Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C25D7_2
(453 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17558192|ref|NP_506701.1| MSP-domain protein like family memb... 269 8e-72
gi|17557470|ref|NP_506723.1| MSP-domain protein like family memb... 260 5e-69
gi|39582189|emb|CAE71521.1| Hypothetical protein CBG18456 [Caeno... 236 7e-62
gi|17541248|ref|NP_501765.1| predicted CDS, MSP-domain protein l... 226 6e-59
gi|39581884|emb|CAE60778.1| Hypothetical protein CBG04467 [Caeno... 74 8e-13
gi|17561434|ref|NP_506076.1| major sperm protein, member of a la... 72 3e-12
gi|17508753|ref|NP_493318.1| Sperm-Specific family, class P SSP-... 71 4e-12
gi|17544490|ref|NP_501989.1| MSP-domain protein like family memb... 70 1e-11
gi|17562962|ref|NP_506630.1| MSP-domain protein like family memb... 70 1e-11
gi|34810947|pdb|1M1S|A Chain A, Structure Of Wr4, A C.Elegans Ms... 70 1e-11
gi|39592211|emb|CAE75432.1| Hypothetical protein CBG23425 [Caeno... 69 1e-11
gi|17568285|ref|NP_509840.1| predicted CDS, MSP-domain protein l... 69 2e-11
gi|39594899|emb|CAE70767.1| Hypothetical protein CBG17518 [Caeno... 68 3e-11
gi|17542418|ref|NP_501739.1| MSP-domain protein like family memb... 65 3e-10
gi|17542092|ref|NP_501782.1| Sperm-Specific family, class P SSP-... 65 3e-10
gi|23169000|gb|AAN08881.1| MSP-domain protein 3 [Ascaris suum] >... 62 2e-09
gi|17540424|ref|NP_501808.1| MSP-domain protein like family memb... 62 2e-09
gi|33114624|gb|AAP94885.1| MFP1-beta [Ascaris suum] 62 3e-09
gi|39591169|emb|CAE73222.1| Hypothetical protein CBG20628 [Caeno... 60 7e-09
gi|39582951|emb|CAE73016.1| Hypothetical protein CBG20377 [Caeno... 60 7e-09
gi|17538127|ref|NP_496078.1| predicted CDS, MSP-domain protein l... 60 7e-09
gi|39596794|emb|CAE59021.1| Hypothetical protein CBG02298 [Caeno... 60 7e-09
gi|17538125|ref|NP_496079.1| predicted CDS, MSP-domain protein l... 60 9e-09
gi|33114622|gb|AAP94884.1| MFP1-alpha [Ascaris suum] 60 1e-08
gi|50511753|gb|AAT77426.1| MSP-domain protein 1 variant [Ascaris... 59 2e-08
gi|50511751|gb|AAT77425.1| MSP-domain protein 1 variant [Ascaris... 59 2e-08
gi|50511749|gb|AAT77424.1| MSP-domain protein 1 variant [Ascaris... 59 2e-08
gi|50511755|gb|AAT77427.1| MSP-domain protein 1 variant [Ascaris... 59 2e-08
gi|50511745|gb|AAT77422.1| MSP-domain protein 1 variant [Ascaris... 59 2e-08
gi|49121580|gb|AAN08879.2| MSP-domain protein 1 [Ascaris suum] 59 2e-08
gi|39594026|emb|CAE70136.1| Hypothetical protein CBG16598 [Caeno... 59 2e-08
gi|39591164|emb|CAE73217.1| Hypothetical protein CBG20623 [Caeno... 59 2e-08
gi|17562648|ref|NP_504485.1| MSP-domain protein like family memb... 59 3e-08
gi|17542088|ref|NP_501767.1| MSP-domain protein like family memb... 59 3e-08
gi|39589662|emb|CAE66897.1| Hypothetical protein CBG12279 [Caeno... 58 3e-08
gi|17508749|ref|NP_491762.1| Sperm-Specific family, class P SSP-... 58 3e-08
gi|17542086|ref|NP_500697.1| Sperm-Specific family, class P SSP-... 57 6e-08
gi|39592311|emb|CAE63388.1| Hypothetical protein CBG07809 [Caeno... 57 1e-07
gi|17508751|ref|NP_491000.1| Sperm-Specific family, class P SSP-... 55 2e-07
gi|39593130|emb|CAE64599.1| Hypothetical protein CBG09354 [Caeno... 53 1e-06
gi|23169006|gb|AAN08882.1| MSP-domain protein 4 [Ascaris suum] >... 52 2e-06
gi|17539024|ref|NP_501124.1| major sperm protein with N myristoy... 49 2e-05
gi|39589763|emb|CAE66998.1| Hypothetical protein CBG12397 [Caeno... 49 2e-05
gi|23169009|gb|AAN08883.1| MSP-domain protein 5 [Ascaris suum] >... 49 2e-05
gi|39594090|emb|CAE70200.1| Hypothetical protein CBG16675 [Caeno... 48 4e-05
gi|17552806|ref|NP_498780.1| MSP-domain protein like family memb... 48 4e-05
gi|17507523|ref|NP_492407.1| MSP-domain protein like family memb... 44 7e-04
gi|17554100|ref|NP_499837.1| predicted CDS, major sperm protein ... 42 0.003
gi|39589204|emb|CAE57937.1| Hypothetical protein CBG00991 [Caeno... 40 0.007
gi|39591509|emb|CAE73563.1| Hypothetical protein CBG21033 [Caeno... 40 0.007
gi|7510976|pir||T27729 hypothetical protein ZK1307.4 - Caenorhab... 39 0.017
gi|17505881|ref|NP_492824.1| vamp-associated protein like family... 39 0.022
gi|39591787|emb|CAE71365.1| Hypothetical protein CBG18269 [Caeno... 38 0.048
gi|17559594|ref|NP_507136.1| MSP-domain protein like (32.2 kD) (... 38 0.048
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb... 38 0.048
gi|39586114|emb|CAE69190.1| Hypothetical protein CBG15225 [Caeno... 36 0.14
gi|17558194|ref|NP_506702.1| MSP-domain protein like family memb... 35 0.41
gi|11466111|ref|NP_047044.1| L2602.4 [Leishmania major] >gnl|BL_... 35 0.41
gi|17558208|ref|NP_506700.1| MSP-domain protein like family memb... 35 0.41
gi|17560040|ref|NP_507098.1| MSP-domain protein like family memb... 34 0.53
gi|17560600|ref|NP_507182.1| MSP-domain protein like family memb... 33 0.91
gi|47203782|emb|CAG14038.1| unnamed protein product [Tetraodon n... 33 1.2
gi|39595110|emb|CAE60147.1| Hypothetical protein CBG03696 [Caeno... 33 1.2
gi|39583249|emb|CAE60041.1| Hypothetical protein CBG03552 [Caeno... 33 1.6
gi|17509493|ref|NP_493185.1| MSP-domain protein 1 like precursor... 33 1.6
gi|32416470|ref|XP_328713.1| hypothetical protein [Neurospora cr... 31 4.5
gi|49613983|emb|CAG70346.1| putative transposase [Dehalobacter r... 31 4.5
gi|21242493|ref|NP_642075.1| hypothetical protein [Xanthomonas a... 31 4.5
gi|39979148|emb|CAE85522.1| related to MAK32 protein [Neurospora... 31 4.5
gi|39586995|emb|CAE62930.1| Hypothetical protein CBG07136 [Caeno... 31 5.9
gi|6049245|gb|AAF02518.1| structural glycoprotein E2 [Bovine vir... 31 5.9
gi|38047609|gb|AAR09707.1| similar to Drosophila melanogaster Bc... 30 7.7
gi|19920832|ref|NP_609037.1| CG9543-PA [Drosophila melanogaster]... 30 7.7
gi|42407366|dbj|BAD09355.1| putative zinc-finger protein [Oryza ... 30 7.7
>gi|17558192|ref|NP_506701.1| MSP-domain protein like family member
(16.6 kD) (5P516) [Caenorhabditis elegans]
gi|7496470|pir||T19447 hypothetical protein C25D7.1 -
Caenorhabditis elegans
gi|3874446|emb|CAB02771.1| Hypothetical protein C25D7.1
[Caenorhabditis elegans]
Length = 150
Score = 269 bits (688), Expect = 8e-72
Identities = 135/135 (100%), Positives = 135/135 (100%)
Frame = -1
Query: 408 IDEANSESSKVPLAIDPEEAKLPNAGGKSEHMVVNFTSKRMAIKVRCGNALFRVEPTHMI 229
IDEANSESSKVPLAIDPEEAKLPNAGGKSEHMVVNFTSKRMAIKVRCGNALFRVEPTHMI
Sbjct: 16 IDEANSESSKVPLAIDPEEAKLPNAGGKSEHMVVNFTSKRMAIKVRCGNALFRVEPTHMI 75
Query: 228 IEPNKCRQLTINRMPGPIQKDKAIVQYLQIENDVQDPKTAFKAADSAGTKIPHLKIKLVA 49
IEPNKCRQLTINRMPGPIQKDKAIVQYLQIENDVQDPKTAFKAADSAGTKIPHLKIKLVA
Sbjct: 76 IEPNKCRQLTINRMPGPIQKDKAIVQYLQIENDVQDPKTAFKAADSAGTKIPHLKIKLVA 135
Query: 48 GASGGRQMSREVVDE 4
GASGGRQMSREVVDE
Sbjct: 136 GASGGRQMSREVVDE 150