP_424854.1| PREDICTED: similar to Tyrosine-prot... 100 3e-19
gi|26331236|dbj|BAC29348.1| unnamed protein product [Mus musculus] 100 3e-19
gi|6002421|dbj|BAA84729.1| EphC1 [Eptatretus burgeri] 100 3e-19
gi|25146840|ref|NP_741859.1| fibroblast growth factor receptor f... 99 4e-19
gi|40254274|ref|NP_775623.2| Eph receptor B1; ELK homolog [Mus m... 99 4e-19
gi|25146843|ref|NP_741858.1| fibroblast growth factor receptor f... 99 4e-19
gi|39593938|emb|CAE70048.1| Hypothetical protein CBG16480 [Caeno... 99 4e-19
gi|12229786|sp|O13147|EPB3_BRARE Ephrin type-B receptor 3 (Tyros... 99 4e-19
gi|1174437|sp|P42688|SRK2_SPOLA Tyrosine-protein kinase SRK2 >gn... 99 4e-19
gi|1022831|gb|AAA79851.1| tyrosine kinase 99 4e-19
gi|33113500|gb|AAL33602.2| receptor tyrosine kinase [Monosiga br... 99 5e-19
gi|187034|gb|AAA59502.1| lymphocyte-specific protein tyrosine ki... 99 5e-19
gi|13928766|ref|NP_113752.1| Eph receptor A3 [Rattus norvegicus]... 99 5e-19
gi|17553726|ref|NP_498511.1| SH2 motif and protein kinase family... 99 5e-19
gi|26342707|dbj|BAC35010.1| unnamed protein product [Mus musculus] 99 5e-19
gi|9626155|ref|NP_056889.1| p140 polyprotein [Fujinami sarcoma v... 99 5e-19
gi|40796153|ref|NP_955606.1| FBS [Fujinami sarcoma virus] >gnl|B... 99 5e-19
gi|47212145|emb|CAF95659.1| unnamed protein product [Tetraodon n... 99 5e-19
gi|48597019|ref|NP_001001596.1| lymphocyte-specific protein tyro... 99 7e-19
gi|47214055|emb|CAG00713.1| unnamed protein product [Tetraodon n... 99 7e-19
gi|18859329|ref|NP_571492.1| eph-like receptor tyrosine kinase 8... 99 7e-19
gi|39598289|emb|CAE68982.1| Hypothetical protein CBG14966 [Caeno... 99 7e-19
gi|209689|gb|AAA42403.1| p140 transforming protein 99 7e-19
gi|47212132|emb|CAF94972.1| unnamed protein product [Tetraodon n... 99 7e-19
gi|4505265|ref|NP_002438.1| macrophage stimulating 1 receptor (c... 99 7e-19
gi|66840|pir||TVFVFS protein-tyrosine kinase (EC 2.7.1.112) fps ... 99 7e-19
gi|47227915|emb|CAF97544.1| unnamed protein product [Tetraodon n... 99 7e-19
gi|17542548|ref|NP_501994.1| tyrosine kinase family member (62.0... 98 9e-19
gi|17569805|ref|NP_509104.1| growth factor receptor (122.9 kD) (... 98 9e-19
gi|7521945|pir||T30811 hepatocyte growth factor receptor - Fugu ... 98 9e-19
>gi|17532317|ref|NP_494971.1| protein kinase with SH2 and coiled-coil
domains (2F489) [Caenorhabditis elegans]
gi|7497031|pir||T15769 hypothetical protein C34F11.5 - Caenorhabditis
elegans
gi|1166626|gb|AAA85760.1| Hypothetical protein C34F11.5
[Caenorhabditis elegans]
Length = 894
Score = 1107 bits (2862), Expect = 0.0
Identities = 581/809 (71%), Positives = 581/809 (71%)
Frame = +1
Query: 1 MPKFSXXXXXXXXXXXXXXXXXGNNPHPRTIALKDAARKRKTKTLIRAEPLETSYGSSKR 180
MPKFS GNNPHPRTIALKDAARKRKTKTLIRAEPLETSYGSSKR
Sbjct: 1 MPKFSKEDRKKHKKTRKKKEAKGNNPHPRTIALKDAARKRKTKTLIRAEPLETSYGSSKR 60
Query: 181 RRPNDWXXXXXXXXXXXXYFRQDWFWGMITQTEAEGHLKDCRHGEFLVRSMLFQDNPXXX 360
RRPNDW YFRQDWFWGMITQTEAEGHLKDCRHGEFLVRSMLFQDNP
Sbjct: 61 RRPNDWKKKMRKKERKRRYFRQDWFWGMITQTEAEGHLKDCRHGEFLVRSMLFQDNPIVV 120
Query: 361 XXXXXXSDKSRTFQQFQASPVVSKWQLDSYPSRHKTLVDLVAYYNRHFIGMTGLKLKTAA 540
SDKSRTFQQFQASPVVSKWQLDSYPSRHKTLVDLVAYYNRHFIGMTGLKLKTAA
Sbjct: 121 IDVVVVSDKSRTFQQFQASPVVSKWQLDSYPSRHKTLVDLVAYYNRHFIGMTGLKLKTAA 180
Query: 541 KQPDWFLKSYNIMCPKNAVNLGSGQYGCVAIGAYRRRLVAIKKLTSSGERLLLDREALLK 720
KQPDWFLKSYNIMCPKNAVNLGSGQYGCVAIGAYRRRLVAIKKLTSSGERLLLDREALLK
Sbjct: 181 KQPDWFLKSYNIMCPKNAVNLGSGQYGCVAIGAYRRRLVAIKKLTSSGERLLLDREALLK 240
Query: 721 EAMFMQKLQHPYITKIIGISIDKTPPMLLIELMACPLLDHLQKYGKYTTIGEKLLYLWQL 900
EAMFMQKLQHPYITKIIGISIDKTPPMLLIELMACPLLDHLQKYGKYTTIGEKLLYLWQL
Sbjct: 241 EAMFMQKLQHPYITKIIGISIDKTPPMLLIELMACPLLDHLQKYGKYTTIGEKLLYLWQL 300
Query: 901 ARGLSFMAKENVVHRDIAARNVLFSRHGIVKVSDLGLSDYESKLQAVNTSKERLPRAWLP 1080
ARGLSFMAKENVVHRDIAARNVLFSRHGIVKVSDLGLSDYESKLQAVNTSKERLPRAWLP
Sbjct: 301 ARGLSFMAKENVVHRDIAARNVLFSRHGIVKVSDLGLSDYESKLQAVNTSKERLPRAWLP 360
Query: 1081 PESVSKTGGNKFNEKTDVWMFGATSVEVFQNGQPPYHELKWKEALPRLQNFKDGDNLLVF 1260
PESVSKTGGNKFNEKTDVWMFGATSVEVFQNGQPPYHELKWKEALPRLQNFKDGDNLLVF
Sbjct: 361 PESVSKTGGNKFNEKTDVWMFGATSVEVFQNGQPPYHELKWKEALPRLQNFKDGDNLLVF 420
Query: 1261 PKYASSEIHAFYSTKVFKRVNEDRVNFEEITSVLDNWLNIKFPPPSLEKRTVNMIPNCHP 1440
PKYASSEIHAFYSTKVFKRVNEDRVNFEEITSVLDNWLNIKFPPPSLEKRTVNMIPNCHP
Sbjct: 421 PKYASSEIHAFYSTKVFKRVNEDRVNFEEITSVLDNWLNIKFPPPSLEKRTVNMIPNCHP 480
Query: 1441 LTNAEYEILYQNNMDWLPAXXXXXXXXXXXXXXXXXXXXXXXXXXAQEVXXXXXXXXXXX 1620
LTNAEYEILYQNNMDWLPA AQEV
Sbjct: 481 LTNAEYEILYQNNMDWLPAVRKVKRKREEREKSKTIKSSTKKKKKAQEVLKMLKRKLIRK 540
Query: 1621 XXXXXXXXXXXXYREQRREHKRKFKALIAFYLMYPQREVPRRKKIRAKHEYLVDIYSRIL 1800
YREQRREHKRKFKALIAFYLMYPQREVPRRKKIRAKHEYLVDIYSRIL
Sbjct: 541 RKRRRIQIKLQMYREQRREHKRKFKALIAFYLMYPQREVPRRKKIRAKHEYLVDIYSRIL 600
Query: 1801 MAKWRKQAPXXXXXXXXXXXXXINKKSKHKASRNGXXXXXXXXXXXXXXXXXXXPLMPRI 1980
MAKWRKQAP INKKSKHKASRNG PLMPRI
Sbjct: 601 MAKWRKQAPTRRTRLRLRRHRLINKKSKHKASRNGKLVRIKKKTKRVKRGKFVRPLMPRI 660
Query: 1981 PXXXXXXXXXXXXXXXXXXXXXEIVLTLKVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 2160
P EIVLTLKVR
Sbjct: 661 PKFVAKKKKLKKVDGKKVLKRKEIVLTLKVRKASTAKKTKKAMQEKKRKRLRAKRRLRRF 720
Query: 2161 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGALNXXXXXXXXXXXXXXXXX 2340
GALN
Sbjct: 721 IMRKRLKKKLRKRYRGAKRRRKRQKYRLRYRKKKYQLRKGALNMEQKERMRELKKRRRMK 780
Query: 2341 XXXIDRLHRNRKIGQILREWRVVRKLLMV 2427
IDRLHRNRKIGQILREWRVVRKLLMV
Sbjct: 781 KQKIDRLHRNRKIGQILREWRVVRKLLMV 809