Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= C18E3_3
         (996 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17505659|ref|NP_491325.1| u5 snRNP-specific protein (36.8 kD)...   678   0.0
gi|7496291|pir||T15181 hypothetical protein C18E3.5 - Caenorhabd...   626   e-178
gi|39586335|emb|CAE66746.1| Hypothetical protein CBG12096 [Caeno...   475   e-135
gi|39594799|emb|CAE70667.1| Hypothetical protein CBG17375 [Caeno...   444   e-123
gi|17551498|ref|NP_509886.1| u5 snRNP-specific protein (XL916) [...   442   e-123
gi|37231578|gb|AAH58365.1| Prp8bp-pending protein [Mus musculus]      374   e-102
gi|16306637|gb|AAH01494.1| U5 snRNP-specific 40 kDa protein (hPr...   373   e-102
gi|50759611|ref|XP_417704.1| PREDICTED: similar to Prp8bp-pendin...   371   e-101
gi|4758560|ref|NP_004805.1| U5 snRNP-specific 40 kDa protein (hP...   370   e-101
gi|41053421|ref|NP_956616.1| similar to U5 snRNP-specific 40 kDa...   365   e-100
gi|27924436|gb|AAH45034.1| Prp8bp-pending-prov protein [Xenopus ...   363   3e-99
gi|32822805|gb|AAH54992.1| MGC64565 protein [Xenopus laevis]          361   1e-98
gi|31202483|ref|XP_310190.1| ENSANGP00000010898 [Anopheles gambi...   353   3e-96
gi|47216142|emb|CAG10016.1| unnamed protein product [Tetraodon n...   347   3e-94
gi|15224356|ref|NP_181905.1| transducin family protein / WD-40 r...   344   2e-93
gi|20129125|ref|NP_608501.1| CG3436-PA [Drosophila melanogaster]...   343   5e-93
gi|21313414|ref|NP_079921.1| U5 snRNP-specific protein (Prp8-bin...   323   3e-87
gi|3746838|gb|AAC64084.1| 38kDa splicing factor; SPF 38 [Homo sa...   315   8e-85
gi|42733993|gb|AAO52600.2| similar to Arabidopsis thaliana (Mous...   314   2e-84
gi|34871679|ref|XP_232775.2| similar to U5 snRNP-specific protei...   295   1e-78
gi|38104352|gb|EAA50934.1| hypothetical protein MG04693.4 [Magna...   285   9e-76
gi|49134361|ref|XP_413222.1| hypothetical protein AN9085.2 [Aspe...   283   4e-75
gi|32410343|ref|XP_325652.1| hypothetical protein [Neurospora cr...   282   1e-74
gi|19113627|ref|NP_596835.1| WD repeat protein; human U5 SNRNP-s...   270   3e-71
gi|46111533|ref|XP_382824.1| hypothetical protein FG02648.1 [Gib...   268   2e-70
gi|23612787|ref|NP_704326.1| u5 snrnp-specific protein, putative...   222   9e-57
gi|23490090|gb|EAA21947.1| hypothetical protein [Plasmodium yoel...   213   4e-54
gi|50256786|gb|EAL19506.1| hypothetical protein CNBG4530 [Crypto...   211   2e-53
gi|49069172|ref|XP_398875.1| hypothetical protein UM01260.1 [Ust...   201   2e-50
gi|46226958|gb|EAK87924.1| WD repeat protein [Cryptosporidium pa...   192   8e-48
gi|50421219|ref|XP_459155.1| unnamed protein product [Debaryomyc...   179   9e-44
gi|20892399|ref|XP_148059.1| expressed sequence AI606931 [Mus mu...   154   2e-36
gi|27666788|ref|XP_221406.1| similar to WD repeat domain 5B [Rat...   149   1e-34
gi|23199987|ref|NP_061942.2| WD repeat domain 5B [Homo sapiens] ...   147   3e-34
gi|17230958|ref|NP_487506.1| WD-40 repeat protein [Nostoc sp. PC...   147   5e-34
gi|23128981|ref|ZP_00110817.1| COG2319: FOG: WD40 repeat [Nostoc...   146   6e-34
gi|40949819|gb|AAR97571.1| will die slowly [Bombyx mori]              146   6e-34
gi|31196347|ref|XP_307121.1| ENSANGP00000012135 [Anopheles gambi...   146   6e-34
gi|30353827|gb|AAH52124.1| Zgc:76895 protein [Danio rerio] >gnl|...   145   1e-33
gi|7023854|dbj|BAA92110.1| unnamed protein product [Homo sapiens]     145   1e-33
gi|20302740|gb|AAM18868.1| unknown [Branchiostoma floridae]           145   1e-33
gi|17864654|ref|NP_524984.1| CG17437-PA [Drosophila melanogaster...   145   2e-33
gi|17225206|gb|AAL37299.1| beta transducin-like protein HET-E2C*...   144   2e-33
gi|16554627|ref|NP_060058.1| WD repeat domain 5 protein; WD-repe...   144   3e-33
gi|34853150|ref|XP_342398.1| similar to hypothetical protein [Ra...   144   3e-33
gi|6714707|emb|CAB66159.1| hypothetical protein [Homo sapiens]        144   3e-33
gi|17225204|gb|AAL37298.1| beta transducin-like protein HET-E2C ...   144   4e-33
gi|17225208|gb|AAL37300.1| beta transducin-like protein HET-E2C*...   144   4e-33
gi|50757207|ref|XP_415427.1| PREDICTED: similar to Zgc:56591 pro...   143   5e-33
gi|37522390|ref|NP_925767.1| WD-repeat protein [Gloeobacter viol...   143   7e-33
gi|23130558|ref|ZP_00112371.1| COG2319: FOG: WD40 repeat [Nostoc...   142   1e-32
gi|23128236|ref|ZP_00110089.1| COG2319: FOG: WD40 repeat [Nostoc...   141   2e-32
gi|50416345|gb|AAH77844.1| Unknown (protein for MGC:80538) [Xeno...   141   3e-32
gi|3023956|sp|Q00808|HET1_PODAN Vegetatible incompatibility prot...   140   3e-32
gi|37523920|ref|NP_927297.1| WD-repeat protein [Gloeobacter viol...   140   6e-32
gi|46130702|ref|XP_389131.1| hypothetical protein FG08955.1 [Gib...   139   1e-31
gi|45509691|ref|ZP_00162024.1| COG2319: FOG: WD40 repeat [Anabae...   137   3e-31
gi|23124810|ref|ZP_00106776.1| COG2319: FOG: WD40 repeat [Nostoc...   137   3e-31
gi|17225210|gb|AAL37301.1| beta transducin-like protein HET-D2Y ...   136   7e-31
gi|23128312|ref|ZP_00110163.1| COG2319: FOG: WD40 repeat [Nostoc...   132   9e-30
gi|37521534|ref|NP_924911.1| WD-repeat protein [Gloeobacter viol...   132   2e-29
gi|15229187|ref|NP_190535.1| transducin family protein / WD-40 r...   131   3e-29
gi|45506973|ref|ZP_00159321.1| COG2319: FOG: WD40 repeat [Anabae...   130   4e-29
gi|11359958|pir||T46935 hypothetical protein DKFZp434D199.1 - hu...   130   6e-29
gi|17227934|ref|NP_484482.1| serine/threonine kinase with WD-40 ...   129   8e-29
gi|17233145|ref|NP_490235.1| WD-repeat protein [Nostoc sp. PCC 7...   129   1e-28
gi|37523925|ref|NP_927302.1| WD-repeat protein [Gloeobacter viol...   128   2e-28
gi|46135387|ref|ZP_00162792.2| COG2319: FOG: WD40 repeat [Anabae...   128   2e-28
gi|23126805|ref|ZP_00108691.1| COG2319: FOG: WD40 repeat [Nostoc...   128   2e-28
gi|17230292|ref|NP_486840.1| WD-repeat protein [Nostoc sp. PCC 7...   127   4e-28
gi|50548017|ref|XP_501478.1| hypothetical protein [Yarrowia lipo...   127   5e-28
gi|45508311|ref|ZP_00160650.1| COG2319: FOG: WD40 repeat [Anabae...   126   7e-28
gi|37522457|ref|NP_925834.1| WD-repeat protein [Gloeobacter viol...   125   1e-27
gi|45507426|ref|ZP_00159770.1| COG2319: FOG: WD40 repeat [Anabae...   125   2e-27
gi|45506782|ref|ZP_00159132.1| COG2319: FOG: WD40 repeat [Anabae...   124   3e-27
gi|39580327|emb|CAE64482.1| Hypothetical protein CBG09206 [Caeno...   123   6e-27
gi|23126094|ref|ZP_00108001.1| COG2319: FOG: WD40 repeat [Nostoc...   123   7e-27
gi|46135357|ref|ZP_00162759.2| COG2319: FOG: WD40 repeat [Anabae...   123   7e-27
gi|23130132|ref|ZP_00111951.1| COG2319: FOG: WD40 repeat [Nostoc...   122   2e-26
gi|23126612|ref|ZP_00108502.1| COG2319: FOG: WD40 repeat [Nostoc...   121   2e-26
gi|23129632|ref|ZP_00111458.1| COG2319: FOG: WD40 repeat [Nostoc...   121   3e-26
gi|50751998|ref|XP_422608.1| PREDICTED: similar to hypothetical ...   121   3e-26
gi|17568701|ref|NP_510394.1| WD repeat domain 5B (43.1 kD) (XO96...   121   3e-26
gi|49124494|ref|XP_412605.1| hypothetical protein AN8468.2 [Aspe...   121   3e-26
gi|37522224|ref|NP_925601.1| WD-repeat protein [Gloeobacter viol...   120   4e-26
gi|45505417|ref|ZP_00157801.1| COG2319: FOG: WD40 repeat [Anabae...   120   5e-26
gi|46134381|ref|ZP_00157805.2| COG2319: FOG: WD40 repeat [Anabae...   120   6e-26
gi|23124949|ref|ZP_00106905.1| COG2319: FOG: WD40 repeat [Nostoc...   119   8e-26
gi|37520744|ref|NP_924121.1| WD-repeat protein [Gloeobacter viol...   119   8e-26
gi|17232251|ref|NP_488799.1| WD-repeat protein [Nostoc sp. PCC 7...   119   1e-25
gi|17230661|ref|NP_487209.1| WD repeat protein with Ser/Thr prot...   119   1e-25
gi|46119952|ref|ZP_00179225.2| COG2319: FOG: WD40 repeat [Crocos...   119   1e-25
gi|23129722|ref|ZP_00111547.1| COG2319: FOG: WD40 repeat [Nostoc...   119   1e-25
gi|17230611|ref|NP_487159.1| WD repeat protein with Ser/Thr prot...   119   1e-25
gi|50252234|dbj|BAD28241.1| putative WD repeat domain 5B [Oryza ...   118   2e-25
gi|17566626|ref|NP_505737.1| WD repeat domain 5B (54.5 kD) (5L21...   118   2e-25
gi|38505813|ref|NP_942432.1| WD-repeat protein [Synechocystis sp...   118   2e-25
gi|48893278|ref|ZP_00326547.1| COG0515: Serine/threonine protein...   118   2e-25
gi|45508310|ref|ZP_00160649.1| COG2319: FOG: WD40 repeat [Anabae...   118   2e-25
gi|24210418|emb|CAD54457.1| LIS1 protein [Dictyostelium discoide...   118   2e-25
gi|45506958|ref|ZP_00159306.1| COG2319: FOG: WD40 repeat [Anabae...   118   2e-25
gi|17228160|ref|NP_484708.1| WD-40 repeat protein [Nostoc sp. PC...   118   2e-25
gi|23129032|ref|ZP_00110866.1| COG2319: FOG: WD40 repeat [Nostoc...   117   3e-25
gi|17552164|ref|NP_497749.1| WD repeat domain 5B (3E795) [Caenor...   116   7e-25
gi|48891847|ref|ZP_00325296.1| COG2319: FOG: WD40 repeat [Tricho...   116   9e-25
gi|45361545|ref|NP_989349.1| hypothetical protein MGC76247 [Xeno...   116   9e-25
gi|23130298|ref|ZP_00112115.1| COG2319: FOG: WD40 repeat [Nostoc...   116   9e-25
gi|17227525|ref|NP_484073.1| WD-40 repeat protein [Nostoc sp. PC...   115   1e-24
gi|23130638|ref|ZP_00112451.1| COG2319: FOG: WD40 repeat [Nostoc...   115   2e-24
gi|17227780|ref|NP_484328.1| WD-40 repeat protein [Nostoc sp. PC...   115   2e-24
gi|15242311|ref|NP_196473.1| transducin family protein / WD-40 r...   115   2e-24
gi|50428732|gb|AAT77083.1| putative WD G-beta repeat protein [Or...   115   2e-24
gi|17229616|ref|NP_486164.1| WD-40 repeat protein [Nostoc sp. PC...   114   3e-24
gi|45509405|ref|ZP_00161739.1| COG2319: FOG: WD40 repeat [Anabae...   114   3e-24
gi|23130123|ref|ZP_00111942.1| COG2319: FOG: WD40 repeat [Nostoc...   114   5e-24
gi|46134601|ref|ZP_00158195.2| COG2319: FOG: WD40 repeat [Anabae...   114   5e-24
gi|39586585|emb|CAE73712.1| Hypothetical protein CBG21225 [Caeno...   113   6e-24
gi|15235470|ref|NP_192182.1| transducin family protein / WD-40 r...   113   6e-24
gi|46134602|ref|ZP_00158196.2| COG2319: FOG: WD40 repeat [Anabae...   113   6e-24
gi|45508715|ref|ZP_00161052.1| COG2319: FOG: WD40 repeat [Anabae...   113   6e-24
gi|23124439|ref|ZP_00106428.1| COG2319: FOG: WD40 repeat [Nostoc...   113   6e-24
gi|17227779|ref|NP_484327.1| WD-40 repeat protein [Nostoc sp. PC...   113   8e-24
gi|37520294|ref|NP_923671.1| WD-40 repeat protein [Gloeobacter v...   113   8e-24
gi|3122952|sp|O15736|TIPD_DICDI Protein tipD >gnl|BL_ORD_ID|3655...   112   1e-23
gi|49102841|ref|XP_411097.1| hypothetical protein AN6960.2 [Aspe...   112   1e-23
gi|21758953|dbj|BAC05425.1| unnamed protein product [Homo sapiens]    112   1e-23
gi|45509331|ref|ZP_00161665.1| COG2319: FOG: WD40 repeat [Anabae...   112   1e-23
gi|17227743|ref|NP_484291.1| WD-40 repeat protein [Nostoc sp. PC...   112   2e-23
gi|17232326|ref|NP_488874.1| WD-repeat protein [Nostoc sp. PCC 7...   111   3e-23
gi|23126059|ref|ZP_00107968.1| COG2319: FOG: WD40 repeat [Nostoc...   111   3e-23
gi|12838548|dbj|BAB24241.1| unnamed protein product [Mus musculu...   110   4e-23
gi|50731422|ref|XP_417265.1| PREDICTED: similar to F-box-WD40 re...   110   4e-23
gi|16331266|ref|NP_441994.1| beta transducin-like protein [Synec...   110   4e-23
gi|34851410|ref|XP_213850.2| similar to RIKEN cDNA 1500041N16 [R...   110   5e-23
gi|18044039|gb|AAH19369.1| RIKEN cDNA 1500041N16 [Mus musculus]       110   5e-23
gi|32189425|ref|NP_849143.1| hypothetical protein FLJ25955 [Homo...   110   5e-23
gi|50547865|ref|XP_501402.1| hypothetical protein [Yarrowia lipo...   110   5e-23
gi|17554220|ref|NP_499755.1| human LISsencephaly gene related (4...   110   7e-23
gi|31240513|ref|XP_320670.1| ENSANGP00000021164 [Anopheles gambi...   110   7e-23
gi|45508168|ref|ZP_00160508.1| COG2319: FOG: WD40 repeat [Anabae...   109   1e-22
gi|31231745|ref|XP_318586.1| ENSANGP00000020892 [Anopheles gambi...   108   1e-22
gi|13385884|ref|NP_080675.1| RIKEN cDNA 1500041N16 [Mus musculus...   108   1e-22
gi|22972904|ref|ZP_00019756.1| hypothetical protein [Chloroflexu...   108   1e-22
gi|23124360|ref|ZP_00106355.1| COG2319: FOG: WD40 repeat [Nostoc...   108   1e-22
gi|12854841|dbj|BAB30146.1| unnamed protein product [Mus musculus]    108   1e-22
gi|47229875|emb|CAG07071.1| unnamed protein product [Tetraodon n...   108   2e-22
gi|17227974|ref|NP_484522.1| WD-40 repeat protein [Nostoc sp. PC...   108   2e-22
gi|46135416|ref|ZP_00203492.1| COG2319: FOG: WD40 repeat [Anabae...   108   2e-22
gi|47208427|emb|CAF87494.1| unnamed protein product [Tetraodon n...   107   3e-22
gi|46120249|ref|ZP_00179648.2| COG2319: FOG: WD40 repeat [Crocos...   107   3e-22
gi|33417154|gb|AAH56099.1| MGC69111 protein [Xenopus laevis]          107   3e-22
gi|41724850|ref|ZP_00151660.1| COG2319: FOG: WD40 repeat [Dechlo...   107   3e-22
gi|48846051|ref|ZP_00300319.1| COG2319: FOG: WD40 repeat [Geobac...   107   3e-22
gi|37523230|ref|NP_926607.1| WD-40 repeat protein [Gloeobacter v...   107   4e-22
gi|17232051|ref|NP_488599.1| WD-40 repeat-protein [Nostoc sp. PC...   107   4e-22
gi|50754099|ref|XP_414244.1| PREDICTED: similar to DKFZP434C245 ...   107   4e-22
gi|18424859|ref|NP_568993.1| transducin family protein / WD-40 r...   107   4e-22
gi|50551767|ref|XP_503358.1| hypothetical protein [Yarrowia lipo...   107   6e-22
gi|48835147|ref|ZP_00292148.1| COG2319: FOG: WD40 repeat [Thermo...   107   6e-22
gi|34394218|dbj|BAC84670.1| putative WD repeat domain 5 protein ...   107   6e-22
gi|45509197|ref|ZP_00161532.1| COG2319: FOG: WD40 repeat [Anabae...   107   6e-22
gi|1346729|sp|P49695|PKWA_THECU Probable serine/threonine-protei...   107   6e-22
gi|17737533|ref|NP_523922.1| CG15010-PC [Drosophila melanogaster...   107   6e-22
gi|14326447|gb|AAK60269.1| F-box protein FBX30 [Homo sapiens]         106   7e-22
gi|17974548|gb|AAL50052.1| F-box protein [Mus musculus]               106   7e-22
gi|21218434|ref|NP_536353.2| F-box and WD-40 domain protein 7, a...   106   7e-22
gi|7023505|dbj|BAA91986.1| unnamed protein product [Homo sapiens]     106   7e-22
gi|16117779|ref|NP_060785.2| F-box protein FBW7 isoform 2; archi...   106   7e-22
gi|50746331|ref|XP_420447.1| PREDICTED: similar to F-box protein...   106   7e-22
gi|15822537|gb|AAG16640.1| F-box protein SEL10 [Homo sapiens]         106   7e-22
gi|16117781|ref|NP_361014.1| F-box protein FBW7 isoform 1; archi...   106   7e-22
gi|45198717|ref|NP_985746.1| AFR199Cp [Eremothecium gossypii] >g...   106   9e-22
gi|34783512|gb|AAH37320.1| FBXW7 protein [Homo sapiens]               106   9e-22
gi|46134549|ref|ZP_00158076.2| COG2319: FOG: WD40 repeat [Anabae...   106   9e-22
gi|50257760|gb|EAL20461.1| hypothetical protein CNBE3820 [Crypto...   106   9e-22
gi|50539926|ref|NP_001002429.1| zgc:92654 [Danio rerio] >gnl|BL_...   106   9e-22
gi|49091992|ref|XP_407457.1| hypothetical protein AN3320.2 [Aspe...   105   1e-21
gi|48840987|ref|ZP_00297913.1| COG2319: FOG: WD40 repeat [Methan...   105   2e-21
gi|48893749|ref|ZP_00326947.1| COG2319: FOG: WD40 repeat [Tricho...   105   2e-21
gi|48895484|ref|ZP_00328468.1| COG2319: FOG: WD40 repeat [Tricho...   105   2e-21
gi|14150114|ref|NP_115708.1| hypothetical protein MGC4238 [Homo ...   105   2e-21
gi|17230283|ref|NP_486831.1| WD-repeat protein [Nostoc sp. PCC 7...   104   3e-21
gi|49523068|gb|AAH75548.1| Unknown (protein for MGC:89488) [Xeno...   104   3e-21
gi|24654584|ref|NP_611261.1| CG10931-PA [Drosophila melanogaster...   103   5e-21
gi|46130696|ref|XP_389128.1| hypothetical protein FG08952.1 [Gib...   103   5e-21
gi|48894319|ref|ZP_00327428.1| COG2319: FOG: WD40 repeat [Tricho...   103   6e-21
gi|22298032|ref|NP_681279.1| WD-40 repeat protein [Thermosynecho...   103   6e-21
gi|49101231|ref|XP_410940.1| hypothetical protein AN6803.2 [Aspe...   103   8e-21
gi|49073067|ref|XP_400779.1| hypothetical protein UM03164.1 [Ust...   103   8e-21
gi|47224493|emb|CAG08743.1| unnamed protein product [Tetraodon n...   102   1e-20
gi|48096118|ref|XP_392399.1| similar to CG8440-PA [Apis mellifera]    102   1e-20
gi|41056233|ref|NP_956412.1| Unknown (protein for MGC:63538); wu...   102   1e-20
gi|17137196|ref|NP_477160.1| CG8440-PA [Drosophila melanogaster]...   102   1e-20
gi|3983137|gb|AAC83821.1| Lis1 homolog [Drosophila melanogaster]      102   1e-20
gi|48893630|ref|ZP_00326828.1| COG2319: FOG: WD40 repeat [Tricho...   102   1e-20
gi|26665869|ref|NP_758440.1| TUWD12 [Homo sapiens] >gnl|BL_ORD_I...   102   1e-20
gi|37682095|gb|AAQ97974.1| TUWD12 [Danio rerio]                       102   1e-20
gi|23129645|ref|ZP_00111471.1| COG2319: FOG: WD40 repeat [Nostoc...   102   1e-20
gi|45190361|ref|NP_984615.1| AEL246Cp [Eremothecium gossypii] >g...   102   2e-20
gi|39581518|emb|CAE64254.1| Hypothetical protein CBG08899 [Caeno...   102   2e-20
gi|15240637|ref|NP_199834.1| transducin family protein / WD-40 r...   101   2e-20
gi|46111239|ref|XP_382677.1| hypothetical protein FG02501.1 [Gib...   101   2e-20
gi|47214100|emb|CAF95357.1| unnamed protein product [Tetraodon n...   101   2e-20
gi|11992988|gb|AAA56865.2| guanine nucleotide regulatory protein...   101   2e-20
gi|19114682|ref|NP_593770.1| guanine nucleotide-binding protein ...   101   2e-20
gi|40823395|gb|AAR92280.1| At5g50230 [Arabidopsis thaliana]           101   2e-20
gi|48099312|ref|XP_394888.1| similar to Hypothetical protein MGC...   101   3e-20
gi|26328005|dbj|BAC27743.1| unnamed protein product [Mus musculus]    101   3e-20
gi|3406654|gb|AAC29438.1| transcriptional repressor TUP1 [Dictyo...   101   3e-20
gi|22028422|gb|AAH34901.1| 2510040D07Rik protein [Mus musculus]       100   4e-20
gi|38455441|gb|AAR20840.1| antigenic WD protein [Leishmania amaz...   100   4e-20
gi|50728412|ref|XP_416132.1| PREDICTED: similar to TUWD12 [Gallu...   100   5e-20
gi|48891324|ref|ZP_00324864.1| COG2319: FOG: WD40 repeat [Tricho...   100   7e-20
gi|23593529|ref|XP_135092.2| RIKEN cDNA 2510040D07 [Mus musculus]     100   7e-20
gi|6323763|ref|NP_013834.1| WD repeat protein (G-beta like prote...   100   7e-20
gi|13938537|gb|AAH07417.1| DKFZP434C245 protein [Homo sapiens]        100   7e-20
gi|47523580|ref|NP_999415.1| platelet-activating factor acetylhy...   100   9e-20
gi|7305363|ref|NP_038653.1| platelet-activating factor acetylhyd...   100   9e-20
gi|17056921|gb|AAL34972.1| Miller-Dieker lissencephaly protein [...   100   9e-20
gi|45383504|ref|NP_989655.1| platelet-activating factor acetylhy...   100   9e-20
gi|45433584|ref|NP_991399.1| hypothetical protein MGC76037 [Xeno...   100   9e-20
gi|14132774|gb|AAK52334.1| LIS1 [Xenopus laevis]                      100   9e-20
gi|4557741|ref|NP_000421.1| platelet-activating factor acetylhyd...   100   9e-20
gi|48892224|ref|ZP_00325622.1| COG2319: FOG: WD40 repeat [Tricho...   100   9e-20
gi|17488592|gb|AAL40359.1| unknown protein [Takifugu rubripes]        100   9e-20
gi|37520475|ref|NP_923852.1| WD-repeat protein [Gloeobacter viol...   100   9e-20
gi|480009|pir||S36113 LIS-1 protein - human                           100   9e-20
gi|27807199|ref|NP_777088.1| platelet-activating factor acetylhy...    99   1e-19
gi|16331137|ref|NP_441865.1| beta transducin-like protein [Synec...    99   1e-19
gi|23127725|ref|ZP_00109588.1| COG2319: FOG: WD40 repeat [Nostoc...    99   2e-19
gi|23574762|dbj|BAC20600.1| platelet activating factor acetylhyd...    99   2e-19
gi|47679343|gb|AAT36652.1| Tup1p [Exophiala dermatitidis]              99   2e-19
gi|32264056|gb|AAO45688.1| activated protein kinase C receptor [...    99   2e-19
gi|21411480|gb|AAH31227.1| LOC126248 protein [Homo sapiens]            99   2e-19
gi|48891596|ref|ZP_00325089.1| COG0515: Serine/threonine protein...    99   2e-19
gi|17056923|gb|AAL34973.1| Miller-Dieker lissencephaly protein [...    99   2e-19
gi|47271481|ref|NP_775750.2| hypothetical protein LOC126248 [Hom...    99   2e-19
gi|48123379|ref|XP_396532.1| similar to ENSANGP00000020955 [Apis...    99   2e-19
gi|48895671|ref|ZP_00328655.1| COG0515: Serine/threonine protein...    99   2e-19
gi|23612749|ref|NP_704288.1| guanine nucleotide-binding protein,...    99   2e-19
gi|13174235|gb|AAK14409.1| putative angio-associated migratory c...    99   2e-19
gi|12856025|dbj|BAB30542.1| unnamed protein product [Mus musculu...    99   2e-19
gi|47059149|ref|NP_082016.1| similar to TUWD12 [Mus musculus] >g...    99   2e-19
gi|30725776|ref|NP_849249.1| Src-associated protein SAW [Mus mus...    98   3e-19
gi|5051805|emb|CAB45034.1| putative WD-repeat containing protein...    98   3e-19
gi|12846941|dbj|BAB27371.1| unnamed protein product [Mus musculus]     98   3e-19
gi|15240036|ref|NP_199205.1| transducin family protein / WD-40 r...    98   3e-19
gi|2104937|gb|AAC63098.1| truncated form platelet-activating fac...    98   3e-19
gi|41152229|ref|NP_958502.1| platelet-activating factor acetylhy...    97   4e-19
gi|14042835|dbj|BAB55412.1| unnamed protein product [Homo sapiens]     97   4e-19
gi|27686925|ref|XP_226713.1| similar to hypothetical protein FLJ...    97   6e-19
gi|10177204|dbj|BAB10306.1| unnamed protein product [Arabidopsis...    97   6e-19
gi|31377770|ref|NP_056241.2| DKFZP434C245 protein [Homo sapiens]...    97   6e-19
gi|31241187|ref|XP_321024.1| ENSANGP00000011207 [Anopheles gambi...    97   6e-19
gi|48894805|ref|ZP_00327914.1| COG2319: FOG: WD40 repeat [Tricho...    97   6e-19
gi|11875643|gb|AAG40737.1| Bap1 [Myxococcus xanthus]                   97   6e-19
gi|47212444|emb|CAG11397.1| unnamed protein product [Tetraodon n...    97   7e-19
gi|18418034|ref|NP_567896.1| WD-40 repeat family protein (LEUNIG...    97   7e-19
gi|11141605|gb|AAG32022.1| LEUNIG [Arabidopsis thaliana]               97   7e-19
gi|48895476|ref|ZP_00328460.1| COG2319: FOG: WD40 repeat [Tricho...    97   7e-19
gi|41152231|ref|NP_958503.1| platelet-activating factor acetylhy...    96   1e-18
gi|11066216|gb|AAG28504.1| TUPA [Emericella nidulans]                  96   1e-18
gi|49098364|ref|XP_410642.1| hypothetical protein AN6505.2 [Aspe...    96   1e-18
gi|11346447|pir||T43158 probable GTP-binding protein beta chain ...    96   1e-18
gi|47213466|emb|CAG12309.1| unnamed protein product [Tetraodon n...    96   1e-18
gi|29465691|gb|AAL99251.1| TupA protein [Penicillium marneffei]        96   1e-18
gi|449693|prf||1919424A Miller-Dieker lissencephaly gene               96   1e-18
gi|19113785|ref|NP_592873.1| WD repeat protein; related to tup1 ...    96   1e-18
gi|37521813|ref|NP_925190.1| WD-repeat protein [Gloeobacter viol...    96   1e-18
gi|31212769|ref|XP_315369.1| ENSANGP00000020955 [Anopheles gambi...    96   1e-18
gi|47216472|emb|CAG02123.1| unnamed protein product [Tetraodon n...    96   2e-18
gi|50258634|gb|EAL21321.1| hypothetical protein CNBD3750 [Crypto...    96   2e-18
gi|38683868|ref|NP_060444.2| APG16 autophagy 16-like isoform 2; ...    96   2e-18
gi|50309993|ref|XP_455010.1| unnamed protein product [Kluyveromy...    96   2e-18
gi|47215541|emb|CAG06271.1| unnamed protein product [Tetraodon n...    96   2e-18
gi|31742530|ref|NP_110430.4| APG16 autophagy 16-like isoform 1; ...    96   2e-18
gi|7479150|pir||T42045 beta transducin-like protein homolog - St...    96   2e-18
gi|50425399|ref|XP_461293.1| unnamed protein product [Debaryomyc...    96   2e-18
gi|48735323|gb|AAH71846.1| APG16L protein [Homo sapiens]               96   2e-18
gi|17563260|ref|NP_506421.1| Suppressor/Enhancer of Lin-12 SEL-1...    95   2e-18
gi|47085759|ref|NP_998214.1| zgc:56055 [Danio rerio] >gnl|BL_ORD...    95   2e-18
gi|30681779|ref|NP_172528.2| transducin family protein / WD-40 r...    95   2e-18
gi|25402606|pir||C86239 protein T10O24.21 [imported] - Arabidops...    95   2e-18
gi|7504252|pir||T22703 hypothetical protein F55B12.3 - Caenorhab...    95   2e-18
gi|14530480|emb|CAC42307.1| C. elegans SEL-10 protein (correspon...    95   2e-18
gi|27804457|gb|AAO22525.1| leunig [Brassica rapa subsp. pekinensis]    95   3e-18
gi|50413165|ref|XP_457216.1| unnamed protein product [Debaryomyc...    95   3e-18
gi|17137500|ref|NP_477329.1| CG4063-PA [Drosophila melanogaster]...    94   4e-18
gi|39590492|emb|CAE66232.1| Hypothetical protein CBG11475 [Caeno...    94   4e-18
gi|28828113|gb|AAO50796.1| similar to Anabaena sp. (strain PCC 7...    94   5e-18
gi|46439984|gb|EAK99295.1| hypothetical protein CaO19.2559 [Cand...    94   5e-18
gi|18403052|ref|NP_565749.1| WD-40 repeat family protein [Arabid...    94   5e-18
gi|49073338|ref|XP_400895.1| hypothetical protein UM03280.1 [Ust...    94   5e-18
gi|31226862|ref|XP_317781.1| ENSANGP00000022244 [Anopheles gambi...    94   5e-18
gi|30685408|ref|NP_850195.1| WD-40 repeat family protein [Arabid...    94   5e-18
gi|48097023|ref|XP_393667.1| similar to ENSANGP00000022244 [Apis...    94   5e-18
gi|21222277|ref|NP_628056.1| putative WD-40 repeat protein [Stre...    94   5e-18
gi|4559414|gb|AAD23059.1| LIS [Mus musculus]                           94   6e-18
gi|15150805|ref|NP_150600.1| transducin beta-like 1Y; transducin...    94   6e-18
gi|31210799|ref|XP_314366.1| ENSANGP00000001275 [Anopheles gambi...    94   6e-18
gi|45201072|ref|NP_986642.1| AGL024Wp [Eremothecium gossypii] >g...    94   6e-18
gi|34534989|dbj|BAC87175.1| unnamed protein product [Homo sapiens]     93   8e-18
gi|48104900|ref|XP_395863.1| similar to CG31132-PA [Apis mellifera]    93   8e-18
gi|48100231|ref|XP_392611.1| similar to TUWD12 [Apis mellifera]        93   8e-18
gi|50306847|ref|XP_453399.1| unnamed protein product [Kluyveromy...    93   8e-18
gi|26354532|dbj|BAC40894.1| unnamed protein product [Mus musculus]     93   8e-18
gi|19527184|ref|NP_598727.1| TAF5-like RNA polymerase II, p300/C...    93   8e-18
gi|23123730|ref|ZP_00105782.1| COG2319: FOG: WD40 repeat [Nostoc...    93   8e-18
gi|34851989|ref|XP_226577.2| similar to RIKEN cDNA 1110005N04 [R...    93   8e-18
gi|45200863|ref|NP_986433.1| AGL234Wp [Eremothecium gossypii] >g...    93   1e-17
gi|3122317|sp|P90648|KMHB_DICDI Myosin heavy chain kinase B (MHC...    93   1e-17
gi|18676759|dbj|BAB85020.1| unnamed protein product [Homo sapiens]     92   1e-17
gi|9931971|gb|AAB81475.2| general transcriptional repressor Tup1...    92   1e-17
gi|39545918|gb|AAR28022.1| TAF5 [Arabidopsis thaliana]                 92   1e-17
gi|34855547|ref|XP_345196.1| similar to nuclear receptor co-repr...    92   1e-17
gi|12840673|dbj|BAB24913.1| unnamed protein product [Mus musculu...    92   1e-17
gi|46439635|gb|EAK98951.1| hypothetical protein CaO19.10786 [Can...    92   1e-17
gi|19113822|ref|NP_592910.1| general transcriptional repressor t...    92   1e-17
gi|18139935|gb|AAL60198.1| WD40-repeat-containing protein [Chlam...    92   1e-17
gi|32411159|ref|XP_326060.1| hypothetical protein [Neurospora cr...    92   1e-17
gi|2494901|sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 ...    92   1e-17
gi|12006108|gb|AAG44738.1| IRA1 [Mus musculus]                         92   1e-17
gi|10434648|dbj|BAB14331.1| unnamed protein product [Homo sapiens]     92   1e-17
gi|31543001|ref|NP_109657.2| IRA1 protein [Mus musculus] >gnl|BL...    92   1e-17
gi|19913371|ref|NP_078941.2| nuclear receptor co-repressor/HDAC3...    92   1e-17
gi|27777650|ref|NP_084122.2| APG16L beta isoform; autophagy 16-l...    92   2e-17
gi|27552519|dbj|BAC55091.1| Apg16L beta [Mus musculus]                 92   2e-17
gi|50294333|ref|XP_449578.1| unnamed protein product [Candida gl...    92   2e-17
gi|45184880|ref|NP_982598.1| AAR057Wp [Eremothecium gossypii] >g...    92   2e-17
gi|50729466|ref|XP_425517.1| PREDICTED: similar to guanine nucle...    92   2e-17
gi|48115068|ref|XP_396382.1| similar to EG:25E8.3 [Apis mellifera]     92   2e-17
gi|50741419|ref|XP_419579.1| PREDICTED: similar to TAF5-like RNA...    92   2e-17
gi|29144977|gb|AAH49122.1| Apg16l protein [Mus musculus]               92   2e-17
gi|27552521|dbj|BAC55092.1| Apg16L gamma [Mus musculus]                92   2e-17
gi|50797401|ref|XP_423947.1| PREDICTED: similar to nuclear recep...    92   2e-17
gi|27552517|dbj|BAC55090.1| Apg16L alpha [Mus musculus]                92   2e-17
gi|12006104|gb|AAG44736.1| IRA1 [Homo sapiens]                         92   2e-17
gi|3646272|emb|CAA08816.1| putative transcription factor [Homo s...    92   2e-17
gi|41393099|ref|NP_958875.1| PRP19/PSO4 homolog; PRP19/PSO4 homo...    92   2e-17
gi|23129787|ref|ZP_00111610.1| COG2319: FOG: WD40 repeat [Nostoc...    92   2e-17
gi|11055998|ref|NP_067642.1| guanine nucleotide-binding protein,...    92   2e-17
gi|349828|gb|AAA02882.1| Miller-Dieker lissencephaly protein           92   2e-17
gi|1705681|sp|P53699|CDC4_CANAL Cell division control protein 4 ...    92   2e-17
gi|34880600|ref|XP_346308.1| similar to RIKEN cDNA 1110005N04 [R...    92   2e-17
gi|7657439|ref|NP_055224.1| PCAF associated factor 65 beta; TAF5...    92   2e-17
gi|50311047|ref|XP_455547.1| TUP1_KLULA [Kluyveromyces lactis] >...    92   2e-17
gi|2494900|sp|P56094|TUP1_KLULA Transcriptional repressor TUP1 >...    92   2e-17
gi|48097292|ref|XP_391870.1| similar to ENSANGP00000017965 [Apis...    92   2e-17
gi|21674797|ref|NP_662862.1| WD-repeat family protein [Chlorobiu...    91   3e-17
gi|26326543|dbj|BAC27015.1| unnamed protein product [Mus musculus]     91   3e-17
gi|33468969|ref|NP_065626.1| transducin (beta)-like 1 X-linked; ...    91   3e-17
gi|48893580|ref|ZP_00326778.1| COG2319: FOG: WD40 repeat [Tricho...    91   3e-17
gi|28849825|gb|AAO46882.1| heterotrimeric guanine nucleotide-bin...    91   3e-17
gi|50285811|ref|XP_445334.1| unnamed protein product [Candida gl...    91   3e-17
gi|2494906|sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding prote...    91   3e-17
gi|13471938|ref|NP_103505.1| probable transcriptional repressor ...    91   3e-17
gi|39596796|emb|CAE59023.1| Hypothetical protein CBG02300 [Caeno...    91   3e-17
gi|49119215|gb|AAH73215.1| Unknown (protein for MGC:80502) [Xeno...    91   3e-17
gi|31322517|gb|AAP20646.1| nuclear receptor co-repressor complex...    91   3e-17
gi|26331128|dbj|BAC29294.1| unnamed protein product [Mus musculus]     91   3e-17
gi|34863779|ref|XP_219965.2| similar to RIKEN cDNA 6330528C20 ge...    91   4e-17
gi|45525517|ref|ZP_00176748.1| COG2319: FOG: WD40 repeat [Crocos...    91   4e-17
gi|46439108|gb|EAK98430.1| hypothetical protein CaO19.536 [Candi...    91   4e-17
gi|30354079|gb|AAH52268.1| TAF5 protein [Homo sapiens]                 91   4e-17
gi|7657381|ref|NP_055317.1| PRP19/PSO4 homolog; nuclear matrix p...    91   4e-17
gi|1491718|emb|CAA64777.1| hTAFII100 [Homo sapiens]                    91   4e-17
gi|28893469|ref|NP_796316.1| TAF5 RNA polymerase II, TATA box bi...    91   4e-17
gi|1732075|gb|AAC50902.1| TBP-associated factor [Homo sapiens]         91   4e-17
gi|47117222|sp|Q8C092|TAF5_MOUSE Transcription initiation factor...    91   4e-17
gi|32406548|ref|XP_323887.1| hypothetical protein [Neurospora cr...    91   4e-17
gi|48854377|ref|ZP_00308540.1| COG2319: FOG: WD40 repeat [Cytoph...    91   4e-17
gi|19075884|ref|NP_588384.1| notchless-like; WD repeat protein [...    91   4e-17
gi|48838134|ref|ZP_00295082.1| COG2319: FOG: WD40 repeat [Methan...    91   4e-17
gi|21071067|ref|NP_008882.2| TBP-associated factor 5; TATA box b...    91   4e-17
gi|6686341|sp|Q15542|TAF5_HUMAN Transcription initiation factor ...    91   4e-17
gi|47215488|emb|CAG01596.1| unnamed protein product [Tetraodon n...    91   5e-17
gi|47209012|emb|CAF91370.1| unnamed protein product [Tetraodon n...    91   5e-17
gi|17933598|ref|NP_525090.1| CG10545-PA [Drosophila melanogaster...    91   5e-17
gi|9955107|pdb|1ERJ|A Chain A, Crystal Structure Of The C-Termin...    91   5e-17
gi|49098124|ref|XP_410522.1| hypothetical protein AN6385.2 [Aspe...    91   5e-17
gi|173067|gb|AAA35182.1| TUP1 protein                                  91   5e-17
gi|7512942|pir||T17256 hypothetical protein DKFZp586O1922.1 - hu...    90   7e-17
gi|31223622|ref|XP_317330.1| ENSANGP00000010549 [Anopheles gambi...    90   7e-17
gi|30689741|ref|NP_197897.2| transducin family protein / WD-40 r...    90   7e-17
gi|33772117|gb|AAQ54495.1| transducin-like [Malus x domestica]         90   7e-17
gi|48894581|ref|ZP_00327690.1| COG2319: FOG: WD40 repeat [Tricho...    90   7e-17
gi|32406078|ref|XP_323652.1| hypothetical protein [Neurospora cr...    90   7e-17
gi|28950172|emb|CAD71040.1| related to NUCLEAR MIGRATION PROTEIN...    90   7e-17
gi|6319926|ref|NP_010007.1| General repressor of transcription (...    90   9e-17
gi|4460|emb|CAA34411.1| unnamed protein product [Saccharomyces c...    90   9e-17
gi|26327737|dbj|BAC27612.1| unnamed protein product [Mus musculus]     90   9e-17
gi|50543494|ref|XP_499913.1| hypothetical protein [Yarrowia lipo...    90   9e-17
gi|49083960|ref|XP_404218.1| GBB_CRYPA Guanine nucleotide-bindin...    90   9e-17
gi|31542899|ref|NP_038559.2| guanine nucleotide-binding protein,...    90   9e-17
gi|71874|pir||RGMSB4 GTP-binding regulatory protein beta-4 chain...    90   9e-17
gi|45359810|gb|AAS59142.1| G-protein beta 4 subunit [Rattus norv...    90   9e-17
gi|17551444|ref|NP_508768.1| Apg16L beta (XF78) [Caenorhabditis ...    90   9e-17
gi|38111876|gb|EAA57376.1| hypothetical protein MG08345.4 [Magna...    90   9e-17
gi|49523567|emb|CAF18245.1| STYLOSA protein [Antirrhinum majus]        90   9e-17
gi|28572022|ref|NP_733312.2| CG31033-PB [Drosophila melanogaster...    89   1e-16
gi|31240845|ref|XP_320836.1| ENSANGP00000017965 [Anopheles gambi...    89   1e-16
gi|26345812|dbj|BAC36557.1| unnamed protein product [Mus musculus]     89   1e-16
gi|28572020|ref|NP_733311.2| CG31033-PA [Drosophila melanogaster...    89   1e-16
gi|23130358|ref|ZP_00112175.1| COG2319: FOG: WD40 repeat [Nostoc...    89   1e-16
gi|47226994|emb|CAG05886.1| unnamed protein product [Tetraodon n...    89   1e-16
gi|3493539|gb|AAC33436.1| G-protein beta subunit [Emericella nid...    89   1e-16
gi|26338912|dbj|BAC33127.1| unnamed protein product [Mus musculus]     89   1e-16
gi|33416638|gb|AAH55978.1| Loc60449-prov protein [Xenopus laevis]      89   1e-16
gi|41054115|ref|NP_956146.1| Unknown (protein for MGC:63765); wu...    89   1e-16
gi|28572018|ref|NP_733313.2| CG31033-PC [Drosophila melanogaster...    89   1e-16
gi|19527358|ref|NP_598890.1| nuclear matrix protein SNEV [Mus mu...    89   1e-16
gi|11127729|gb|AAG31061.1| G-protein B3 subunit [Ambystoma tigri...    89   2e-16
gi|33585633|gb|AAH56002.1| Gnb3-prov protein [Xenopus laevis]          89   2e-16
gi|11127727|gb|AAG31060.1| G-protein B1 subunit [Ambystoma tigri...    89   2e-16
gi|3023838|sp|P79959|GBB1_XENLA Guanine nucleotide-binding prote...    89   2e-16
gi|49899896|gb|AAH76910.1| Unknown (protein for MGC:89081) [Xeno...    89   2e-16
gi|50545019|ref|XP_500061.1| YlTUP1 [Yarrowia lipolytica] >gnl|B...    89   2e-16
gi|49071468|ref|XP_400023.1| hypothetical protein UM02408.1 [Ust...    89   2e-16
gi|17534937|ref|NP_495299.1| Apg16L beta (2G742) [Caenorhabditis...    89   2e-16
gi|31237851|ref|XP_319677.1| ENSANGP00000021381 [Anopheles gambi...    89   2e-16
gi|49522519|gb|AAH75582.1| Unknown (protein for MGC:89568) [Xeno...    89   2e-16
gi|1903291|emb|CAA98718.1| COP1 [Saccharomyces cerevisiae]             89   2e-16
gi|23956326|ref|NP_705783.1| H326 [Mus musculus] >gnl|BL_ORD_ID|...    89   2e-16
gi|45526977|ref|ZP_00178178.1| COG2319: FOG: WD40 repeat [Crocos...    89   2e-16
gi|47847396|dbj|BAD21370.1| mFLJ00045 protein [Mus musculus]           89   2e-16
gi|6320056|ref|NP_010136.1| Alpha subunit of COPI vesicle coatom...    89   2e-16
gi|633648|emb|CAA58712.1| alpha-COP [Saccharomyces cerevisiae] >...    89   2e-16
gi|34853578|ref|XP_213170.2| similar to guanine nucleotide-bindi...    89   2e-16
gi|31214985|ref|XP_315941.1| ENSANGP00000014117 [Anopheles gambi...    89   2e-16
gi|34855811|ref|XP_218509.2| hypothetical protein XP_218509 [Rat...    89   2e-16
gi|24649631|ref|NP_732982.1| CG31132-PA [Drosophila melanogaster...    89   2e-16
gi|46561762|gb|AAT01086.1| putative activated protein kinase C r...    89   2e-16
gi|47221781|emb|CAG08835.1| unnamed protein product [Tetraodon n...    89   2e-16
gi|23479901|gb|EAA16609.1| hypothetical protein [Plasmodium yoel...    89   2e-16
gi|47214090|emb|CAF95347.1| unnamed protein product [Tetraodon n...    89   2e-16
gi|339937|gb|AAA63265.1| transducin beta-1 subunit                     88   3e-16
gi|3387984|gb|AAC28655.1| beta-subunit signal transducing protei...    88   3e-16
gi|49257618|gb|AAH74250.1| Unknown (protein for MGC:84000) [Xeno...    88   3e-16
gi|6680045|ref|NP_032168.1| guanine nucleotide-binding protein, ...    88   3e-16
gi|4139469|pdb|1A0R|B Chain B, Heterotrimeric Complex Of Phosduc...    88   3e-16
gi|50752442|ref|XP_422782.1| PREDICTED: similar to guanine nucle...    88   3e-16
gi|28461181|ref|NP_786971.1| guanine nucleotide binding protein ...    88   3e-16
gi|38104383|gb|EAA50960.1| hypothetical protein MG04719.4 [Magna...    88   3e-16
gi|17533647|ref|NP_494926.1| g-protein beta WD-40 repeat (2F320)...    88   3e-16
gi|627169|pir||S33263 transcription initiation factor IID-associ...    88   3e-16
gi|17136870|ref|NP_476957.1| CG7704-PA [Drosophila melanogaster]...    88   3e-16
gi|15451370|dbj|BAB64489.1| hypothetical protein [Macaca fascicu...    88   3e-16
gi|15451392|dbj|BAB64500.1| hypothetical protein [Macaca fascicu...    88   3e-16
gi|458692|gb|AAA16607.1| homologous to mouse gene PC326:GenBank ...    88   3e-16
gi|30089954|ref|NP_056541.2| H326 [Homo sapiens]                       88   3e-16
gi|33146605|dbj|BAC79801.1| putative TATA box binding protein-as...    88   3e-16
gi|34877003|ref|XP_343610.1| similar to RIKEN cDNA 4933429D11 [R...    88   3e-16
gi|50256900|gb|EAL19618.1| hypothetical protein CNBG2460 [Crypto...    88   3e-16
gi|1730218|sp|Q08706|GBB_LYMST Guanine nucleotide-binding protei...    88   3e-16
gi|47847864|dbj|BAD21657.1| putative LEUNIG [Oryza sativa (japon...    88   3e-16
gi|24584567|ref|NP_609782.2| CG4935-PA [Drosophila melanogaster]...    88   3e-16
gi|49076806|ref|XP_402338.1| hypothetical protein UM04723.1 [Ust...    88   3e-16
gi|49088728|ref|XP_406158.1| hypothetical protein AN2021.2 [Aspe...    88   3e-16
gi|12652731|gb|AAH00115.1| Guanine nucleotide-binding protein, b...    88   3e-16
gi|3913720|sp|O45040|GBB1_HOMAM Guanine nucleotide-binding prote...    88   3e-16
gi|27597250|dbj|BAC55158.1| guanine nucleotide-binding protein b...    88   3e-16
gi|31214992|ref|XP_315942.1| ENSANGP00000014177 [Anopheles gambi...    88   3e-16
gi|71875|pir||RGKWB GTP-binding regulatory protein beta chain - ...    88   3e-16
gi|23503100|sp|O60907|TBLX_HUMAN F-box-like/WD-repeat protein TB...    88   3e-16
gi|17534675|ref|NP_496508.1| G Protein, Beta subunit (37.4 kD) (...    88   3e-16
gi|17555848|ref|NP_499518.1| coatomer (3M811) [Caenorhabditis el...    88   3e-16
gi|1170675|sp|P42527|KMHA_DICDI Myosin heavy chain kinase A (MHC...    88   3e-16
gi|17559120|ref|NP_505763.1| pleiotropic regulator 1 Arabidopsis...    88   3e-16
gi|42659259|ref|XP_376909.1| similar to hypothetical protein FLJ...    88   3e-16
gi|5032159|ref|NP_005638.1| transducin beta-like 1X; transducin ...    88   3e-16
gi|19114222|ref|NP_593310.1| F-box protein [Schizosaccharomyces ...    88   3e-16
gi|31215754|ref|XP_316089.1| ENSANGP00000005867 [Anopheles gambi...    87   5e-16
gi|34854574|ref|XP_218024.2| similar to RIKEN cDNA 1110005N04 [R...    87   5e-16
gi|21326455|ref|NP_647549.1| neuronal differentiation-related ge...    87   5e-16
gi|50759201|ref|XP_417564.1| PREDICTED: similar to beta 1 subuni...    87   5e-16
gi|47087315|ref|NP_998646.1| guanine nucleotide binding protein ...    87   5e-16
gi|47086811|ref|NP_997774.1| guanine nucleotide binding protein ...    87   5e-16
gi|45190337|ref|NP_984591.1| AEL269Cp [Eremothecium gossypii] >g...    87   5e-16
gi|50543284|ref|XP_499808.1| hypothetical protein [Yarrowia lipo...    87   5e-16
gi|24652663|ref|NP_725018.1| CG9062-PB [Drosophila melanogaster]...    87   5e-16
gi|25012800|gb|AAN71491.1| RE72568p [Drosophila melanogaster]          87   5e-16
gi|38110722|gb|EAA56401.1| hypothetical protein MG06372.4 [Magna...    87   6e-16
gi|39593406|emb|CAE64876.1| Hypothetical protein CBG09688 [Caeno...    87   6e-16
gi|48104663|ref|XP_392962.1| similar to putative activated prote...    87   6e-16
gi|4504053|ref|NP_002066.1| guanine nucleotide-binding protein, ...    87   6e-16
gi|20257506|gb|AAM15922.1| guanine nucleotide binding protein be...    87   6e-16
gi|13591874|ref|NP_112249.1| guanine nucleotide-binding protein,...    87   6e-16
gi|50545651|ref|XP_500364.1| hypothetical protein [Yarrowia lipo...    87   6e-16
gi|19112019|ref|NP_595227.1| WD repeat protein [Schizosaccharomy...    87   6e-16
gi|37521199|ref|NP_924576.1| WD-40 repeat protein [Gloeobacter v...    87   6e-16
gi|23126511|ref|ZP_00108404.1| COG2319: FOG: WD40 repeat [Nostoc...    87   6e-16
gi|10178281|emb|CAC08339.1| katanin p80 subunit-like protein [Ar...    87   8e-16
gi|50286567|ref|XP_445712.1| unnamed protein product [Candida gl...    87   8e-16
gi|26788037|emb|CAD58749.1| SI:dZ234G15.7 (novel protein similar...    87   8e-16
gi|3023850|sp|O42249|GBLP_ORENI Guanine nucleotide-binding prote...    87   8e-16
gi|37498964|gb|AAQ91574.1| receptor for activated protein kinase...    87   8e-16
gi|18859301|ref|NP_571519.1| guanine nucleotide binding protein ...    87   8e-16
gi|18415801|ref|NP_568194.1| transducin family protein / WD-40 r...    87   8e-16
gi|50292381|ref|XP_448623.1| unnamed protein product [Candida gl...    87   8e-16
gi|31198029|ref|XP_307962.1| ENSANGP00000013415 [Anopheles gambi...    87   8e-16


>gi|17505659|ref|NP_491325.1| u5 snRNP-specific protein (36.8 kD)
           (1E771) [Caenorhabditis elegans]
 gi|14573841|gb|AAK68197.1| Hypothetical protein C18E3.5
           [Caenorhabditis elegans]
          Length = 331

 Score =  678 bits (1750), Expect = 0.0
 Identities = 331/331 (100%), Positives = 331/331 (100%)
 Frame = +1

Query: 1   MAMVIPARNQMASQFLELPKRTSSLMAPTMVLQGHGGEIYTSQFSSDGSFLASAGYDQQI 180
           MAMVIPARNQMASQFLELPKRTSSLMAPTMVLQGHGGEIYTSQFSSDGSFLASAGYDQQI
Sbjct: 1   MAMVIPARNQMASQFLELPKRTSSLMAPTMVLQGHGGEIYTSQFSSDGSFLASAGYDQQI 60

Query: 181 FLWNVFGECENFAVLKGHKGAIMEVKFNADSSHLVSAGTDKTVRVWDMETGSCIRNFKSH 360
           FLWNVFGECENFAVLKGHKGAIMEVKFNADSSHLVSAGTDKTVRVWDMETGSCIRNFKSH
Sbjct: 61  FLWNVFGECENFAVLKGHKGAIMEVKFNADSSHLVSAGTDKTVRVWDMETGSCIRNFKSH 120

Query: 361 TDIVNSVDVNRRGPQMICSASDDGTVMVHDMRSKEAAKKFICKYQQTAVTFNDAADNVIC 540
           TDIVNSVDVNRRGPQMICSASDDGTVMVHDMRSKEAAKKFICKYQQTAVTFNDAADNVIC
Sbjct: 121 TDIVNSVDVNRRGPQMICSASDDGTVMVHDMRSKEAAKKFICKYQQTAVTFNDAADNVIC 180

Query: 541 GGIDNQIKVWDMLRNDVRYVLSGHRDTITSLSVSHNGNFLLSNSMDCSLMSWDIRPFVPA 720
           GGIDNQIKVWDMLRNDVRYVLSGHRDTITSLSVSHNGNFLLSNSMDCSLMSWDIRPFVPA
Sbjct: 181 GGIDNQIKVWDMLRNDVRYVLSGHRDTITSLSVSHNGNFLLSNSMDCSLMSWDIRPFVPA 240

Query: 721 QRLVARYQGASHNFEKNLLKCGWSPRDNYITAGSADRFVYVWNAKSRACVYKLPGHLGSV 900
           QRLVARYQGASHNFEKNLLKCGWSPRDNYITAGSADRFVYVWNAKSRACVYKLPGHLGSV
Sbjct: 241 QRLVARYQGASHNFEKNLLKCGWSPRDNYITAGSADRFVYVWNAKSRACVYKLPGHLGSV 300

Query: 901 NCTALHPTQQILLSAGSDKTIFLGELDLEDY 993
           NCTALHPTQQILLSAGSDKTIFLGELDLEDY
Sbjct: 301 NCTALHPTQQILLSAGSDKTIFLGELDLEDY 331




[DB home][top]