Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C18A3_4
(1227 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17531965|ref|NP_495121.1| tia-1 family member (45.2 kD) (2G2)... 632 e-180
gi|7446337|pir||T15542 hypothetical protein C18A3.5 - Caenorhabd... 613 e-174
gi|39596949|emb|CAE59176.1| Hypothetical protein CBG02484 [Caeno... 571 e-161
gi|17531963|ref|NP_495120.1| RNA-binding region RNP-1 family mem... 552 e-156
gi|39592368|emb|CAE63445.1| Hypothetical protein CBG07904 [Caeno... 429 e-119
gi|32564504|ref|NP_495123.2| RNA-binding region RNP-1 family mem... 422 e-116
gi|17537143|ref|NP_496718.1| tia-1 family member (2N61) [Caenorh... 409 e-113
gi|32564506|ref|NP_871980.1| tia-1 (32.6 kD) (2G2) [Caenorhabdit... 403 e-111
gi|48102436|ref|XP_395357.1| similar to TIA-1 homologue [Apis me... 298 1e-79
gi|38141765|dbj|BAD00701.1| TIA-1 homologue [Bombyx mori] 292 1e-77
gi|10801574|dbj|BAB16700.1| TIA-1 like protein [Bombyx mori] 291 2e-77
gi|31207333|ref|XP_312633.1| ENSANGP00000015348 [Anopheles gambi... 281 2e-74
gi|17944383|gb|AAL48083.1| RE71384p [Drosophila melanogaster] 277 4e-73
gi|24649519|ref|NP_732945.1| CG5422-PD [Drosophila melanogaster]... 277 4e-73
gi|24649513|ref|NP_732942.1| CG5422-PB [Drosophila melanogaster]... 277 4e-73
gi|37681959|gb|AAQ97857.1| TIA1 cytotoxic granule-associated RNA... 274 4e-72
gi|28883273|gb|AAO49720.1| TIA-1 [Gallus gallus] 273 5e-72
gi|11863161|ref|NP_071320.1| TIA1 protein isoform 1; TIA1 cytoto... 273 5e-72
gi|41055734|ref|NP_956476.1| TIA1 cytotoxic granule-associated R... 273 8e-72
gi|47086779|ref|NP_997793.1| TIA1 cytotoxic granule-associated R... 272 1e-71
gi|28386187|gb|AAH46812.1| Tia1 protein [Mus musculus] 272 1e-71
gi|542588|pir||S41644 polyadenylate-binding protein - fruit fly ... 271 2e-71
gi|34856361|ref|XP_232139.2| similar to Tia1 protein [Rattus nor... 271 2e-71
gi|4507499|ref|NP_003243.1| TIA1 cytotoxic granule-associated RN... 268 3e-70
gi|14714709|gb|AAH10496.1| Tial1 protein [Mus musculus] 268 3e-70
gi|41054740|ref|NP_957426.1| similar to TIA1 cytotoxic granule-a... 267 4e-70
gi|11863163|ref|NP_071505.1| TIA1 protein isoform 2; TIA1 cytoto... 266 1e-69
gi|6094480|sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 (RNA-binding p... 266 1e-69
gi|6755783|ref|NP_035715.1| cytotoxic granule-associated RNA bin... 265 2e-69
gi|45361397|ref|NP_989276.1| hypothetical protein MGC75625 [Xeno... 263 5e-69
gi|16215602|emb|CAC95017.1| TIAR protein [Xenopus laevis] 262 1e-68
gi|45383446|ref|NP_989687.1| TIA1 cytotoxic granule-associated R... 261 2e-68
gi|6678349|ref|NP_033409.1| Tial1 cytotoxic granule-associated R... 261 2e-68
gi|16215606|emb|CAC95018.1| TIA-1 protein [Xenopus laevis] 260 4e-68
gi|50416510|gb|AAH77169.1| Unknown (protein for MGC:78766) [Xeno... 260 4e-68
gi|27924240|gb|AAH45086.1| Tia1 protein [Xenopus laevis] 260 5e-68
gi|47228429|emb|CAG05249.1| unnamed protein product [Tetraodon n... 258 3e-67
gi|47217530|emb|CAG02457.1| unnamed protein product [Tetraodon n... 257 4e-67
gi|26390405|dbj|BAC25892.1| unnamed protein product [Mus musculus] 256 8e-67
gi|34859375|ref|XP_341938.1| similar to RNA binding protein TIAR... 253 5e-66
gi|23271442|gb|AAH23813.1| Tia1 protein [Mus musculus] 248 3e-64
gi|13435394|ref|NP_071728.1| TIA1 cytotoxic granule-associated R... 237 4e-61
gi|49086348|ref|XP_405228.1| hypothetical protein AN1091.2 [Aspe... 218 2e-55
gi|38110755|gb|EAA56429.1| hypothetical protein MG06400.4 [Magna... 216 7e-55
gi|41581275|emb|CAE47924.1| oligouridylate binding protein, puta... 216 7e-55
gi|46122079|ref|XP_385593.1| conserved hypothetical protein [Gib... 215 2e-54
gi|32416204|ref|XP_328580.1| hypothetical protein [Neurospora cr... 213 7e-54
gi|48094568|ref|XP_392148.1| similar to CG7757-PA [Apis mellifera] 211 3e-53
gi|39585450|emb|CAE70533.1| Hypothetical protein CBG17168 [Caeno... 209 1e-52
gi|24650782|ref|NP_651609.1| CG12870-PA [Drosophila melanogaster... 206 9e-52
gi|17550216|ref|NP_509705.1| predicted CDS, cytotoxic granule-as... 206 1e-51
gi|50258729|gb|EAL21414.1| hypothetical protein CNBD1090 [Crypto... 203 8e-51
gi|16198525|gb|AAH15944.1| TIA1 protein [Homo sapiens] 191 2e-47
gi|42408523|dbj|BAD09702.1| putative oligouridylate binding prot... 179 2e-43
gi|23237933|dbj|BAC16506.1| putative oligouridylate binding prot... 176 1e-42
gi|15221031|ref|NP_175810.1| oligouridylate-binding protein, put... 176 1e-42
gi|15231783|ref|NP_188026.1| oligouridylate-binding protein, put... 173 8e-42
gi|21593280|gb|AAM65229.1| oligouridylate binding protein, putat... 173 8e-42
gi|30695647|ref|NP_849806.1| oligouridylate-binding protein, put... 170 7e-41
gi|6996560|emb|CAB75429.1| oligouridylate binding protein [Nicot... 169 9e-41
gi|17531967|ref|NP_495122.1| rox8 like (2G2) [Caenorhabditis ele... 168 2e-40
gi|18394471|ref|NP_564018.1| oligouridylate-binding protein, put... 166 8e-40
gi|45872602|gb|AAH68194.1| Tial1 protein [Mus musculus] 164 4e-39
gi|22208507|gb|AAM94322.1| putative oligouridylate binding prote... 161 3e-38
gi|9663769|emb|CAC01238.1| RNA Binding Protein 47 [Nicotiana plu... 159 1e-37
gi|40804404|gb|AAR91698.1| DNA-binding protein [Lycopersicon esc... 159 1e-37
gi|23928438|gb|AAN40024.1| putative oligouridylate binding prote... 159 2e-37
gi|7489196|pir||T01932 RNA binding protein homolog - common toba... 159 2e-37
gi|7489112|pir||T03934 DNA binding protein ACBF - common tobacco... 159 2e-37
gi|34896988|ref|NP_909840.1| putative RNA binding protein [Oryza... 158 2e-37
gi|34901884|ref|NP_912288.1| putative RNA Binding Protein 45 [Or... 154 3e-36
gi|18423684|ref|NP_568815.1| RNA-binding protein 45 (RBP45), put... 154 5e-36
gi|9758270|dbj|BAB08769.1| unnamed protein product [Arabidopsis ... 154 5e-36
gi|7485342|pir||T04823 hypothetical protein F10M23.340 - Arabido... 151 3e-35
gi|18416906|ref|NP_567764.1| RNA-binding protein 45 (RBP45), put... 151 3e-35
gi|15239715|ref|NP_197436.1| RNA-binding protein 45 (RBP45), put... 150 6e-35
gi|9663767|emb|CAC01237.1| RNA Binding Protein 45 [Nicotiana plu... 147 7e-34
gi|40253807|dbj|BAD05744.1| putative RNA Binding Protein 45 [Ory... 146 9e-34
gi|46438281|gb|EAK97614.1| hypothetical protein CaO19.7368 [Cand... 145 2e-33
gi|39545835|emb|CAE04743.3| OSJNBb0060E08.6 [Oryza sativa (japon... 143 7e-33
gi|15221071|ref|NP_172630.1| RNA-binding protein 45 (RBP45), put... 142 2e-32
gi|30524689|emb|CAC85246.1| salt tolerance protein 6 [Beta vulga... 141 3e-32
gi|15222783|ref|NP_175383.1| RNA-binding protein 47 (RBP47), put... 141 4e-32
gi|15220241|ref|NP_175181.1| RNA-binding protein 47 (RBP47), put... 140 5e-32
gi|21618243|gb|AAM67293.1| nuclear acid binding protein, putativ... 140 6e-32
gi|15230291|ref|NP_188544.1| RNA-binding protein, putative [Arab... 140 6e-32
gi|9294614|dbj|BAB02953.1| DNA/RNA binding protein-like [Arabido... 140 6e-32
gi|45201486|ref|NP_987056.1| AGR390Cp [Eremothecium gossypii] >g... 140 8e-32
gi|25402821|pir||C86310 protein F1L3.2 [imported] - Arabidopsis ... 139 1e-31
gi|47216544|emb|CAG04722.1| unnamed protein product [Tetraodon n... 138 2e-31
gi|50408254|ref|XP_456766.1| unnamed protein product [Debaryomyc... 138 3e-31
gi|21592583|gb|AAM64532.1| putative DNA binding protein [Arabido... 137 4e-31
gi|38107608|gb|EAA53755.1| hypothetical protein MG09505.4 [Magna... 137 7e-31
gi|49134437|ref|XP_413227.1| hypothetical protein AN9090.2 [Aspe... 135 2e-30
gi|46128087|ref|XP_388597.1| hypothetical protein FG08421.1 [Gib... 135 2e-30
gi|38104685|gb|EAA51219.1| hypothetical protein MG08741.4 [Magna... 135 2e-30
gi|50289655|ref|XP_447259.1| unnamed protein product [Candida gl... 135 3e-30
gi|26401571|sp|O60176|YG41_SCHPO Hypothetical RNA-binding protei... 134 3e-30
gi|15220233|ref|NP_175180.1| RNA-binding protein 47 (RBP47), put... 134 3e-30
gi|32407122|ref|XP_324156.1| hypothetical protein [Neurospora cr... 134 4e-30
gi|41388837|gb|AAH65540.1| PABPC4 protein [Homo sapiens] 134 4e-30
gi|20867416|ref|XP_143201.1| similar to polyA-binding protein [M... 134 4e-30
gi|34870953|ref|XP_216517.2| similar to poly(A)-binding protein,... 134 4e-30
gi|48734702|gb|AAH71591.1| PABPC4 protein [Homo sapiens] 134 6e-30
gi|4504715|ref|NP_003810.1| poly A binding protein, cytoplasmic ... 134 6e-30
gi|6324312|ref|NP_014382.1| abundant mRNP-component protein hypo... 133 1e-29
gi|417556|sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadeny... 133 1e-29
gi|172438|gb|AAA02808.1| RNA-binding protein 133 1e-29
gi|27690704|ref|XP_227127.1| similar to Polyadenylate-binding pr... 132 2e-29
gi|22507391|ref|NP_683717.1| poly(A) binding protein, cytoplasmi... 131 3e-29
gi|32408935|ref|XP_324948.1| hypothetical protein [Neurospora cr... 131 3e-29
gi|34419622|ref|NP_570951.2| poly(A) binding protein, cytoplasmi... 131 3e-29
gi|13096978|gb|AAH03283.1| Poly(A) binding protein, cytoplasmic ... 131 3e-29
gi|25386576|pir||F96532 probable RNA binding protein [imported] ... 131 4e-29
gi|15594035|emb|CAC69852.1| nucleic acid binding protein [Nicoti... 131 4e-29
gi|46122719|ref|XP_385913.1| hypothetical protein FG05737.1 [Gib... 130 5e-29
gi|41152034|ref|NP_958453.1| poly(A) binding protein, cytoplasmi... 130 6e-29
gi|38091386|ref|XP_122209.4| similar to Poly(A) binding protein,... 129 1e-28
gi|34870050|ref|XP_213689.2| similar to poly(A)-binding protein,... 129 1e-28
gi|50725189|dbj|BAD33940.1| putative nucleic acid binding protei... 128 2e-28
gi|19526272|gb|AAL89666.1| polyA-binding protein [Takifugu rubri... 128 3e-28
gi|38345560|emb|CAE03434.2| OSJNBa0032F06.17 [Oryza sativa (japo... 127 4e-28
gi|38078078|ref|XP_124207.2| similar to Poly(A) binding protein,... 127 5e-28
gi|47219550|emb|CAG09904.1| unnamed protein product [Tetraodon n... 125 2e-27
gi|34860763|ref|XP_230831.2| similar to embryonic poly(A) bindin... 125 2e-27
gi|1616770|gb|AAB16848.1| putative poly(A)-binding protein FabM ... 125 2e-27
gi|49093352|ref|XP_408137.1| conserved hypothetical protein [Asp... 125 2e-27
gi|49073864|ref|XP_401109.1| hypothetical protein UM03494.1 [Ust... 125 3e-27
gi|6321013|ref|NP_011092.1| Poly(A) binding protein, cytoplasmic... 124 3e-27
gi|172092|gb|AAA34838.1| polyadenylate-binding protein 124 3e-27
gi|30682335|ref|NP_849641.1| RNA-binding protein 45 (RBP45), put... 124 5e-27
gi|47217896|emb|CAG05018.1| unnamed protein product [Tetraodon n... 124 5e-27
gi|38078076|ref|XP_355472.1| similar to Poly(A) binding protein,... 124 5e-27
gi|41053728|ref|NP_957176.1| poly A binding protein, cytoplasmic... 124 6e-27
gi|50426951|ref|XP_462076.1| unnamed protein product [Debaryomyc... 123 8e-27
gi|13540314|gb|AAK29408.1| embryonic poly(A) binding protein [Xe... 122 1e-26
gi|13560783|gb|AAK30205.1| poly(A)-binding protein [Daucus carota] 122 1e-26
gi|480602|pir||S37085 polyadenylate-binding protein - fern (Anem... 122 2e-26
gi|19347816|gb|AAL86321.1| putative poly(A)-binding protein [Ara... 122 2e-26
gi|1171978|sp|P42731|PAB2_ARATH Polyadenylate-binding protein 2 ... 122 2e-26
gi|49257242|gb|AAH71118.1| Unknown (protein for MGC:81363) [Xeno... 122 2e-26
gi|49899948|gb|AAH76956.1| Unknown (protein for MGC:89376) [Xeno... 122 2e-26
gi|7673355|gb|AAF66823.1| poly(A)-binding protein [Nicotiana tab... 122 2e-26
gi|129535|sp|P29341|PAB1_MOUSE Polyadenylate-binding protein 1 (... 120 5e-26
gi|30353795|gb|AAH52100.1| Pabpc1-prov protein [Xenopus laevis] 120 5e-26
gi|64970|emb|CAA40721.1| polyA binding protein [Xenopus laevis] 120 5e-26
gi|49118872|gb|AAH73435.1| Unknown (protein for MGC:80927) [Xeno... 120 7e-26
gi|19705459|ref|NP_599180.1| poly(A) binding protein, cytoplasmi... 120 7e-26
gi|31560656|ref|NP_032800.2| poly A binding protein, cytoplasmic... 120 7e-26
gi|26354649|dbj|BAC40951.1| unnamed protein product [Mus musculus] 120 9e-26
gi|50293737|ref|XP_449280.1| unnamed protein product [Candida gl... 120 9e-26
gi|45188180|ref|NP_984403.1| ADR307Wp [Eremothecium gossypii] >g... 120 9e-26
gi|38541222|gb|AAH62832.1| Unknown (protein for IMAGE:6997127) [... 119 1e-25
gi|47940242|gb|AAH72110.1| MGC79060 protein [Xenopus laevis] 119 1e-25
gi|7439965|pir||T00768 polyadenylate-binding protein T22J18.7 - ... 119 1e-25
gi|9930616|gb|AAG02117.1| poly(A) binding protein [Arabidopsis t... 119 1e-25
gi|15219945|ref|NP_173690.1| polyadenylate-binding protein 3 (PA... 119 1e-25
gi|6754972|ref|NP_035163.1| poly A binding protein, cytoplasmic ... 119 1e-25
gi|45201218|ref|NP_986788.1| AGR122Cp [Eremothecium gossypii] >g... 119 1e-25
gi|1082703|pir||S52491 polyadenylate binding protein II - human ... 119 1e-25
gi|41386798|ref|NP_776993.1| poly(A) binding protein, cytoplasmi... 119 1e-25
gi|50758679|ref|XP_417367.1| PREDICTED: similar to embryonic pol... 119 1e-25
gi|49903495|gb|AAH76931.1| Unknown (protein for MGC:89198) [Xeno... 119 2e-25
gi|46443173|gb|EAL02457.1| hypothetical protein CaO19.10555 [Can... 118 2e-25
gi|24650786|ref|NP_651611.1| CG4787-PA [Drosophila melanogaster]... 118 2e-25
gi|27730131|ref|XP_217884.1| similar to RIKEN cDNA 4932702K14 [R... 118 2e-25
gi|50759870|ref|XP_417821.1| PREDICTED: similar to PABPC4 protei... 118 3e-25
gi|27682273|ref|XP_225992.1| similar to polyA binding protein, t... 117 4e-25
gi|1352709|sp|P20965|PAB1_XENLA Polyadenylate-binding protein 1 ... 117 4e-25
gi|31200267|ref|XP_309081.1| ENSANGP00000019511 [Anopheles gambi... 117 6e-25
gi|15217573|ref|NP_177322.1| polyadenylate-binding protein 5 (PA... 117 7e-25
gi|166786|gb|AAA32832.1| poly(A)-binding protein 117 7e-25
gi|173421|gb|AAA35320.1| poly(A)-binding protein 116 1e-24
gi|19114289|ref|NP_593377.1| polyadenylate-binding protein [Schi... 116 1e-24
gi|15227815|ref|NP_179916.1| polyadenylate-binding protein, puta... 116 1e-24
gi|13430610|gb|AAK25927.1| putative poly(A) binding protein [Ara... 116 1e-24
gi|2665654|gb|AAB88449.1| polyadenylate binding protein [Petromy... 115 2e-24
gi|21312912|ref|NP_080502.1| RIKEN cDNA 4932702K14 [Mus musculus... 115 2e-24
gi|37681851|gb|AAQ97803.1| poly(A)-binding protein, cytoplasmic ... 115 2e-24
gi|41054151|ref|NP_956133.1| poly(A) binding protein, cytoplasmi... 115 2e-24
gi|38075240|ref|XP_355363.1| similar to embryonic poly(A) bindin... 115 2e-24
gi|18402769|ref|NP_564554.1| polyadenylate-binding protein, puta... 115 2e-24
gi|45238849|ref|NP_112241.2| poly(A) binding protein, cytoplasmi... 115 3e-24
gi|11610605|gb|AAG38953.1| testis-specific poly(A)-binding prote... 115 3e-24
gi|50306049|ref|XP_452986.1| unnamed protein product [Kluyveromy... 115 3e-24
gi|50549903|ref|XP_502423.1| hypothetical protein [Yarrowia lipo... 114 5e-24
gi|538581|pir||DNHUPA polyadenylate-binding protein - human >gnl... 114 5e-24
gi|50308683|ref|XP_454345.1| unnamed protein product [Kluyveromy... 114 6e-24
gi|2393873|gb|AAB70164.1| poly(A)-binding protein testis-specifi... 114 6e-24
gi|31201221|ref|XP_309558.1| ENSANGP00000022280 [Anopheles gambi... 113 8e-24
gi|38075788|ref|XP_130754.3| similar to Poly(A) binding protein,... 113 8e-24
gi|7528270|gb|AAF63202.1| poly(A)-binding protein [Cucumis sativus] 113 8e-24
gi|15228016|ref|NP_181204.1| polyadenylate-binding protein, puta... 113 1e-23
gi|50256695|gb|EAL19418.1| hypothetical protein CNBH1100 [Crypto... 113 1e-23
gi|13435438|gb|AAH04587.1| Pabpc1 protein [Mus musculus] 112 1e-23
gi|4680340|gb|AAD27631.1| putative nucleolysin [Oryza sativa sub... 112 2e-23
gi|50548145|ref|XP_501542.1| hypothetical protein [Yarrowia lipo... 112 2e-23
gi|49069016|ref|XP_398797.1| hypothetical protein UM01182.1 [Ust... 112 2e-23
gi|12053297|emb|CAB66834.1| hypothetical protein [Homo sapiens] 112 2e-23
gi|35215045|dbj|BAC92404.1| putative polyadenylate-binding prote... 111 3e-23
gi|3776057|emb|CAA15498.1| dJ148E22.2 (novel PABPC1 (poly(A)-bin... 111 3e-23
gi|34015145|gb|AAQ56342.1| putative poly(A)-binding protein [Ory... 111 3e-23
gi|34395215|dbj|BAC83714.1| RNA Binding Protein-like [Oryza sati... 111 3e-23
gi|7689377|gb|AAF67755.1| poly(A)-binding protein [Spisula solid... 111 4e-23
gi|4680498|gb|AAD27678.1| TIA-1 related protein [Oryza sativa] 111 4e-23
gi|29336045|ref|NP_444344.1| poly A binding protein, cytoplasmic... 111 4e-23
gi|50288915|ref|XP_446887.1| unnamed protein product [Candida gl... 110 7e-23
gi|32398879|emb|CAD98589.1| putative poly(a)-binding protein fab... 110 7e-23
gi|46806694|dbj|BAD17764.1| putative nucleic acid binding protei... 110 7e-23
gi|46389987|dbj|BAD16229.1| putative poly(A)-binding protein [Or... 109 1e-22
gi|32490269|emb|CAE05558.1| OSJNBb0116K07.11 [Oryza sativa (japo... 109 2e-22
gi|27709474|ref|XP_229071.1| similar to poly(A) binding protein,... 108 3e-22
gi|17136378|ref|NP_476667.1| CG5119-PA [Drosophila melanogaster]... 108 3e-22
gi|29841435|gb|AAP06467.1| similar to GenBank Accession Number A... 108 3e-22
gi|41151222|ref|XP_114158.3| similar to Polyadenylate-binding pr... 107 4e-22
gi|7439967|pir||T06979 polyadenylate-binding protein - wheat >gn... 107 4e-22
gi|7512684|pir||T34543 hypothetical protein DKFZp434O1221.1 - hu... 107 6e-22
gi|18201888|ref|NP_543022.1| poly(A) binding protein, cytoplasmi... 107 6e-22
gi|50400917|sp|Q7JGR2|PAB5_MACMU Polyadenylate-binding protein 5... 107 6e-22
gi|50801542|ref|XP_428547.1| PREDICTED: similar to Polyadenylate... 107 6e-22
gi|14571652|emb|CAC42812.1| Poly(A)-binding protein cytoplasmic ... 107 7e-22
gi|39596513|emb|CAE63132.1| Hypothetical protein CBG07431 [Caeno... 107 7e-22
gi|19115155|ref|NP_594243.1| rna-binding post-transcriptional re... 106 1e-21
gi|50547639|ref|XP_501289.1| hypothetical protein [Yarrowia lipo... 106 1e-21
gi|585638|sp|P21187|PABP_DROME Polyadenylate-binding protein (Po... 105 2e-21
gi|418855|pir||S30887 polyadenylate-binding protein - fruit fly ... 105 2e-21
gi|50311447|ref|XP_455748.1| unnamed protein product [Kluyveromy... 105 2e-21
gi|23481012|gb|EAA17420.1| polyA binding protein-related [Plasmo... 105 3e-21
gi|17567133|ref|NP_510260.1| PolyA Binding protein (76.0 kD) (pa... 103 6e-21
gi|17567131|ref|NP_510259.1| PolyA Binding protein (pab-2) [Caen... 103 6e-21
gi|88405|pir||PS0381 polyadenylate-binding protein II - human (f... 103 6e-21
gi|38091648|ref|XP_356550.1| similar to Poly(A) binding protein,... 103 8e-21
gi|780291|gb|AAA65224.1| polyadenylate-binding protein 103 8e-21
gi|46434612|gb|EAK94016.1| hypothetical protein CaO19.1876 [Cand... 103 1e-20
gi|17510879|ref|NP_492727.1| polyadenylate-binding protein, Poly... 103 1e-20
gi|6019464|gb|AAC64372.2| polyadenylate-binding protein 1 [Leish... 103 1e-20
gi|23508928|ref|NP_701596.1| polyadenylate-binding protein, puta... 103 1e-20
gi|39580770|emb|CAE58939.1| Hypothetical protein CBG02207 [Caeno... 102 1e-20
gi|7882851|gb|AAF70533.1| PolyA Binding Protein 1 [Leishmania ma... 102 1e-20
gi|50604232|gb|AAH77458.1| Unknown (protein for MGC:82420) [Xeno... 101 4e-20
gi|28374170|gb|AAH45264.1| Spx-prov protein [Xenopus laevis] 101 4e-20
gi|31200419|ref|XP_309157.1| ENSANGP00000018039 [Anopheles gambi... 100 5e-20
gi|21265137|gb|AAH30692.1| ELAVL2 protein [Homo sapiens] 100 7e-20
gi|46592826|ref|NP_997569.1| ELAV-like 2 isoform 3; HU-antigen; ... 100 7e-20
gi|18921322|gb|AAL82527.1| putative ribonucleoprotein [Oryza sat... 100 7e-20
gi|15020256|gb|AAK74153.1| ELAV-like neuronal protein-2 [Mus mus... 100 9e-20
gi|14334958|gb|AAK59656.1| putative spliceosome associated prote... 100 9e-20
gi|34193906|gb|AAH56532.1| Splicing factor 3b, subunit 4 [Danio ... 100 1e-19
gi|37535012|ref|NP_921808.1| putative spliceosomal protein [Oryz... 100 1e-19
gi|34858075|ref|XP_238245.2| similar to Sf3b4 protein [Rattus no... 100 1e-19
gi|15021899|dbj|BAB62225.1| Hu/elav class neuron-specific RNA bi... 100 1e-19
gi|45360881|ref|NP_989116.1| Spx-prov protein [Xenopus tropicali... 100 1e-19
gi|50794775|ref|XP_423721.1| PREDICTED: similar to Splicing fact... 100 1e-19
gi|23346437|ref|NP_694693.1| splicing factor 3b, subunit 4; spli... 100 1e-19
gi|5032069|ref|NP_005841.1| splicing factor 3b, subunit 4; splic... 100 1e-19
gi|7439963|pir||T07933 polyadenylate-binding protein RB47 precur... 100 1e-19
gi|15020254|gb|AAK74152.1| ELAV-like neuronal protein-3 [Mus mus... 100 1e-19
gi|2136127|pir||I39077 RNA-binding protein Hel-N2 - human >gnl|B... 99 2e-19
gi|50725435|dbj|BAD32907.1| putative polyadenylate-binding prote... 99 2e-19
gi|18079265|ref|NP_525033.1| CG4262-PA [Drosophila melanogaster]... 99 2e-19
gi|103516|pir||A40252 elav protein - fruit fly (Drosophila virilis) 99 2e-19
gi|119265|sp|P23241|ELAV_DROVI Elav protein (Embryonic lethal ab... 99 2e-19
gi|2961399|emb|CAA18091.1| EG:65F1.2 [Drosophila melanogaster] 99 2e-19
gi|7446358|pir||T05725 cp31AHv protein - barley >gnl|BL_ORD_ID|1... 99 2e-19
gi|48098445|ref|XP_392063.1| similar to ENSANGP00000016235 [Apis... 99 2e-19
gi|21593441|gb|AAM65408.1| putative spliceosome associated prote... 99 3e-19
gi|15224186|ref|NP_179441.1| pre-mRNA splicing factor, putative ... 99 3e-19
gi|47933430|gb|AAT39343.1| polyadenylate binding protein [Oikopl... 99 3e-19
gi|31211119|ref|XP_314526.1| ENSANGP00000016235 [Anopheles gambi... 98 3e-19
gi|24119253|ref|NP_705947.1| splicing factor 3b, subunit 4; spli... 98 5e-19
gi|24655233|ref|NP_728610.1| CG12085-PB [Drosophila melanogaster... 97 6e-19
gi|6118522|gb|AAF04132.1| poly-U binding splicing factor [Drosop... 97 6e-19
gi|19224321|gb|AAL86452.1| half pint [Drosophila melanogaster] 97 6e-19
gi|24655228|ref|NP_525123.2| CG12085-PA [Drosophila melanogaster... 97 6e-19
gi|50260672|gb|EAL23325.1| hypothetical protein CNBA4410 [Crypto... 97 6e-19
gi|629557|pir||S49030 RNA-binding protein RNP-D precursor - Arab... 97 1e-18
gi|475719|gb|AAA18379.1| RNA-binding protein 2 97 1e-18
gi|15233980|ref|NP_194208.1| 31 kDa ribonucleoprotein, chloropla... 97 1e-18
gi|15294254|gb|AAK95304.1| AT4g24770/F22K18_30 [Arabidopsis thal... 97 1e-18
gi|48106130|ref|XP_396057.1| similar to ENSANGP00000022280 [Apis... 97 1e-18
gi|99684|pir||S20940 DNA-binding protein - Arabidopsis thaliana 97 1e-18
gi|681908|dbj|BAA06521.1| cp31 [Arabidopsis thaliana] 97 1e-18
gi|1076305|pir||S53492 RNA-binding protein cp31 precursor - Arab... 97 1e-18
gi|48094405|ref|XP_394166.1| similar to ENSANGP00000018039 [Apis... 96 1e-18
gi|7446356|pir||T06232 Ps16 protein - wheat >gnl|BL_ORD_ID|15835... 96 1e-18
gi|15228191|ref|NP_188259.1| polyadenylate-binding protein, puta... 96 2e-18
gi|23509415|ref|NP_702082.1| spliceosome-associated protein, put... 96 2e-18
gi|46592818|ref|NP_997568.1| ELAV-like 2 isoform 1; HU-antigen; ... 96 2e-18
gi|47223169|emb|CAG11304.1| unnamed protein product [Tetraodon n... 96 2e-18
gi|34869592|ref|XP_346744.1| hypothetical protein XP_346743 [Rat... 96 2e-18
gi|12274833|emb|CAC22160.1| bA31K16.2 (ELAV (embryonic lethal, a... 96 2e-18
gi|42407939|dbj|BAD09078.1| putative nucleic acid-binding protei... 95 3e-18
gi|49658982|emb|CAE01482.1| HUR [Tetraodon nigroviridis] 95 4e-18
gi|49387841|dbj|BAD26506.1| putative plastid-specific ribosomal ... 95 4e-18
gi|50256235|gb|EAL18962.1| hypothetical protein CNBI2230 [Crypto... 95 4e-18
gi|23485610|gb|EAA20492.1| splicing factor 3b subunit 4 [Plasmod... 94 5e-18
gi|31242307|ref|XP_321584.1| ENSANGP00000011587 [Anopheles gambi... 94 5e-18
gi|7446359|pir||T05727 nucleic acid-binding protein - barley >gn... 94 5e-18
gi|6754264|ref|NP_034616.1| ELAV-like 2 isoform 2; HU-antigen; H... 94 5e-18
gi|2134154|pir||I51677 ribonucleoprotein - African clawed frog >... 94 5e-18
gi|4758262|ref|NP_004423.1| ELAV (embryonic lethal, abnormal vis... 94 5e-18
gi|48097884|ref|XP_393914.1| similar to ENSANGP00000011587 [Apis... 94 7e-18
gi|49098356|ref|XP_410638.1| hypothetical protein AN6501.2 [Aspe... 94 7e-18
gi|100903|pir||S23780 nucleic acid-binding protein - maize >gnl|... 94 7e-18
gi|22329932|ref|NP_174676.2| polyadenylate-binding protein, puta... 94 9e-18
gi|49355765|ref|NP_115657.2| ELAV-like protein 3 isoform 2; Hu a... 94 9e-18
gi|50286801|ref|XP_445830.1| unnamed protein product [Candida gl... 93 1e-17
gi|6137350|pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Po... 93 1e-17
gi|15231200|ref|NP_190806.1| 33 kDa ribonucleoprotein, chloropla... 93 1e-17
gi|12836631|dbj|BAB23742.1| unnamed protein product [Mus musculus] 93 1e-17
gi|19032260|emb|CAD18921.1| RNA-binding protein precursor [Perse... 93 1e-17
gi|681912|dbj|BAA06523.1| cp33 [Arabidopsis thaliana] 93 1e-17
gi|27545382|ref|NP_775431.1| RNA binding protein HuB [Rattus nor... 93 1e-17
gi|21309|emb|CAA41023.1| 28kD RNA binding protein [Spinacia oler... 92 2e-17
gi|1076509|pir||S49463 RNA-binding protein RNP1 precursor - kidn... 92 2e-17
gi|17064758|gb|AAL32533.1| ubiquitin / ribosomal protein CEP52 [... 92 2e-17
gi|34913270|ref|NP_917982.1| putative 29 kDa ribonucleoprotein A... 92 2e-17
gi|99565|pir||S15348 RNA-binding protein, 28K - spinach 92 2e-17
gi|26399889|sp|O14102|SP49_SCHPO Spliceosome-associated protein 49 92 2e-17
gi|133247|sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chlorop... 92 2e-17
gi|7673359|gb|AAF66825.1| poly(A)-binding protein [Nicotiana tab... 92 2e-17
gi|542846|pir||JC2116 hippocampal 38K autoantigen protein - huma... 92 2e-17
gi|27229298|ref|NP_758827.1| ELAV-like protein 3 [Rattus norvegi... 92 3e-17
gi|30689921|ref|NP_195137.2| polyadenylate-binding protein 2 (PA... 92 3e-17
gi|17432522|gb|AAL39067.1| single-stranded DNA binding protein p... 92 3e-17
gi|18463972|gb|AAL73053.1| HUC [Sphoeroides nephelus] 92 3e-17
gi|6754266|ref|NP_034618.1| ELAV (embryonic lethal, abnormal vis... 91 4e-17
gi|18858615|ref|NP_571524.1| ELAV-like protein 3; elav/huc homol... 91 4e-17
gi|14585790|gb|AAK67714.1| HUC [Homo sapiens] 91 4e-17
gi|419961|pir||JN0573 polyadenylate-binding protein - fruit fly ... 91 6e-17
gi|13812116|ref|NP_113243.1| polyadenylate-binding protein [Guil... 91 6e-17
gi|42571787|ref|NP_973984.1| RNA-binding protein 47 (RBP47), put... 91 6e-17
gi|133246|sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chlorop... 91 6e-17
gi|38422743|emb|CAE54917.1| Hypothetical protein Y106G6H.2c [Cae... 91 6e-17
gi|47847880|dbj|BAD21673.1| putative RNA-binding protein RNP1 pr... 91 6e-17
gi|49355761|ref|NP_001411.2| ELAV-like protein 3 isoform 1; Hu a... 91 6e-17
gi|1176668|sp|Q09442|YP85_CAEEL Hypothetical RNA-binding protein... 91 7e-17
gi|50511896|emb|CAB60993.2| Hypothetical protein C08B11.5 [Caeno... 91 7e-17
gi|7446344|pir||JC5437 spliceosome-associated protein 49 - Caeno... 91 7e-17
gi|47220048|emb|CAG12196.1| unnamed protein product [Tetraodon n... 91 7e-17
gi|7446361|pir||T12196 RNA-binding protein - fava bean (fragment... 91 7e-17
gi|1002380|gb|AAC47514.1| RRM-type RNA binding protein 91 7e-17
gi|133248|sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chlorop... 90 9e-17
gi|50409715|ref|XP_456900.1| unnamed protein product [Debaryomyc... 90 1e-16
gi|50345000|ref|NP_001002172.1| zgc:91918 [Danio rerio] >gnl|BL_... 89 2e-16
gi|17530817|ref|NP_511058.1| CG3780-PA [Drosophila melanogaster]... 89 2e-16
gi|431093|gb|AAA58677.1| huc 89 2e-16
gi|15240641|ref|NP_199836.1| 31 kDa ribonucleoprotein, chloropla... 89 2e-16
gi|50305507|ref|XP_452713.1| unnamed protein product [Kluyveromy... 89 2e-16
gi|2134155|pir||I51678 ribonucleoprotein - African clawed frog >... 89 2e-16
gi|15218972|ref|NP_176208.1| 29 kDa ribonucleoprotein, chloropla... 89 3e-16
gi|38086531|ref|XP_141989.3| hypothetical protein XP_141989 [Mus... 89 3e-16
gi|50553138|ref|XP_503979.1| hypothetical protein [Yarrowia lipo... 89 3e-16
gi|34394882|dbj|BAC84331.1| putative RNA-binding protein [Oryza ... 89 3e-16
gi|37546316|ref|XP_352848.1| hypothetical protein XP_352847 [Hom... 89 3e-16
gi|19032262|emb|CAD18922.1| RNA-binding protein precursor [Perse... 88 4e-16
gi|39587756|emb|CAE67774.1| Hypothetical protein CBG13349 [Caeno... 88 4e-16
gi|1076251|pir||S50765 RNA-binding protein - common ice plant >g... 88 4e-16
gi|1809248|gb|AAB41656.1| siah binding protein 1 [Homo sapiens] 88 5e-16
gi|5524727|gb|AAD44358.1| RNA-binding protein SiahBP [Rattus nor... 88 5e-16
gi|6321599|ref|NP_011675.1| Nucleolar protein that binds nuclear... 88 5e-16
gi|50797652|ref|XP_423964.1| PREDICTED: similar to RIKEN cDNA 24... 88 5e-16
gi|16307289|gb|AAH09734.1| SIAHBP1 protein [Homo sapiens] 88 5e-16
gi|19526862|ref|NP_598452.1| RIKEN cDNA 2410104I19 [Mus musculus... 88 5e-16
gi|17298690|ref|NP_055096.2| fuse-binding protein-interacting re... 88 5e-16
gi|34866841|ref|XP_343269.1| siah binding protein 1; FBP interac... 88 5e-16
gi|17978512|ref|NP_510965.1| fuse-binding protein-interacting re... 88 5e-16
gi|45198625|ref|NP_985654.1| AFR107Wp [Eremothecium gossypii] >g... 88 5e-16
gi|27706752|ref|XP_228576.1| hypothetical protein XP_228576 [Rat... 88 5e-16
gi|32405818|ref|XP_323522.1| hypothetical protein [Neurospora cr... 88 5e-16
gi|6176532|gb|AAF05605.1| poly-U binding splicing factor PUF60 [... 88 5e-16
gi|12851808|dbj|BAB29173.1| unnamed protein product [Mus musculus] 88 5e-16
gi|27469824|gb|AAH41956.1| LOC340529 protein [Homo sapiens] 88 5e-16
gi|14280325|gb|AAK57539.1| HUD4 [Homo sapiens] 88 5e-16
gi|15030041|gb|AAH11265.1| SIAHBP1 protein [Homo sapiens] >gnl|B... 88 5e-16
gi|14280323|gb|AAK57538.1| HUD3 [Homo sapiens] 88 5e-16
gi|14280327|gb|AAK57540.1| HUD1 [Homo sapiens] 88 5e-16
gi|47221195|emb|CAG05516.1| unnamed protein product [Tetraodon n... 87 6e-16
gi|27817320|emb|CAD61099.1| SI:zC12P8.2.1 (novel protein similar... 87 6e-16
gi|38175737|dbj|BAC55617.2| putative heterogeneous nuclear ribon... 87 6e-16
gi|50344898|ref|NP_001002121.1| zgc:86806 [Danio rerio] >gnl|BL_... 87 6e-16
gi|27817319|emb|CAD61098.1| SI:zC12P8.2.2 (novel protein similar... 87 6e-16
gi|12230584|sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chl... 87 8e-16
gi|40807107|gb|AAH65343.1| Elavl3 protein [Danio rerio] 87 8e-16
gi|41053419|ref|NP_956615.1| hypothetical protein MGC56258 [Dani... 87 8e-16
gi|30693595|ref|NP_566958.3| RNA recognition motif (RRM)-contain... 87 1e-15
gi|45382281|ref|NP_990163.1| RNA-binding protein HuC [Gallus gal... 87 1e-15
gi|7578881|gb|AAF64167.1| plastid-specific ribosomal protein 2 p... 86 1e-15
gi|38109806|gb|EAA55617.1| hypothetical protein MG01268.4 [Magna... 86 1e-15
gi|12230585|sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chl... 86 2e-15
gi|50799071|ref|XP_424052.1| PREDICTED: similar to fuse-binding ... 86 2e-15
gi|38103529|gb|EAA50214.1| hypothetical protein MG03973.4 [Magna... 86 2e-15
gi|28279908|gb|AAH44184.1| Elavl1 protein [Danio rerio] 86 2e-15
gi|18858613|ref|NP_571527.1| ELAV (embryonic lethal, abnormal vi... 86 2e-15
gi|49095082|ref|XP_409002.1| hypothetical protein AN4865.2 [Aspe... 86 2e-15
gi|7493336|pir||T39935 RNA binding protein - fission yeast (Schi... 86 2e-15
gi|45382273|ref|NP_990161.1| RNA-binding protein HuD [Gallus gal... 86 2e-15
gi|19114443|ref|NP_593531.1| gar2 protein [Schizosaccharomyces p... 86 2e-15
gi|253181|gb|AAB22809.1| NSR1=nucleolin homolog [Saccharomyces c... 86 2e-15
gi|18858617|ref|NP_571528.1| ELAV (embryonic lethal, abnormal vi... 86 2e-15
gi|14280337|gb|AAK57545.1| Hu antigen C long [Homo sapiens] 86 2e-15
gi|2130461|pir||S55785 nucleolar protein gar2 - fission yeast (S... 85 3e-15
gi|2134152|pir||I51675 ribonucleoprotein - African clawed frog >... 85 3e-15
gi|47216059|emb|CAG11390.1| unnamed protein product [Tetraodon n... 85 3e-15
gi|23271926|gb|AAH36071.1| ELAVL4 protein [Homo sapiens] 85 3e-15
gi|46440741|gb|EAL00044.1| hypothetical protein CaO19.13509 [Can... 85 4e-15
gi|475720|gb|AAA18380.1| RNA-binding protein 3 85 4e-15
gi|1350821|sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloro... 85 4e-15
gi|7446339|pir||T05730 probable RNA-binding protein cp33 precurs... 85 4e-15
gi|7446357|pir||T06817 RNA-binding protein - garden pea >gnl|BL_... 84 5e-15
gi|46125929|ref|XP_387518.1| hypothetical protein FG07342.1 [Gib... 84 5e-15
gi|18858877|ref|NP_570984.1| HuG; etID19626.11 [Danio rerio] >gn... 84 5e-15
gi|47229364|emb|CAF99352.1| unnamed protein product [Tetraodon n... 84 7e-15
gi|1350820|sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloro... 84 9e-15
gi|31242563|ref|XP_321712.1| ENSANGP00000023817 [Anopheles gambi... 84 9e-15
gi|7446360|pir||T09108 RNA binding protein, 24K, chloroplast - s... 83 1e-14
gi|1279382|emb|CAA65831.1| spliceosomal protein [Drosophila mela... 83 1e-14
gi|31242561|ref|XP_321711.1| ENSANGP00000023687 [Anopheles gambi... 83 1e-14
gi|49076696|ref|XP_402294.1| hypothetical protein UM04679.1 [Ust... 83 1e-14
gi|32399025|emb|CAD98265.1| splicing factor, probable [Cryptospo... 83 2e-14
gi|49250885|gb|AAH74585.1| Unknown (protein for MGC:69387) [Xeno... 83 2e-14
gi|50425517|ref|XP_461354.1| unnamed protein product [Debaryomyc... 83 2e-14
gi|46229319|gb|EAK90168.1| U2 snRNP. Hsh49p, RRM domain containi... 83 2e-14
gi|25141353|ref|NP_740829.1| poly U binding factor 68kD like (rn... 82 2e-14
gi|14571650|emb|CAC42811.1| Poly(A)-binding protein cytoplasmic ... 82 2e-14
gi|25518601|pir||E86465 hypothetical protein F12G12.4 - Arabidop... 82 2e-14
gi|17510027|ref|NP_491177.1| poly U binding factor 68kD like (rn... 82 2e-14
gi|31242567|ref|XP_321714.1| ENSANGP00000025309 [Anopheles gambi... 82 2e-14
gi|38201714|ref|NP_001410.2| ELAV-like 1; embryonic lethal, abno... 82 2e-14
gi|1022961|gb|AAB41913.1| HuR RNA binding protein 82 2e-14
gi|41053816|ref|NP_956789.1| hypothetical protein MGC66127 [Dani... 82 2e-14
gi|17510025|ref|NP_491176.1| poly U binding factor 68kD like (rn... 82 2e-14
gi|39598264|emb|CAE68956.1| Hypothetical protein CBG14936 [Caeno... 82 2e-14
gi|33356910|pdb|1FNX|H Chain H, Solution Structure Of The Huc Rb... 82 3e-14
gi|21617920|gb|AAM66970.1| putative RNA-binding protein [Arabido... 82 3e-14
gi|15228102|ref|NP_181259.1| 29 kDa ribonucleoprotein, chloropla... 82 3e-14
gi|38422742|emb|CAE54916.1| Hypothetical protein Y106G6H.2b [Cae... 82 3e-14
gi|45382283|ref|NP_990164.1| RNA-binding protein HuA [Gallus gal... 82 3e-14
gi|50725369|dbj|BAD34441.1| unknown protein [Oryza sativa (japon... 82 3e-14
gi|45549052|ref|NP_476936.2| CG3151-PD [Drosophila melanogaster]... 81 4e-14
gi|26354232|dbj|BAC40744.1| unnamed protein product [Mus musculus] 81 4e-14
gi|26344670|dbj|BAC35984.1| unnamed protein product [Mus musculus] 81 4e-14
gi|31542602|ref|NP_034615.2| ELAV (embryonic lethal, abnormal vi... 81 4e-14
gi|19549690|ref|NP_599125.1| CG3151-PE [Drosophila melanogaster]... 81 4e-14
gi|38091384|ref|XP_354609.1| similar to Poly(A) binding protein,... 81 4e-14
gi|15822703|gb|AAL07518.1| RNA-binding protein precursor [Nicoti... 81 4e-14
gi|7446355|pir||S71556 DNA-binding protein CEBP-1 - clove pink >... 80 7e-14
gi|133249|sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chlorop... 80 7e-14
gi|38346724|emb|CAE04874.2| OSJNBa0086O06.22 [Oryza sativa (japo... 80 1e-13
gi|31234589|ref|XP_319085.1| ENSANGP00000005999 [Anopheles gambi... 80 1e-13
gi|7446342|pir||S77714 RNA-binding protein precursor, 33K - wood... 80 1e-13
gi|14029147|gb|AAK51123.1| polyadenylated mRNA-binding protein 2... 80 1e-13
gi|87650|pir||S02061 heterogeneous ribonuclear particle protein ... 80 1e-13
gi|47939618|gb|AAH71945.1| Heterogeneous nuclear ribonucleoprote... 80 1e-13
gi|45190591|ref|NP_984845.1| AEL016Cp [Eremothecium gossypii] >g... 80 1e-13
gi|48095502|ref|XP_392307.1| similar to CG17838-PE [Apis mellifera] 80 1e-13
gi|26330019|dbj|BAC28748.1| unnamed protein product [Mus musculus] 80 1e-13
gi|20877266|ref|XP_123260.1| similar to Heterogeneous nuclear ri... 80 1e-13
gi|41151081|ref|XP_208200.3| similar to Heterogeneous nuclear ri... 79 2e-13
gi|49085942|ref|XP_405054.1| hypothetical protein AN0917.2 [Aspe... 79 2e-13
gi|41150277|ref|XP_370982.1| similar to Heterogeneous nuclear ri... 79 2e-13
gi|31241499|ref|XP_321180.1| ENSANGP00000020835 [Anopheles gambi... 79 2e-13
gi|2134153|pir||I51676 ribonucleoprotein - African clawed frog >... 79 2e-13
gi|38328245|gb|AAH62235.1| Hnrpa1 protein [Rattus norvegicus] 79 2e-13
gi|5542530|pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Co... 79 2e-13
gi|47219493|emb|CAG10857.1| unnamed protein product [Tetraodon n... 79 2e-13
gi|26347149|dbj|BAC37223.1| unnamed protein product [Mus musculus] 79 2e-13
gi|20664272|pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Mot... 79 2e-13
gi|133254|sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleop... 79 2e-13
gi|14043070|ref|NP_112420.1| heterogeneous nuclear ribonucleopro... 79 2e-13
gi|47225636|emb|CAG07979.1| unnamed protein product [Tetraodon n... 79 2e-13
gi|2194069|pdb|1HA1| Hnrnp A1 (Rbd1,2) From Homo Sapiens 79 2e-13
gi|1711240|dbj|BAA13161.1| TIS [Mus musculus] 79 2e-13
gi|41202654|ref|XP_018399.3| similar to Heterogeneous nuclear ri... 79 2e-13
gi|4504445|ref|NP_002127.1| heterogeneous nuclear ribonucleoprot... 79 2e-13
gi|8393547|ref|NP_058944.1| heterogeneous nuclear ribonucleoprot... 79 2e-13
gi|2554653|pdb|1UP1| Up1, The Two Rna-Recognition Motif Domain ... 79 2e-13
gi|133252|sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleop... 79 2e-13
gi|38076553|ref|XP_143255.3| similar to poly(A) binding protein ... 79 3e-13
gi|728726|emb|CAA59430.1| Xel-1 [Xenopus laevis] 79 3e-13
gi|47122815|gb|AAH70529.1| MGC78820 protein [Xenopus laevis] 79 3e-13
gi|2500580|sp|Q61701|ELV4_MOUSE ELAV-like protein 4 (Paraneoplas... 78 4e-13
gi|2500581|sp|O09032|ELV4_RAT ELAV-like protein 4 (Paraneoplasti... 78 4e-13
gi|26347767|dbj|BAC37532.1| unnamed protein product [Mus musculus] 78 4e-13
gi|19920866|ref|NP_609095.1| CG11266-PB [Drosophila melanogaster... 78 4e-13
gi|28879001|gb|AAH48159.1| Elavl4 protein [Mus musculus] 78 4e-13
gi|42658041|ref|XP_208373.4| similar to Heterogeneous nuclear ri... 78 5e-13
gi|22328624|ref|NP_193166.2| heterogeneous nuclear ribonucleopro... 78 5e-13
gi|18423760|ref|NP_568826.1| RNA recognition motif (RRM)-contain... 77 6e-13
gi|30696616|ref|NP_851195.1| RNA recognition motif (RRM)-contain... 77 6e-13
gi|22531168|gb|AAM97088.1| RNA-binding protein-like [Arabidopsis... 77 6e-13
gi|28574707|ref|NP_608837.2| CG15440-PA [Drosophila melanogaster... 77 6e-13
gi|46249455|gb|AAH68622.1| LOC414671 protein [Xenopus laevis] 77 6e-13
gi|9758187|dbj|BAB08572.1| RNA-binding protein-like [Arabidopsis... 77 6e-13
gi|11386163|ref|NP_068771.1| ELAV (embryonic lethal, abnormal vi... 77 6e-13
gi|50759706|ref|XP_417743.1| PREDICTED: similar to tRNA selenocy... 77 6e-13
gi|12018306|ref|NP_072143.1| nucleolin-related protein [Rattus n... 77 8e-13
gi|104063|pir||B34840 heterogeneous ribonuclear particle protein... 77 8e-13
gi|133258|sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleop... 77 8e-13
gi|15242719|ref|NP_198865.1| RNA recognition motif (RRM)-contain... 77 8e-13
>gi|17531965|ref|NP_495121.1| tia-1 family member (45.2 kD) (2G2)
[Caenorhabditis elegans]
gi|14573833|gb|AAK68191.1| Hypothetical protein C18A3.5a
[Caenorhabditis elegans]
Length = 408
Score = 632 bits (1631), Expect = e-180
Identities = 309/309 (100%), Positives = 309/309 (100%)
Frame = -1
Query: 1227 MSFFNPPANSNHGYNDDVNTGYNARMHSKLAEREGFHLGNGSDEPRTLYVGNLDSTVTED 1048
MSFFNPPANSNHGYNDDVNTGYNARMHSKLAEREGFHLGNGSDEPRTLYVGNLDSTVTED
Sbjct: 1 MSFFNPPANSNHGYNDDVNTGYNARMHSKLAEREGFHLGNGSDEPRTLYVGNLDSTVTED 60
Query: 1047 FIATLFNQIGSVTKTKVIFDGSNDPYAFVEFSDHGQASQALQTMNKRLLLDREMKVNWAV 868
FIATLFNQIGSVTKTKVIFDGSNDPYAFVEFSDHGQASQALQTMNKRLLLDREMKVNWAV
Sbjct: 61 FIATLFNQIGSVTKTKVIFDGSNDPYAFVEFSDHGQASQALQTMNKRLLLDREMKVNWAV 120
Query: 867 EPGQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGF 688
EPGQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGF
Sbjct: 121 EPGQQQSKIDTTRHFHVFVGDLSSEVDNQKLREAFQPFGDVSDAKVIRDTNTTKSKGYGF 180
Query: 687 VSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDN 508
VSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDN
Sbjct: 181 VSYPKREEAERAIEQMNGQWLGRRTIRTNWATRKPGDQEKPSHYNEKSYDEIYNQTSGDN 240
Query: 507 TSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDV 328
TSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDV
Sbjct: 241 TSVYVGNIASLTEDEIRQGFASFGRITEVRIFKMQGYAFVKFDNKDAAAKAIVQMNNQDV 300
Query: 327 GGQLVRCSW 301
GGQLVRCSW
Sbjct: 301 GGQLVRCSW 309