Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C34C12_3
(2040 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17552446|ref|NP_497712.1| putative nuclear protein, with 2 co... 1280 0.0
gi|7509394|pir||T26467 hypothetical protein Y11D7A.14 - Caenorha... 55 5e-06
gi|32566156|ref|NP_501620.2| myosin head and M protein repeat (... 55 5e-06
gi|7498955|pir||T34418 hypothetical protein F12F3.3 - Caenorhabd... 53 2e-05
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans] 53 2e-05
gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans] 53 2e-05
gi|17559578|ref|NP_504584.1| immunoglobulin-like and fibronectin... 53 2e-05
gi|6322385|ref|NP_012459.1| Nucleolar protein involved in exit f... 49 4e-04
gi|48104706|ref|XP_392964.1| similar to ENSANGP00000012035 [Apis... 49 6e-04
gi|45185380|ref|NP_983097.1| ABR149Wp [Eremothecium gossypii] >g... 48 8e-04
gi|48477928|ref|YP_023634.1| chromosome partition protein smc [P... 48 0.001
gi|15218348|ref|NP_177964.1| tropomyosin-related [Arabidopsis th... 47 0.001
gi|50424029|ref|XP_460599.1| unnamed protein product [Debaryomyc... 47 0.002
gi|48859553|ref|ZP_00313486.1| COG1196: Chromosome segregation A... 47 0.002
gi|4324420|gb|AAD16881.1| prespore-specific protein [Dictyosteli... 47 0.002
gi|6319931|ref|NP_010012.1| Actin-binding protein of the cortica... 47 0.002
gi|226703|prf||1603360A actin binding protein 47 0.002
gi|3322|emb|CAA36075.1| unnamed protein product [Saccharomyces c... 47 0.002
gi|6323340|ref|NP_013412.1| Protein involved in vesicular transp... 46 0.003
gi|18394444|ref|NP_564015.1| tropomyosin-related [Arabidopsis th... 46 0.003
gi|29421174|dbj|BAA25472.2| KIAA0546 protein [Homo sapiens] 46 0.004
gi|34787415|ref|NP_659419.2| hypothetical protein MGC23401 [Homo... 46 0.004
gi|39598344|emb|CAE69037.1| Hypothetical protein CBG15043 [Caeno... 46 0.004
gi|17541318|ref|NP_500507.1| putative protein family member, wit... 45 0.005
gi|7505517|pir||T29390 hypothetical protein K08D10.1 - Caenorhab... 45 0.005
gi|17541386|ref|NP_500621.1| putative protein family member, wit... 45 0.005
gi|7505561|pir||T30023 hypothetical protein K08F11.2 - Caenorhab... 45 0.005
gi|24620455|gb|AAN61519.1| 1MDa_1 protein [Caenorhabditis elegans] 45 0.007
gi|50510523|dbj|BAD32247.1| mKIAA0546 protein [Mus musculus] 45 0.007
gi|17565434|ref|NP_504585.1| fibronectin, type III and M protein... 45 0.007
gi|7507640|pir||T24806 hypothetical protein T10G3.5 - Caenorhabd... 45 0.007
gi|40218526|gb|AAR83180.1| LPXTG anchored putative adhesin [Stre... 45 0.007
gi|6323115|ref|NP_013187.1| Subunit of the condensin complex, wh... 45 0.007
gi|38090719|ref|XP_147426.3| similar to hypothetical protein MGC... 45 0.007
gi|50728478|ref|XP_416138.1| PREDICTED: similar to Early endosom... 45 0.007
gi|25150872|ref|NP_506347.2| similar to early endosome-associate... 45 0.007
gi|2204269|emb|CAA97648.1| unnamed protein product [Saccharomyce... 45 0.007
gi|34530995|dbj|BAC86028.1| unnamed protein product [Homo sapiens] 45 0.007
gi|46433961|gb|EAK93385.1| hypothetical protein CaO19.7838 [Cand... 45 0.009
gi|46445394|gb|EAL04663.1| hypothetical protein CaO19.12334 [Can... 45 0.009
gi|46445590|gb|EAL04858.1| hypothetical protein CaO19.4870 [Cand... 45 0.009
gi|6708502|gb|AAD09454.2| superfast myosin heavy chain [Felis ca... 45 0.009
gi|42658064|ref|XP_376656.1| hypothetical protein FLJ22037 [Homo... 44 0.011
gi|42658517|ref|XP_379895.1| similar to superfast myosin heavy c... 44 0.011
gi|10438291|dbj|BAB15219.1| unnamed protein product [Homo sapiens] 44 0.011
gi|50288085|ref|XP_446471.1| unnamed protein product [Candida gl... 44 0.011
gi|30173370|sp|Q9ERA5|SMC4_MICAR Structural maintenance of chrom... 44 0.015
gi|10241756|emb|CAC09587.1| SMC4 protein [Microtus arvalis] 44 0.015
gi|20128875|ref|NP_569927.1| CG14796-PA [Drosophila melanogaster... 44 0.019
gi|7513053|pir||T00369 hypothetical protein KIAA0662 - human (fr... 44 0.019
gi|29374744|ref|NP_813896.1| cell wall surface anchor family pro... 44 0.019
gi|15605760|ref|NP_213137.1| putative protein [Aquifex aeolicus ... 44 0.019
gi|29248147|gb|EAA39688.1| GLP_741_3464_1731 [Giardia lamblia AT... 43 0.025
gi|34907340|ref|NP_915017.1| P0471B04.4 [Oryza sativa (japonica ... 43 0.033
gi|48111808|ref|XP_396309.1| similar to hypothetical protein [Ap... 43 0.033
gi|11498824|ref|NP_070053.1| hypothetical protein [Archaeoglobus... 43 0.033
gi|20521125|dbj|BAA31637.2| KIAA0662 protein [Homo sapiens] 42 0.043
gi|31211711|ref|XP_314825.1| ENSANGP00000011098 [Anopheles gambi... 42 0.043
gi|11096177|gb|AAG30223.1| DNA polymerase zeta catalytic subunit... 42 0.043
gi|1209855|gb|AAB07845.1| repeat motif-containing gene [Borrelia... 42 0.043
gi|21739822|emb|CAD38938.1| hypothetical protein [Homo sapiens] 42 0.043
gi|24797091|ref|NP_078793.1| PHD finger protein 2 isoform b [Hom... 42 0.043
gi|24797093|ref|NP_005383.2| PHD finger protein 2 isoform a [Hom... 42 0.043
gi|49035147|gb|AAF59577.3| Hypothetical protein Y54G2A.21 [Caeno... 42 0.043
gi|50286051|ref|XP_445454.1| unnamed protein product [Candida gl... 42 0.043
gi|25148671|ref|NP_500270.2| putative protein family member, wit... 42 0.043
gi|46447651|ref|YP_009016.1| hypothetical protein pc2017 [Parach... 42 0.043
gi|7460239|pir||T13564 microtubule-associated protein homolog - ... 42 0.056
gi|41054021|ref|NP_956195.1| myomegalin; wu:fi74c05 [Danio rerio... 42 0.056
gi|15425681|dbj|BAB64297.1| I-connectin [Procambarus clarkii] 42 0.056
gi|17543356|ref|NP_502817.1| DNA-binding SAP containing protein ... 42 0.056
gi|34853883|ref|XP_231251.2| similar to rab6 GTPase activating p... 42 0.056
gi|34857050|ref|XP_215573.2| similar to SMC4 protein [Rattus nor... 42 0.056
gi|38103245|gb|EAA49965.1| hypothetical protein MG10674.4 [Magna... 42 0.056
gi|34762131|ref|ZP_00143139.1| ClpB protein [Fusobacterium nucle... 42 0.056
gi|46437094|gb|EAK96446.1| hypothetical protein CaO19.10603 [Can... 42 0.056
gi|47271366|ref|NP_571587.1| coilin p80 [Danio rerio] >gnl|BL_OR... 42 0.073
gi|1841872|gb|AAB47544.1| MigA [Dictyostelium discoideum] 42 0.073
gi|47123036|gb|AAH70715.1| LOC431973 protein [Xenopus laevis] 42 0.073
gi|26342082|dbj|BAC34703.1| unnamed protein product [Mus musculus] 41 0.096
gi|7513292|pir||T13163 Rab6 GTPase activating protein, GAPCenA -... 41 0.096
gi|5815245|gb|AAD52614.1| SANT domain protein SMRTER [Drosophila... 41 0.096
gi|4529843|gb|AAD21791.1| PHD-finger protein [Homo sapiens] 41 0.096
gi|50546607|ref|XP_500773.1| hypothetical protein [Yarrowia lipo... 41 0.096
gi|50757127|ref|XP_415391.1| PREDICTED: similar to Rab6 GTPase a... 41 0.096
gi|29249503|gb|EAA41013.1| GLP_12_28392_26428 [Giardia lamblia A... 41 0.096
gi|12232373|ref|NP_036329.2| RAB GTPase activating protein 1; ra... 41 0.096
gi|6322945|ref|NP_013018.1| Suppressor of mutant AC40 subunit of... 41 0.096
gi|295671|gb|AAA35091.1| selected as a weak suppressor of a muta... 41 0.096
gi|23613557|ref|NP_704578.1| hypothetical protein [Plasmodium fa... 41 0.13
gi|38181589|gb|AAH61481.1| Smc4l1 protein [Mus musculus] 41 0.13
gi|26353334|dbj|BAC40297.1| unnamed protein product [Mus musculus] 41 0.13
gi|29789347|ref|NP_598547.1| SMC4 structural maintenance of chro... 41 0.13
gi|47225654|emb|CAG07997.1| unnamed protein product [Tetraodon n... 41 0.13
gi|20386036|gb|AAM21558.1| MEK1 interacting protein 1 [Dictyoste... 41 0.13
gi|22266324|emb|CAD23627.1| outer surface protein [Borrelia gari... 41 0.13
gi|50729138|ref|XP_416444.1| PREDICTED: similar to Liprin-beta 1... 41 0.13
gi|26353956|dbj|BAC40608.1| unnamed protein product [Mus musculus] 41 0.13
gi|50556082|ref|XP_505449.1| hypothetical protein [Yarrowia lipo... 40 0.16
gi|48098685|ref|XP_392107.1| similar to CG4832-PA [Apis mellifera] 40 0.16
gi|50658063|ref|NP_001002800.1| SMC4 structural maintenance of c... 40 0.16
gi|11278962|pir||T46486 chromosomal protein CAPC homolog DKFZp43... 40 0.16
gi|46431492|gb|EAK91046.1| hypothetical protein CaO19.4715 [Cand... 40 0.16
gi|50543498|ref|XP_499915.1| hypothetical protein [Yarrowia lipo... 40 0.16
gi|50658067|ref|NP_001002799.1| SMC4 structural maintenance of c... 40 0.16
gi|47123398|gb|AAH70161.1| SMC4L1 protein [Homo sapiens] 40 0.16
gi|15223854|ref|NP_172920.1| hypothetical protein [Arabidopsis t... 40 0.16
gi|21739524|emb|CAD38803.1| hypothetical protein [Homo sapiens] 40 0.16
gi|46435639|gb|EAK95016.1| hypothetical protein CaO19.11553 [Can... 40 0.16
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa... 40 0.16
gi|7229681|gb|AAF42939.1| RECQ4 [Drosophila melanogaster] 40 0.21
gi|12053097|emb|CAB66726.1| hypothetical protein [Homo sapiens] 40 0.21
gi|34809533|gb|AAQ82687.1| Epa5p [Candida glabrata] 40 0.21
gi|45552915|ref|NP_995984.1| CG12734-PB [Drosophila melanogaster... 40 0.21
gi|14133231|dbj|BAA82975.2| KIAA1023 protein [Homo sapiens] 40 0.21
gi|45184739|ref|NP_982457.1| AAL085Cp [Eremothecium gossypii] >g... 40 0.21
gi|18398741|ref|NP_566367.1| transcription initiation factor IID... 40 0.21
gi|21358123|ref|NP_652607.1| CG7487-PA [Drosophila melanogaster]... 40 0.21
gi|47226425|emb|CAG08441.1| unnamed protein product [Tetraodon n... 40 0.21
gi|15644384|ref|NP_229436.1| conserved hypothetical protein [The... 40 0.21
gi|14591553|ref|NP_143635.1| chromosome assembly protein [Pyroco... 40 0.21
gi|12007317|gb|AAG45132.1| prespore-specific protein [Dictyostel... 40 0.21
gi|34809534|gb|AAQ82688.1| Epa4p [Candida glabrata] 40 0.21
gi|19112670|ref|NP_595878.1| hypothetical serine-rich repeat pro... 40 0.21
gi|24639088|ref|NP_524753.2| CG3064-PB [Drosophila melanogaster]... 40 0.21
gi|24656542|ref|NP_647780.1| CG12734-PA [Drosophila melanogaster... 40 0.21
gi|48675825|ref|NP_689771.2| hypothetical protein DKFZp434I0118 ... 40 0.21
gi|23509704|ref|NP_702371.1| hypothetical protein, conserved [Pl... 40 0.21
gi|13430502|gb|AAK25873.1| unknown protein [Arabidopsis thaliana] 40 0.28
gi|50730576|ref|XP_425585.1| PREDICTED: similar to GRIP coiled-c... 40 0.28
gi|18417960|ref|NP_567889.1| centromeric protein-related [Arabid... 40 0.28
gi|7485354|pir||T05409 hypothetical protein F10M6.170 - Arabidop... 40 0.28
gi|1209847|gb|AAB07838.1| repeat motif-containing gene [Borrelia... 40 0.28
gi|42820768|emb|CAF32081.1| spindle-related protein, putative [A... 40 0.28
gi|11497110|ref|NP_051232.1| BdrF [Borrelia burgdorferi B31] >gn... 40 0.28
gi|45199188|ref|NP_986217.1| AFR669Wp [Eremothecium gossypii] >g... 40 0.28
gi|30682720|ref|NP_180104.2| meprin and TRAF homology domain-con... 40 0.28
gi|29421238|gb|AAO59281.1| kinesin [Botryotinia fuckeliana] 40 0.28
gi|46228771|gb|EAK89641.1| large protein with central conserved ... 40 0.28
gi|25412298|pir||A84647 hypothetical protein At2g25320 [imported... 40 0.28
gi|23508469|ref|NP_701138.1| hypothetical protein [Plasmodium fa... 40 0.28
gi|15669512|ref|NP_248322.1| purine NTPase [Methanocaldococcus j... 39 0.36
gi|1903280|emb|CAA98620.1| USO1 [Saccharomyces cerevisiae] 39 0.36
gi|15217558|ref|NP_174616.1| hypothetical protein [Arabidopsis t... 39 0.36
gi|39585383|emb|CAE61705.1| Hypothetical protein CBG05654 [Caeno... 39 0.36
gi|48853861|ref|ZP_00308027.1| COG0419: ATPase involved in DNA r... 39 0.36
gi|49096160|ref|XP_409540.1| hypothetical protein AN5403.2 [Aspe... 39 0.36
gi|422615|pir||A47297 myosin heavy chain form B, nonmuscle - Afr... 39 0.36
gi|47225967|emb|CAG04341.1| unnamed protein product [Tetraodon n... 39 0.36
gi|6320145|ref|NP_010225.1| involved intracellular protein trans... 39 0.36
gi|137175|sp|P25386|USO1_YEAST Intracellular protein transport p... 39 0.36
gi|6942203|gb|AAF32356.1| mitotic kinesin-like motor protein CEN... 39 0.36
gi|50548805|ref|XP_501872.1| hypothetical protein [Yarrowia lipo... 39 0.36
gi|50758242|ref|XP_415827.1| PREDICTED: similar to myosin 18A is... 39 0.36
gi|46138859|ref|XP_391120.1| hypothetical protein FG10944.1 [Gib... 39 0.36
gi|39589581|emb|CAE66816.1| Hypothetical protein CBG12181 [Caeno... 39 0.36
gi|3851586|gb|AAC72361.1| chromosome-associated protein-C [Homo ... 39 0.48
gi|11560048|ref|NP_071582.1| RAD50 homolog [Rattus norvegicus] >... 39 0.48
gi|11359772|pir||T45031 hypothetical protein Y39B6B.e [imported]... 39 0.48
gi|677198|gb|AAB00143.1| putative 39 0.48
gi|13472161|ref|NP_103728.1| serine/threonine kinase [Mesorhizob... 39 0.48
gi|2760351|gb|AAB95253.1| myosin heavy chain [Girardia tigrina] 39 0.48
gi|23508812|ref|NP_701480.1| hypothetical protein [Plasmodium fa... 39 0.48
gi|7511304|pir||T34513 hypothetical protein ZK783.1 - Caenorhabd... 39 0.48
gi|50806660|ref|XP_424476.1| PREDICTED: similar to Golgi autoant... 39 0.48
gi|50760148|ref|XP_417909.1| PREDICTED: similar to KIAA1052 prot... 39 0.48
gi|15219901|ref|NP_173669.1| SEC14 cytosolic factor family prote... 39 0.48
gi|25151580|ref|NP_741679.1| protein tyrosine phosphatase family... 39 0.48
gi|50293577|ref|XP_449200.1| unnamed protein product [Candida gl... 39 0.48
gi|50257461|gb|EAL20168.1| hypothetical protein CNBF2450 [Crypto... 39 0.62
gi|189036|gb|AAA36349.1| nonmuscle myosin heavy chain (NMHC) 39 0.62
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 39 0.62
gi|25151561|ref|NP_741667.1| protein tyrosine phosphatase family... 39 0.62
gi|625305|pir||A61231 myosin heavy chain nonmuscle form A - human 39 0.62
gi|34596295|gb|AAQ76827.1| GRINL1A complex protein Gcom4 precurs... 39 0.62
gi|38073543|ref|XP_148990.2| similar to KIAA1096 protein [Mus mu... 39 0.62
gi|27498927|ref|XP_089747.2| similar to CG5882-PA [Homo sapiens] 39 0.62
gi|24664316|ref|NP_648722.2| CG9311-PA [Drosophila melanogaster]... 39 0.62
gi|23509263|ref|NP_701930.1| hypothetical protein [Plasmodium fa... 39 0.62
gi|6321459|ref|NP_011537.1| Mid-Two Like 1; Mtl1p [Saccharomyces... 39 0.62
gi|21243223|ref|NP_642805.1| conserved hypothetical protein [Xan... 39 0.62
gi|48101527|ref|XP_395150.1| similar to CG5140-PA [Apis mellifera] 39 0.62
gi|21752036|dbj|BAC04102.1| unnamed protein product [Homo sapiens] 39 0.62
gi|38181796|gb|AAH61518.1| KIAA1023 protein [Homo sapiens] 39 0.62
gi|46126621|ref|XP_387864.1| hypothetical protein FG07688.1 [Gib... 39 0.62
gi|39592202|emb|CAE75423.1| Hypothetical protein CBG23416 [Caeno... 39 0.62
gi|23480572|gb|EAA17097.1| hypothetical protein [Plasmodium yoel... 39 0.62
gi|28972614|dbj|BAC65723.1| mKIAA1096 protein [Mus musculus] 39 0.62
gi|38044284|ref|NP_892009.2| neuron navigator 2 isoform 1; retin... 38 0.81
gi|50426329|ref|XP_461761.1| unnamed protein product [Debaryomyc... 38 0.81
gi|23508431|ref|NP_701100.1| dynein heavy chain, putative [Plasm... 38 0.81
gi|48130462|ref|XP_396665.1| similar to hypothetical protein [Ap... 38 0.81
gi|735904|gb|AAA64514.1| testicular protein 38 0.81
gi|10432807|dbj|BAB13850.1| unnamed protein product [Homo sapiens] 38 0.81
gi|8096269|dbj|BAA95789.1| KED [Nicotiana tabacum] 38 0.81
gi|38109577|gb|EAA55426.1| predicted protein [Magnaporthe grisea... 38 0.81
gi|1173565|gb|AAC51791.1| golgin-245 [Homo sapiens] >gnl|BL_ORD_... 38 0.81
gi|49088592|ref|XP_406103.1| hypothetical protein AN1966.2 [Aspe... 38 0.81
gi|28574125|ref|NP_788028.1| CG32955-PE [Drosophila melanogaster... 38 0.81
gi|23485476|gb|EAA20445.1| hypothetical protein [Plasmodium yoel... 38 0.81
gi|25453232|sp|O61308|PUMA_PARUN 227 kDa spindle- and centromere... 38 0.81
gi|1236759|emb|CAA58041.1| 256 kD golgin [Homo sapiens] 38 0.81
gi|27803028|emb|CAD60731.1| unnamed protein product [Podospora a... 38 0.81
gi|34864867|ref|XP_235146.2| similar to KIAA0546 protein [Rattus... 38 0.81
gi|41055251|ref|NP_957387.1| similar to troponin 1, type 2 [Dani... 38 0.81
gi|50738301|ref|XP_419285.1| PREDICTED: hypothetical protein XP_... 38 0.81
gi|46447657|ref|YP_009022.1| hypothetical protein pc2023 [Parach... 38 0.81
gi|26000356|gb|AAN75470.1| dentin matrix protein 1 [Pteropus hyp... 38 0.81
gi|1209841|gb|AAB07833.1| repeat motif-containing gene [Borrelia... 38 0.81
gi|46435796|gb|EAK95170.1| hypothetical protein CaO19.4072 [Cand... 38 0.81
gi|47221227|emb|CAG13163.1| unnamed protein product [Tetraodon n... 38 0.81
gi|24641597|ref|NP_536797.2| CG4013-PA [Drosophila melanogaster]... 38 0.81
gi|50404915|ref|YP_054007.1| Kinesin, putative [Paramecium tetra... 38 0.81
gi|1168461|sp|P21249|ANT1_ONCVO MAJOR ANTIGEN >gnl|BL_ORD_ID|167... 38 0.81
gi|45597449|ref|NP_035646.1| synaptonemal complex protein 1 [Mus... 38 0.81
gi|23509848|ref|NP_702515.1| dynein beta chain, putative [Plasmo... 38 0.81
gi|6715600|ref|NP_002069.2| golgi autoantigen, golgin subfamily ... 38 0.81
gi|39590030|emb|CAE61028.1| Hypothetical protein CBG04771 [Caeno... 38 0.81
gi|29249424|gb|EAA40936.1| GLP_186_56330_58033 [Giardia lamblia ... 38 0.81
gi|49096040|ref|XP_409480.1| hypothetical protein AN5343.2 [Aspe... 38 0.81
gi|28210315|ref|NP_781259.1| exonuclease sbcC [Clostridium tetan... 38 0.81
gi|27706912|ref|XP_228584.1| similar to bA351K23.4 (novel protei... 38 0.81
gi|7271813|gb|AAF44628.1| histone acetyltransferase [Drosophila ... 38 0.81
gi|20908094|tpg|DAA00021.1| TPA: TITIN [Drosophila melanogaster] 38 0.81
gi|23508767|ref|NP_701435.1| hypothetical protein [Plasmodium fa... 38 1.1
gi|21396506|dbj|BAC00853.1| helicase [Homo sapiens] 38 1.1
gi|34556096|emb|CAB60772.3| Hypothetical protein Y57A10A.18 [Cae... 38 1.1
gi|23510135|ref|NP_702801.1| hypothetical protein [Plasmodium fa... 38 1.1
gi|24586371|ref|NP_524881.2| CG1925-PA [Drosophila melanogaster]... 38 1.1
gi|50748458|ref|XP_421254.1| PREDICTED: similar to meningioma ex... 38 1.1
gi|17537601|ref|NP_496594.1| prion-like Q/N-rich domain protein ... 38 1.1
gi|33333845|gb|AAQ12016.1| tropomyosin [Heterodera glycines] 38 1.1
gi|47211182|emb|CAF92409.1| unnamed protein product [Tetraodon n... 38 1.1
gi|47605964|sp|O77819|ROC1_RABIT Rho-associated protein kinase 1... 38 1.1
gi|21396508|dbj|BAC00854.1| helicase [Homo sapiens] 38 1.1
gi|38044282|ref|NP_660093.2| neuron navigator 2 isoform 2; retin... 38 1.1
gi|19744388|gb|AAL96479.1| retinoic acid inducible in neuroblast... 38 1.1
gi|27227741|emb|CAD59239.1| NAD(+) ADP-ribosyltransferase-3 [Dic... 38 1.1
gi|19744390|gb|AAL96480.1| retinoic acid inducible in neuroblast... 38 1.1
gi|48696749|ref|YP_024573.1| ORF28 [Ostreid herpesvirus 1] >gnl|... 38 1.1
gi|48870355|ref|ZP_00323079.1| hypothetical protein PpenA0100100... 38 1.1
gi|42522709|ref|NP_968089.1| large Ala/Glu-rich protein [Bdellov... 38 1.1
gi|11359780|pir||T45039 hypothetical protein Y39B6B.m [imported]... 38 1.1
gi|7510242|pir||T31638 hypothetical protein Y57A10A.p - Caenorha... 38 1.1
gi|34879616|ref|XP_223709.2| similar to hypothetical protein [Ra... 38 1.1
gi|50292911|ref|XP_448888.1| unnamed protein product [Candida gl... 38 1.1
gi|50582991|ref|NP_689664.2| GRINL1A complex upstream protein; N... 37 1.4
gi|38112339|gb|AAR11258.1| microtubule-associated protein 1B [Ma... 37 1.4
gi|46442359|gb|EAL01649.1| hypothetical protein CaO19.2739 [Cand... 37 1.4
gi|12044815|emb|CAC19836.1| kinesin (KINA protein) [Emericella n... 37 1.4
gi|14017905|dbj|BAB47473.1| KIAA1844 protein [Homo sapiens] 37 1.4
gi|15081523|ref|NP_150036.1| conserved hypothetical protein [Clo... 37 1.4
gi|46442162|gb|EAL01453.1| hypothetical protein CaO19.7006 [Cand... 37 1.4
gi|46438332|gb|EAK97664.1| hypothetical protein CaO19.10912 [Can... 37 1.4
gi|2072290|gb|AAC60120.1| XL-INCENP [Xenopus laevis] 37 1.4
gi|23490877|gb|EAA22546.1| maebl [Plasmodium yoelii yoelii] 37 1.4
gi|29436380|gb|AAH49849.1| MYH9 protein [Homo sapiens] 37 1.4
gi|48105709|ref|XP_395987.1| similar to ENSANGP00000018463 [Apis... 37 1.4
gi|12667788|ref|NP_002464.1| myosin, heavy polypeptide 9, non-mu... 37 1.4
gi|34596293|gb|AAQ76826.1| GRINL1A complex protein Gcom3 precurs... 37 1.4
gi|1079390|pir||A47168 cardiac morphogenesis protein ES/130 - ch... 37 1.4
gi|553596|gb|AAA59888.1| cellular myosin heavy chain 37 1.4
gi|50308363|ref|XP_454183.1| unnamed protein product [Kluyveromy... 37 1.4
gi|558753|gb|AAC46496.1| SEC-1 >gnl|BL_ORD_ID|1961201 gi|1093371... 37 1.4
gi|31242063|ref|XP_321462.1| ENSANGP00000017369 [Anopheles gambi... 37 1.4
gi|6678946|ref|NP_032660.1| microtubule-associated protein 1 B; ... 37 1.4
gi|42733831|gb|AAS38749.1| similar to Arabidopsis thaliana (Mous... 37 1.4
gi|50257196|gb|EAL19909.1| hypothetical protein CNBG0520 [Crypto... 37 1.4
gi|47086727|ref|NP_997819.1| Unknown (protein for MGC:76973); wu... 37 1.4
gi|33668516|gb|AAO39707.1| GRINL1A complex protein 1 Gcom1 precu... 37 1.4
gi|4966317|gb|AAA88778.2| vitellogenin [Anolis pulchellus] 37 1.4
gi|32265052|gb|AAP41549.1| GRINL1A complex protein 2 precursor [... 37 1.4
gi|17230167|ref|NP_486715.1| similar to leukotoxin secretion pro... 37 1.4
gi|15644748|ref|NP_206918.1| hypothetical protein HP0118 [Helico... 37 1.4
gi|47206494|emb|CAF92339.1| unnamed protein product [Tetraodon n... 37 1.8
gi|1163913|gb|AAC48501.1| junctional sarcoplasmic reticulum prot... 37 1.8
gi|23619130|ref|NP_705092.1| chromosome segregation protein, put... 37 1.8
gi|50510575|dbj|BAD32273.1| mKIAA0662 protein [Mus musculus] 37 1.8
gi|30425220|ref|NP_780685.1| Rho GTPase activating protein 25 [M... 37 1.8
gi|24640147|ref|NP_572325.1| CG3950-PA [Drosophila melanogaster]... 37 1.8
gi|3850135|emb|CAA21936.1| SEC12 homologue [Candida albicans] 37 1.8
gi|17536671|ref|NP_496914.1| rho rac-interacting Citron kinase (... 37 1.8
gi|50756097|ref|XP_415015.1| PREDICTED: EDT-soluble/130 kDa prot... 37 1.8
gi|48101374|ref|XP_395113.1| similar to CG18076-PH [Apis mellifera] 37 1.8
gi|47205442|emb|CAG05719.1| unnamed protein product [Tetraodon n... 37 1.8
gi|46441523|gb|EAL00819.1| hypothetical protein CaO19.14004 [Can... 37 1.8
gi|42734036|gb|AAS38911.1| similar to Leishmania major. Ppg3 [Di... 37 1.8
gi|42734064|gb|AAS38936.1| similar to Plasmodium falciparum (iso... 37 1.8
gi|50510341|dbj|BAD32156.1| mKIAA0053 protein [Mus musculus] 37 1.8
gi|25141373|ref|NP_491340.2| nuclear protein SET and WW/Rsp5/WWP... 37 1.8
gi|33563122|dbj|BAC81704.1| serine-rich protein [Entamoeba histo... 37 1.8
gi|26332254|dbj|BAC29857.1| unnamed protein product [Mus musculus] 37 1.8
gi|50289247|ref|XP_447054.1| unnamed protein product [Candida gl... 37 1.8
gi|38640214|ref|NP_944170.1| hypothetical protein Aeh1p292 [Bact... 37 1.8
gi|47117221|sp|Q8BYW1|RH25_MOUSE Rho-GTPase-activating protein 25 37 1.8
gi|4529845|gb|AAD21792.1| PHD-finger protein [Mus musculus] 37 1.8
gi|31543476|ref|NP_035208.2| PHD finger protein 2 [Mus musculus]... 37 1.8
gi|48110107|ref|XP_396257.1| similar to ENSANGP00000017857 [Apis... 37 1.8
gi|31745178|ref|NP_853634.1| SWI/SNF related, matrix associated,... 37 1.8
gi|37956533|gb|AAP20593.1| effector protein B [Legionella pneumo... 37 1.8
gi|34852618|ref|XP_214954.2| similar to RalBP1-associated EH dom... 37 1.8
gi|25395254|pir||B87754 protein C43E11.3 [imported] - Caenorhabd... 37 1.8
gi|23508384|ref|NP_701053.1| hypothetical protein [Plasmodium fa... 33 2.3
gi|6634015|dbj|BAA20782.2| KIAA0324 protein [Homo sapiens] 37 2.4
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 37 2.4
gi|19923466|ref|NP_057417.2| splicing coactivator subunit SRm300... 37 2.4
gi|46108010|ref|XP_381063.1| hypothetical protein FG00887.1 [Gib... 37 2.4
gi|23508275|ref|NP_700944.1| hypothetical protein [Plasmodium fa... 37 2.4
gi|50426883|ref|XP_462040.1| unnamed protein product [Debaryomyc... 37 2.4
gi|23491117|gb|EAA22730.1| 235 kDa rhoptry protein [Plasmodium y... 37 2.4
gi|45199215|ref|NP_986244.1| AFR696Cp [Eremothecium gossypii] >g... 37 2.4
gi|45190844|ref|NP_985098.1| AER241Wp [Eremothecium gossypii] >g... 37 2.4
gi|7494465|pir||T28677 rhoptry protein - Plasmodium yoelii >gnl|... 37 2.4
gi|284667|pir||A43427 neurofilament triplet H1 protein - rabbit ... 37 2.4
gi|21751020|dbj|BAC03887.1| unnamed protein product [Homo sapiens] 37 2.4
gi|16080173|ref|NP_390999.1| yulB [Bacillus subtilis subsp. subt... 37 2.4
gi|47212246|emb|CAF93159.1| unnamed protein product [Tetraodon n... 37 2.4
gi|49090076|ref|XP_406597.1| hypothetical protein AN2460.2 [Aspe... 37 2.4
gi|46391122|gb|AAS90649.1| putative retrotransposon RIRE2 protei... 37 2.4
gi|38788274|ref|NP_872579.2| fetal Alzheimer antigen isoform 1; ... 37 2.4
gi|13173388|gb|AAK14386.1| lysine/glutamic acid-rich protein [Ca... 37 2.4
gi|45384404|ref|NP_990273.1| restin [Gallus gallus] >gnl|BL_ORD_... 37 2.4
gi|24581879|ref|NP_723065.1| CG31649-PA [Drosophila melanogaster... 37 2.4
gi|4966319|gb|AAA88779.2| vitellogenin [Anolis pulchellus] 37 2.4
gi|23508284|ref|NP_700953.1| hypothetical protein [Plasmodium fa... 37 2.4
gi|6683492|dbj|BAA89208.1| bromodomain PHD finger transcription ... 37 2.4
gi|4758454|ref|NP_004478.1| golgi autoantigen, golgin subfamily ... 37 2.4
gi|23619065|ref|NP_705027.1| hypothetical protein [Plasmodium fa... 37 2.4
gi|50293729|ref|XP_449276.1| unnamed protein product [Candida gl... 37 2.4
gi|50737115|ref|XP_419158.1| PREDICTED: similar to retinoblastom... 37 2.4
gi|47225554|emb|CAG12037.1| unnamed protein product [Tetraodon n... 37 2.4
gi|2119533|pir||I52300 giantin - human >gnl|BL_ORD_ID|1705043 gi... 37 2.4
gi|23479921|gb|EAA16622.1| Arabidopsis thaliana At3g58560/F14P22... 37 2.4
gi|5821151|dbj|BAA83717.1| RNA binding protein [Homo sapiens] 37 2.4
gi|45552525|ref|NP_995785.1| CG30337-PB [Drosophila melanogaster... 37 2.4
gi|13195258|gb|AAK15626.1| 235 kDa rhoptry protein [Plasmodium y... 37 2.4
gi|24943076|ref|NP_609117.4| CG5229-PA [Drosophila melanogaster]... 37 2.4
gi|46442117|gb|EAL01409.1| hypothetical protein CaO19.10253 [Can... 36 3.1
gi|40254171|ref|NP_083109.2| RIKEN cDNA 1700028P05 [Mus musculus... 36 3.1
gi|34365399|emb|CAE46015.1| hypothetical protein [Homo sapiens] 36 3.1
gi|41718582|ref|ZP_00147566.1| COG1340: Uncharacterized archaeal... 36 3.1
gi|31874058|emb|CAD97945.1| hypothetical protein [Homo sapiens] 36 3.1
gi|3986194|dbj|BAA34954.1| myosin heavy chain [Dugesia japonica] 36 3.1
gi|15292463|gb|AAK93500.1| SD03094p [Drosophila melanogaster] 36 3.1
gi|46390276|dbj|BAD15726.1| translocated promoter region-like [O... 36 3.1
gi|21595387|gb|AAM66096.1| unknown [Arabidopsis thaliana] 36 3.1
gi|15231584|ref|NP_191443.1| expressed protein [Arabidopsis thal... 36 3.1
gi|50419303|ref|XP_458176.1| unnamed protein product [Debaryomyc... 36 3.1
gi|45198598|ref|NP_985627.1| AFR080Wp [Eremothecium gossypii] >g... 36 3.1
gi|10863905|ref|NP_004230.1| thyroid hormone receptor interactor... 36 3.1
gi|48139985|ref|XP_397066.1| similar to ENSANGP00000016491 [Apis... 36 3.1
gi|23489781|gb|EAA21707.1| hypothetical protein [Plasmodium yoel... 36 3.1
gi|30046597|gb|AAH50472.1| LOC134218 protein [Homo sapiens] 36 3.1
gi|46438397|gb|EAK97728.1| hypothetical protein CaO19.3409 [Cand... 36 3.1
gi|11359550|pir||T49648 hypothetical protein B8B20.20 [imported]... 36 3.1
gi|46435346|gb|EAK94729.1| hypothetical protein CaO19.8274 [Cand... 36 3.1
gi|46441391|gb|EAL00688.1| hypothetical protein CaO19.9541 [Cand... 36 3.1
gi|8923251|ref|NP_060208.1| chromosome 9 open reading frame 39 [... 36 3.1
gi|46441258|gb|EAL00556.1| hypothetical protein CaO19.1990 [Cand... 36 3.1
gi|23509386|ref|NP_702053.1| hypothetical protein [Plasmodium fa... 36 3.1
gi|38347210|emb|CAE02280.2| OSJNBa0055C08.4 [Oryza sativa (japon... 36 3.1
gi|23487448|gb|EAA21058.1| hypothetical protein [Plasmodium yoel... 36 3.1
gi|50843816|ref|NP_060554.2| KIAA1212 [Homo sapiens] 36 3.1
gi|45198744|ref|NP_985773.1| AFR226Cp [Eremothecium gossypii] >g... 36 3.1
gi|23491478|gb|EAA23001.1| rhoptry protein-related [Plasmodium y... 36 3.1
gi|32409665|ref|XP_325313.1| hypothetical protein ( (AL355933) c... 36 3.1
gi|6324105|ref|NP_014175.1| Hypothetical ORF; Ynl224cp [Saccharo... 36 3.1
gi|6754478|ref|NP_034787.1| human immunodeficiency virus type I ... 36 3.1
gi|2198820|gb|AAD12485.1| Cux/CDP(1B1); Cux/CDP homeoprotein [Mu... 36 3.1
gi|7511618|pir||T29757 protein UNC-89 - Caenorhabditis elegans 36 3.1
gi|46432498|gb|EAK91977.1| hypothetical protein CaO19.998 [Candi... 36 3.1
gi|31746683|gb|AAP68958.1| Uncoordinated protein 89, isoform b [... 36 3.1
gi|27694686|gb|AAH43775.1| MGC52980 protein [Xenopus laevis] 36 3.1
gi|13637900|sp|P53564|CUT1_MOUSE CCAAT displacement protein (CDP... 36 3.1
gi|1160355|gb|AAB00542.1| UNC-89 36 3.1
gi|18977539|ref|NP_578896.1| smc-like [Pyrococcus furiosus DSM 3... 36 3.1
gi|25141314|ref|NP_491290.2| UNCoordinated locomotion UNC-89, PH... 36 3.1
gi|2253417|gb|AAD09135.1| Trip230 [Homo sapiens] 36 3.1
gi|31217814|ref|XP_316511.1| ENSANGP00000013488 [Anopheles gambi... 36 3.1
gi|50728238|ref|XP_416047.1| PREDICTED: similar to splicing fact... 36 3.1
gi|15922443|ref|NP_378112.1| 584aa long hypothetical bps2 protei... 36 3.1
gi|23479946|gb|EAA16641.1| 1 beta dynein heavy chain [Plasmodium... 36 3.1
gi|12839591|dbj|BAB24605.1| unnamed protein product [Mus musculus] 36 3.1
gi|38348586|ref|NP_034116.2| CCAAT displacement protein isoform ... 36 3.1
gi|2137246|pir||I48314 homeotic protein CDP - mouse >gnl|BL_ORD_... 36 3.1
gi|45684580|ref|ZP_00196010.1| COG0508: Pyruvate/2-oxoglutarate ... 36 3.1
gi|47223907|emb|CAG06084.1| unnamed protein product [Tetraodon n... 36 3.1
gi|10444523|gb|AAG17934.1| J5 [Trichinella pseudospiralis] 36 4.0
gi|39939000|ref|NP_950766.1| conserved hypothetical protein [Oni... 36 4.0
gi|17554502|ref|NP_497888.1| putative nuclear protein, with 2 co... 36 4.0
gi|17543530|ref|NP_502971.1| zn-finger-like, PHD finger and nucl... 36 4.0
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 36 4.0
gi|32417180|ref|XP_329068.1| hypothetical protein [Neurospora cr... 36 4.0
gi|7494475|pir||T14914 dynein beta heavy chain - Tetrahymena the... 36 4.0
gi|23490353|gb|EAA22151.1| hypothetical protein [Plasmodium yoel... 36 4.0
gi|19745146|ref|NP_034211.1| dystonin isoform e; bullous pemphig... 36 4.0
gi|32477034|ref|NP_870028.1| hypothetical protein-signal peptide... 36 4.0
gi|50302473|ref|XP_451171.1| unnamed protein product [Kluyveromy... 36 4.0
gi|50754309|ref|XP_414324.1| PREDICTED: similar to PHD finger pr... 36 4.0
gi|50287941|ref|XP_446399.1| unnamed protein product [Candida gl... 36 4.0
gi|5174525|ref|NP_005900.1| microtubule-associated protein 1B is... 36 4.0
gi|48102332|ref|XP_392766.1| similar to 309 kDa centrosomal prot... 36 4.0
gi|48099334|ref|XP_392583.1| similar to ENSANGP00000012594 [Apis... 36 4.0
gi|23619332|ref|NP_705294.1| hypothetical protein [Plasmodium fa... 36 4.0
gi|50757426|ref|XP_415517.1| PREDICTED: similar to CDK5 regulato... 36 4.0
gi|38079956|ref|XP_356900.1| similar to KIAA1000 protein [Mus mu... 36 4.0
gi|23509067|ref|NP_701735.1| hypothetical protein [Plasmodium fa... 36 4.0
gi|14165456|ref|NP_114399.1| microtubule-associated protein 1B i... 36 4.0
gi|47227297|emb|CAF96846.1| unnamed protein product [Tetraodon n... 36 4.0
gi|46436261|gb|EAK95626.1| hypothetical protein CaO19.6967 [Cand... 36 4.0
gi|34874618|ref|XP_237042.2| similar to bullous pemphigoid antig... 36 4.0
gi|50304493|ref|XP_452197.1| unnamed protein product [Kluyveromy... 36 4.0
gi|6679671|ref|NP_031969.1| epidermal growth factor receptor pat... 36 4.0
gi|50878311|gb|AAT85086.1| unknown protein [Oryza sativa (japoni... 36 4.0
gi|45382215|ref|NP_990140.1| synemin [Gallus gallus] >gnl|BL_ORD... 36 4.0
gi|34874749|ref|XP_236929.2| similar to zinc finger protein TZF-... 36 4.0
gi|3041729|sp|Q03410|SCP1_RAT Synaptonemal complex protein 1 (SC... 36 4.0
gi|38636442|emb|CAE81978.1| related to vesicular transport prote... 36 4.0
gi|49084868|ref|XP_404598.1| hypothetical protein AN0461.2 [Aspe... 36 4.0
gi|38112337|gb|AAR11257.1| microtubule-associated protein 1B [Pa... 36 4.0
gi|47227954|emb|CAF97583.1| unnamed protein product [Tetraodon n... 36 4.0
gi|50748282|ref|XP_429303.1| PREDICTED: hypothetical protein XP_... 36 4.0
gi|38081072|ref|XP_359049.1| similar to myosin heavy chain [Mus ... 36 4.0
gi|630734|pir||S43597 coiled-coil protein homolog R07E5.6 - Caen... 36 4.0
gi|45382421|ref|NP_990707.1| kinectin [Gallus gallus] >gnl|BL_OR... 36 4.0
gi|127575|sp|P16946|MX_STRPY Virulence factor-related M protein ... 36 4.0
gi|6981616|ref|NP_036942.1| synaptonemal complex protein 1; A co... 36 4.0
gi|23478072|gb|EAA15256.1| rhoptry protein [Plasmodium yoelii yo... 36 4.0
gi|38073487|ref|XP_355243.1| similar to This gene is isolated by... 36 4.0
gi|47210347|emb|CAF90604.1| unnamed protein product [Tetraodon n... 36 4.0
gi|47169578|tpe|CAE51898.1| TPA: Hin-6 protease [Mus musculus] 36 4.0
gi|13508186|ref|NP_110135.1| cytadherence accessory protein HMW1... 36 4.0
gi|1705737|sp|P53565|CUT1_RAT CCAAT displacement protein (CDP) (... 35 5.3
gi|31563507|ref|NP_852118.1| GRIP coiled-coil protein GCC185 iso... 35 5.3
gi|45382587|ref|NP_990577.1| claustrin [Gallus gallus] >gnl|BL_O... 35 5.3
gi|7662062|ref|NP_055450.1| GRIP coiled-coil protein GCC185 isof... 35 5.3
gi|34871258|ref|XP_221965.2| similar to RIKEN cDNA 1700028P05 [R... 35 5.3
gi|50511089|dbj|BAD32530.1| mKIAA1749 protein [Mus musculus] 35 5.3
gi|34870895|ref|XP_340821.1| myosin heavy polypeptide 13 [Rattus... 35 5.3
gi|45187625|ref|NP_983848.1| ADL248Cp [Eremothecium gossypii] >g... 35 5.3
gi|46133229|ref|ZP_00156849.2| COG3468: Type V secretory pathway... 35 5.3
gi|19075591|ref|NP_588091.1| DNA repair and recombination protei... 35 5.3
gi|213235|gb|AAA49279.1| electromotor neuron-associated protein 35 5.3
gi|49085420|ref|XP_404833.1| hypothetical protein AN0696.2 [Aspe... 35 5.3
gi|11385308|pir||VJCH2 vitellogenin II precursor [validated] - c... 35 5.3
gi|40643146|emb|CAE14681.1| unnamed protein product [Leptospira ... 35 5.3
gi|46121453|ref|XP_385281.1| conserved hypothetical protein [Gib... 35 5.3
gi|6322873|ref|NP_012946.1| Hypothetical ORF; Ykr021wp [Saccharo... 35 5.3
gi|48136802|ref|XP_396782.1| similar to CG9776-PA [Apis mellifera] 35 5.3
gi|15617847|gb|AAL02517.1| Hypothetical protein F47F6.1 [Caenorh... 35 5.3
gi|48096455|ref|XP_392460.1| similar to BMKETTIN [Apis mellifera] 35 5.3
gi|45198978|ref|NP_986007.1| AFR460Cp [Eremothecium gossypii] >g... 35 5.3
gi|22749143|ref|NP_689761.1| hypothetical protein FLJ25333 [Homo... 35 5.3
gi|1685115|gb|AAB36702.1| putative transcription factor [Dictyos... 35 5.3
gi|14590512|ref|NP_142580.1| hypothetical protein PH0620 [Pyroco... 35 5.3
gi|119357|sp|P14400|ENP1_TORCA Electromotor neuron-associated pr... 35 5.3
gi|16805257|ref|NP_473285.1| hypothetical protein [Plasmodium fa... 35 5.3
gi|6671967|gb|AAF23226.1| unknown protein [Arabidopsis thaliana]... 35 5.3
gi|49073892|ref|XP_401120.1| hypothetical protein UM03505.1 [Ust... 35 5.3
gi|28856212|gb|AAH48067.1| Unknown (protein for IMAGE:3818911) [... 35 5.3
gi|24654393|ref|NP_725671.1| CG6556-PA [Drosophila melanogaster]... 35 5.3
gi|29248299|gb|EAA39836.1| GLP_399_679_6558 [Giardia lamblia ATC... 35 5.3
gi|34880781|ref|XP_341139.1| similar to KIAA0471 gene product [R... 35 5.3
gi|39584465|emb|CAE72603.1| Hypothetical protein CBG19793 [Caeno... 35 5.3
gi|48770042|ref|ZP_00274386.1| COG0840: Methyl-accepting chemota... 35 5.3
gi|25151024|ref|NP_493540.2| tropomyosin, LEVamisole resistant L... 35 5.3
gi|34871708|ref|XP_341054.1| CCAAT displacement protein [Rattus ... 35 5.3
gi|48852133|ref|ZP_00306324.1| COG1196: Chromosome segregation A... 35 5.3
gi|15606061|ref|NP_213438.1| chromosome assembly protein homolog... 35 5.3
gi|50742591|ref|XP_419686.1| PREDICTED: similar to Putative RNA-... 35 5.3
gi|40788217|dbj|BAA20794.2| KIAA0336 [Homo sapiens] 35 5.3
gi|50548235|ref|XP_501587.1| hypothetical protein [Yarrowia lipo... 35 5.3
gi|23508409|ref|NP_701078.1| hypothetical protein [Plasmodium fa... 35 5.3
gi|44890380|gb|AAH66698.1| Unknown (protein for MGC:76973) [Dani... 35 5.3
gi|2981173|gb|AAC06245.1| neurofilament medium subunit [Serinus ... 35 5.3
gi|128146|sp|P16053|NFM_CHICK Neurofilament triplet M protein (1... 35 5.3
gi|63686|emb|CAA29073.1| NF-M c-terminus [Gallus gallus] 35 5.3
gi|39590880|emb|CAE65254.1| Hypothetical protein CBG10142 [Caeno... 35 5.3
gi|38110890|gb|EAA56543.1| hypothetical protein MG06514.4 [Magna... 35 5.3
gi|46116034|ref|XP_384035.1| hypothetical protein FG03859.1 [Gib... 35 5.3
gi|46137665|ref|XP_390524.1| hypothetical protein FG10348.1 [Gib... 35 5.3
gi|34873366|ref|XP_347164.1| similar to Cux/CDP(1B1); Cux/CDP ho... 35 5.3
gi|30679640|ref|NP_187241.2| neurofilament protein-related [Arab... 35 5.3
gi|47125165|gb|AAH70659.1| LOC431812 protein [Xenopus laevis] 35 5.3
gi|11362271|pir||T47237 myosin II heavy chain [imported] - Naegl... 35 5.3
gi|23510054|ref|NP_702720.1| hypothetical protein [Plasmodium fa... 35 5.3
gi|1197391|emb|CAA59461.1| methyl-accepting chemoxtaxis protein ... 35 5.3
gi|23481301|gb|EAA17620.1| hypothetical protein [Plasmodium yoel... 35 5.3
gi|34580624|ref|ZP_00142104.1| DNA topoisomerase I [Rickettsia s... 35 5.3
gi|11036632|ref|NP_055023.1| dentin sialophosphoprotein prepropr... 35 5.3
gi|15233676|ref|NP_192645.1| expressed protein [Arabidopsis thal... 35 6.9
gi|50748610|ref|XP_421324.1| PREDICTED: similar to thyroid hormo... 35 6.9
gi|28828227|gb|AAO50904.1| similar to Oryza sativa (Rice). Hydro... 35 6.9
gi|23508321|ref|NP_700990.1| hypothetical protein [Plasmodium fa... 35 6.9
gi|42566341|ref|NP_192603.2| expressed protein [Arabidopsis thal... 35 6.9
gi|34911958|ref|NP_917326.1| putative myosin heavy chain-like pr... 35 6.9
gi|25148435|ref|NP_503136.2| putative protein, with 2 coiled coi... 35 6.9
gi|23508673|ref|NP_701342.1| MAEBL, putative [Plasmodium falcipa... 35 6.9
gi|11497084|ref|NP_051195.1| BdrA [Borrelia burgdorferi B31] >gn... 35 6.9
gi|27526777|emb|CAD32471.1| steerin2 protein [Homo sapiens] 35 6.9
>gi|17552446|ref|NP_497712.1| putative nuclear protein, with 2 coiled
coil-4 domains (75.8 kD) (3E549) [Caenorhabditis elegans]
gi|7496981|pir||T19703 hypothetical protein C34C12.2 - Caenorhabditis
elegans
gi|3874730|emb|CAA87102.1| Hypothetical protein C34C12.2
[Caenorhabditis elegans]
Length = 679
Score = 1280 bits (3312), Expect = 0.0
Identities = 646/666 (96%), Positives = 646/666 (96%)
Frame = +1
Query: 40 EASIRVLEAIREKRKQQLAENARLEAEQAEQDVAPEPIDVQDPVINAGNIVEDAEPLNVN 219
EASIRVLEAIREKRKQQLAENARLEAEQAEQDVAPEPIDVQDPVINAGNIVEDAEPLNVN
Sbjct: 14 EASIRVLEAIREKRKQQLAENARLEAEQAEQDVAPEPIDVQDPVINAGNIVEDAEPLNVN 73
Query: 220 PSPPQPRKFNFRVANLEIARQAKISQNLMKTSETASTSSPVRQQVKTEIVPRVSQRTIVK 399
PSPPQPRKFNFRVANLEIARQAKISQNLMKTSETASTSSPVRQQVKTEIVPRVSQRTIVK
Sbjct: 74 PSPPQPRKFNFRVANLEIARQAKISQNLMKTSETASTSSPVRQQVKTEIVPRVSQRTIVK 133
Query: 400 TQALPRVNAPVLSSVPAKNPLPPKFVYINTAGLKRKRDDDKNTPSTSNSITLNPSSRGDQ 579
TQALPRVNAPVLSSVPAKNPLPPKFVYINTAGLKRKRDDDKNTPSTSNSITLNPSSRGDQ
Sbjct: 134 TQALPRVNAPVLSSVPAKNPLPPKFVYINTAGLKRKRDDDKNTPSTSNSITLNPSSRGDQ 193
Query: 580 TQFIVHLQRTIERLEKEKAALTEKLTMREDEIKVFSVEFVNIQKENVKLMKENKAKESQI 759
TQFIVHLQRTIERLEKEKAALTEKLTMREDEIKVFSVEFVNIQKENVKLMKENKAKESQI
Sbjct: 194 TQFIVHLQRTIERLEKEKAALTEKLTMREDEIKVFSVEFVNIQKENVKLMKENKAKESQI 253
Query: 760 SNQSIQVRNSWKFADLFKKELQKSRKDVSEVKWKIDKIEKKVGIKKPTPRKKPDVKLINP 939
SNQSIQVRNSWKFADLFKKELQKSRKDVSEVKWKIDKIEKKVGIKKPTPRKKPDVKLINP
Sbjct: 254 SNQSIQVRNSWKFADLFKKELQKSRKDVSEVKWKIDKIEKKVGIKKPTPRKKPDVKLINP 313
Query: 940 EDISLMSDRTQDGEDSSDFGSPLAKYLKPDQPSTSSACYGKPFYFESTSSSSRKPITASP 1119
EDISLMSDRTQDGEDSSDFGSPLAKYLKPDQPSTSSACYGKPFYFESTSSSSRKPITASP
Sbjct: 314 EDISLMSDRTQDGEDSSDFGSPLAKYLKPDQPSTSSACYGKPFYFESTSSSSRKPITASP 373
Query: 1120 GPPGRTQISDQLNTGEVRYVVNSGKPFNFSSESNSRNLKLIPGYIKRPEFRYIKPEGFTS 1299
GPPGRTQISDQLNTGEVRYVVNSGKPFNFSSESNSRNLKLIPGYIKRPEFRYIKPEGFTS
Sbjct: 374 GPPGRTQISDQLNTGEVRYVVNSGKPFNFSSESNSRNLKLIPGYIKRPEFRYIKPEGFTS 433
Query: 1300 ASYKAQSEGMSSFLKTGSSATPENSKKSAHFDMPDISSTPYKSHVVVESDEMNSSSSTIG 1479
ASYKAQSEGMSSFLKTGSSATPENSKKSAHFDMPDISSTPYKSHVVVESDEMNSSSSTIG
Sbjct: 434 ASYKAQSEGMSSFLKTGSSATPENSKKSAHFDMPDISSTPYKSHVVVESDEMNSSSSTIG 493
Query: 1480 GFESEKKDNGALGSQKSPMPDIATALHNIFDSKEVQXXXXXXXXXAPPENSKKSDHFDMP 1659
GFESEKKDNGALGSQKSPMPDIATALHNIFDSKEVQ APPENSKKSDHFDMP
Sbjct: 494 GFESEKKDNGALGSQKSPMPDIATALHNIFDSKEVQSSSSTTGSSAPPENSKKSDHFDMP 553
Query: 1660 DISSTLYRSRVEPIXXXXXXXXXXXAPRYVPKPIAQPARYAIPSPGALNALRRPPEWKGQ 1839
DISSTLYRSRVEPI APRYVPKPIAQPARYAIPSPGALNALRRPPEWKGQ
Sbjct: 554 DISSTLYRSRVEPISSSSSGSTSTSAPRYVPKPIAQPARYAIPSPGALNALRRPPEWKGQ 613
Query: 1840 RRHAPSYVKSRESVTFRGCSRFPVTSPHFAKAHLEPVTDGKDDSKIVKYRFVPKRPDFDG 2019
RRHAPSYVKSRESVTFRGCSRFPVTSPHFAKAHLEPVTDGKDDSKIVKYRFVPKRPDFDG
Sbjct: 614 RRHAPSYVKSRESVTFRGCSRFPVTSPHFAKAHLEPVTDGKDDSKIVKYRFVPKRPDFDG 673
Query: 2020 EREHKK 2037
EREHKK
Sbjct: 674 EREHKK 679