Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C16C10_8
(1179 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17552222|ref|NP_497831.1| putative nuclear protein, with a co... 593 e-168
gi|39581892|emb|CAE72854.1| Hypothetical protein CBG20153 [Caeno... 446 e-124
gi|26337859|dbj|BAC32615.1| unnamed protein product [Mus musculus] 98 3e-19
gi|28510494|ref|XP_110955.2| similar to hypothetical protein DKF... 98 3e-19
gi|34872872|ref|XP_220748.2| similar to hypothetical protein DKF... 97 1e-18
gi|50758256|ref|XP_415834.1| PREDICTED: similar to hypothetical ... 91 4e-17
gi|14149807|ref|NP_115517.1| hypothetical protein DKFZp434K1421 ... 85 3e-15
gi|49065536|emb|CAG38586.1| DKFZP434K1421 [Homo sapiens] 85 3e-15
gi|49900606|gb|AAH76130.1| Unknown (protein for IMAGE:7071950) [... 83 1e-14
gi|47221822|emb|CAG08876.1| unnamed protein product [Tetraodon n... 82 3e-14
gi|32411235|ref|XP_326098.1| hypothetical protein [Neurospora cr... 82 3e-14
gi|24641752|ref|NP_727694.1| CG15747-PA [Drosophila melanogaster... 80 7e-14
gi|16768602|gb|AAL28520.1| GM10183p [Drosophila melanogaster] 79 2e-13
gi|50255346|gb|EAL18081.1| hypothetical protein CNBK1020 [Crypto... 77 1e-12
gi|38110714|gb|EAA56394.1| hypothetical protein MG06365.4 [Magna... 76 2e-12
gi|49072040|ref|XP_400309.1| hypothetical protein UM02694.1 [Ust... 76 2e-12
gi|18401379|ref|NP_565643.1| hypothetical protein [Arabidopsis t... 75 2e-12
gi|25407880|pir||A84671 hypothetical protein At2g27280 [imported... 75 2e-12
gi|49097600|ref|XP_410260.1| hypothetical protein AN6123.2 [Aspe... 72 3e-11
gi|46125739|ref|XP_387423.1| hypothetical protein FG07247.1 [Gib... 72 3e-11
gi|18401381|ref|NP_565644.1| expressed protein [Arabidopsis thal... 69 2e-10
gi|19115788|ref|NP_594876.1| hypothetical protein [Schizosacchar... 64 9e-09
gi|50554535|ref|XP_504676.1| hypothetical protein [Yarrowia lipo... 62 3e-08
gi|47225554|emb|CAG12037.1| unnamed protein product [Tetraodon n... 61 4e-08
gi|39545658|emb|CAE03132.3| OJ000114_01.13 [Oryza sativa (japoni... 58 5e-07
gi|31209543|ref|XP_313738.1| ENSANGP00000016897 [Anopheles gambi... 54 5e-06
gi|2133786|pir||I51116 NF-180 - sea lamprey >gnl|BL_ORD_ID|32563... 53 2e-05
gi|17367114|sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX ... 52 4e-05
gi|17509687|ref|NP_491423.1| human XNP gene related (156.2 kD) (... 52 4e-05
gi|32421759|ref|XP_331323.1| hypothetical protein [Neurospora cr... 52 4e-05
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet... 51 6e-05
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat... 51 6e-05
gi|50545281|ref|XP_500178.1| hypothetical protein [Yarrowia lipo... 50 8e-05
gi|1107512|emb|CAA62539.1| ORF2 [Bacteriophage A511] 50 8e-05
gi|25406009|pir||E96600 protein F14J16.20 [imported] - Arabidops... 50 1e-04
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot... 50 1e-04
gi|39589507|emb|CAE74536.1| Hypothetical protein CBG22293 [Caeno... 50 1e-04
gi|6002950|gb|AAF00223.1| triadin isoform 3 [Canis familiaris] 49 2e-04
gi|21362996|sp|P82179|TRDN_CANFA Triadin >gnl|BL_ORD_ID|310205 g... 49 2e-04
gi|45383800|ref|NP_989489.1| caldesmon 1 [Gallus gallus] >gnl|BL... 48 4e-04
gi|27529742|dbj|BAA74868.2| KIAA0845 protein [Homo sapiens] 48 4e-04
gi|33302611|sp|P12036|NFH_HUMAN Neurofilament triplet H protein ... 48 4e-04
gi|14250426|gb|AAH08648.1| Unknown (protein for IMAGE:3866238) [... 48 4e-04
gi|3089522|gb|AAC38407.1| gas vesicle protein GvpT [Bacillus meg... 48 4e-04
gi|15149467|ref|NP_149347.1| caldesmon 1 isoform 3 [Homo sapiens] 48 4e-04
gi|71549|pir||QFHUH neurofilament triplet H protein - human >gnl... 48 4e-04
gi|32483416|ref|NP_066554.2| neurofilament, heavy polypeptide 20... 48 4e-04
gi|21064505|gb|AAM29482.1| RE44143p [Drosophila melanogaster] 48 4e-04
gi|17221648|dbj|BAB78478.1| preproMP73 [Cucurbita maxima] 48 5e-04
gi|39595447|emb|CAE60485.1| Hypothetical protein CBG04099 [Caeno... 48 5e-04
gi|13186201|gb|AAF69498.3| NAG22 protein [Homo sapiens] 47 7e-04
gi|4826657|ref|NP_004333.1| caldesmon 1 isoform 2 [Homo sapiens]... 47 7e-04
gi|179830|gb|AAA35636.1| caldesmon 47 7e-04
gi|46108446|ref|XP_381281.1| hypothetical protein FG01105.1 [Gib... 47 7e-04
gi|44680105|ref|NP_149129.2| caldesmon 1 isoform 1 [Homo sapiens] 47 7e-04
gi|2498204|sp|Q05682|CALD_HUMAN Caldesmon (CDM) >gnl|BL_ORD_ID|3... 47 7e-04
gi|24620455|gb|AAN61519.1| 1MDa_1 protein [Caenorhabditis elegans] 47 9e-04
gi|39580495|emb|CAE70465.1| Hypothetical protein CBG17052 [Caeno... 47 9e-04
gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans] 47 9e-04
gi|17565434|ref|NP_504585.1| fibronectin, type III and M protein... 47 9e-04
gi|17544554|ref|NP_500777.1| putative nuclear protein, with 4 co... 47 9e-04
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans] 47 9e-04
gi|19074574|ref|NP_586080.1| similarity to ribosomal protein L5 ... 47 0.001
gi|8096269|dbj|BAA95789.1| KED [Nicotiana tabacum] 46 0.001
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 46 0.001
gi|2506984|sp|P12957|CALD_CHICK Caldesmon (CDM) >gnl|BL_ORD_ID|7... 46 0.002
gi|32698003|emb|CAB04326.3| Hypothetical protein F36F2.3 [Caenor... 46 0.002
gi|15149463|ref|NP_149130.1| caldesmon 1 isoform 4 [Homo sapiens... 46 0.002
gi|7511618|pir||T29757 protein UNC-89 - Caenorhabditis elegans 45 0.003
gi|28828540|gb|AAO51148.1| similar to Y55B1BR.3.p [Caenorhabditi... 45 0.003
gi|31746683|gb|AAP68958.1| Uncoordinated protein 89, isoform b [... 45 0.003
gi|1160355|gb|AAB00542.1| UNC-89 45 0.003
gi|25141314|ref|NP_491290.2| UNCoordinated locomotion UNC-89, PH... 45 0.003
gi|17556242|ref|NP_497198.1| chromo domain containing protein (7... 45 0.003
gi|39593040|emb|CAE64509.1| Hypothetical protein CBG09244 [Caeno... 45 0.003
gi|47937903|gb|AAH71371.1| Unknown (protein for IMAGE:6895565) [... 45 0.003
gi|46229652|gb|EAK90470.1| hypothetical low complexity protein w... 45 0.003
gi|15149465|ref|NP_149131.1| caldesmon 1 isoform 5 [Homo sapiens... 45 0.003
gi|27806279|ref|NP_776683.1| caldesmon, smooth muscle [Bos tauru... 45 0.003
gi|33878450|gb|AAH14035.1| CALD1 protein [Homo sapiens] 45 0.003
gi|39593112|emb|CAE64581.1| Hypothetical protein CBG09334 [Caeno... 45 0.003
gi|5174725|ref|NP_006064.1| triadin [Homo sapiens] >gnl|BL_ORD_I... 39 0.004
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 45 0.004
gi|19401863|gb|AAL87694.1| non-transporter ABC protein AbcF4 [Di... 45 0.004
gi|50255325|gb|EAL18060.1| hypothetical protein CNBK0810 [Crypto... 45 0.004
gi|28839581|gb|AAH47849.1| Atrxl protein [Danio rerio] 44 0.006
gi|39594465|emb|CAE72043.1| Hypothetical protein CBG19125 [Caeno... 44 0.006
gi|23613480|ref|NP_703324.1| glutamic acid-rich protein (garp) [... 44 0.006
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur... 44 0.006
gi|49250412|gb|AAH74703.1| Unknown (protein for MGC:69335) [Xeno... 44 0.007
gi|50748241|ref|XP_421170.1| PREDICTED: similar to S164 [Gallus ... 44 0.007
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 44 0.007
gi|21700195|dbj|BAC02896.1| tobacco nucleolin [Nicotiana tabacum] 44 0.007
gi|38089561|ref|XP_286113.2| similar to Cngb1 protein [Mus muscu... 44 0.007
gi|45200747|ref|NP_986317.1| AGL350Cp [Eremothecium gossypii] >g... 44 0.007
gi|42569129|ref|NP_179444.2| cupin family protein [Arabidopsis t... 44 0.010
gi|13539605|emb|CAC35733.1| cyclophilin-RNA interacting protein ... 44 0.010
gi|18399879|ref|NP_565526.1| RNA recognition motif (RRM)-contain... 44 0.010
gi|21593807|gb|AAM65774.1| putative RNA-binding protein [Arabido... 44 0.010
gi|17507645|ref|NP_491654.1| CBF1 interacting corepressor (65.8 ... 44 0.010
gi|25411878|pir||E84565 hypothetical protein At2g18540 [imported... 44 0.010
gi|50732541|ref|XP_418684.1| PREDICTED: similar to PHD finger pr... 44 0.010
gi|48096459|ref|XP_392462.1| similar to CG18255-PA [Apis mellifera] 44 0.010
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb... 44 0.010
gi|39598251|emb|CAE68943.1| Hypothetical protein CBG14923 [Caeno... 44 0.010
gi|17558378|ref|NP_504775.1| putative protein, with 4 coiled coi... 43 0.013
gi|7440063|pir||T09648 nucleolin homolog nuM1 - alfalfa >gnl|BL_... 43 0.013
gi|23478137|gb|EAA15306.1| hypothetical protein [Plasmodium yoel... 43 0.013
gi|11496756|ref|NP_045547.1| B. burgdorferi predicted coding reg... 43 0.013
gi|2315159|emb|CAB09575.1| caldesmon [Bos taurus] 43 0.013
gi|39593629|emb|CAE61921.1| Hypothetical protein CBG05917 [Caeno... 43 0.013
gi|23509641|ref|NP_702308.1| hypothetical protein [Plasmodium fa... 43 0.013
gi|6323482|ref|NP_013554.1| Nuclear protein, putative peptidyl-p... 43 0.013
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster... 43 0.013
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 43 0.016
gi|39590279|emb|CAE66017.1| Hypothetical protein CBG11210 [Caeno... 43 0.016
gi|304728|gb|AAA28573.1| transcription factor 43 0.016
gi|17737765|ref|NP_524229.1| CG1119-PA [Drosophila melanogaster]... 43 0.016
gi|21483228|gb|AAM52589.1| AT18625p [Drosophila melanogaster] 43 0.016
gi|39590065|emb|CAE61063.1| Hypothetical protein CBG04812 [Caeno... 43 0.016
gi|7505887|pir||T23647 hypothetical protein M01E5.5b - Caenorhab... 43 0.016
gi|27881943|gb|AAH44500.1| LOC407619 protein [Danio rerio] 43 0.016
gi|14249158|ref|NP_116020.1| hepatoma-derived growth factor-rela... 42 0.021
gi|18858189|ref|NP_572495.1| CG12109-PB [Drosophila melanogaster... 42 0.021
gi|49900538|gb|AAH76031.1| Unknown (protein for IMAGE:7046168) [... 42 0.021
gi|46138029|ref|XP_390705.1| hypothetical protein FG10529.1 [Gib... 42 0.021
gi|45185293|ref|NP_983010.1| ABR064Wp [Eremothecium gossypii] >g... 42 0.021
gi|50302725|ref|XP_451299.1| unnamed protein product [Kluyveromy... 42 0.021
gi|47498038|ref|NP_998865.1| hypothetical protein MGC69319 [Xeno... 42 0.021
gi|48255931|ref|NP_001001520.1| hepatoma-derived growth factor-r... 42 0.021
gi|14495677|gb|AAH09449.1| MGC2641 protein [Homo sapiens] 42 0.021
gi|15222009|ref|NP_175322.1| nucleolin, putative [Arabidopsis th... 42 0.021
gi|32563720|ref|NP_871901.1| RNA-binding region RNP-1 family mem... 42 0.028
gi|25395621|pir||E88320 protein F07A11.6 [imported] - Caenorhabd... 42 0.028
gi|7498509|pir||T20532 hypothetical protein F07A11.6b - Caenorha... 42 0.028
gi|29346315|ref|NP_809818.1| BatC, conserved hypothetical protei... 42 0.028
gi|48730797|ref|ZP_00264544.1| COG0810: Periplasmic protein TonB... 42 0.028
gi|7498508|pir||T20531 hypothetical protein F07A11.6a - Caenorha... 42 0.028
gi|32563718|ref|NP_496485.2| RNA-binding region RNP-1 family mem... 42 0.028
gi|39596340|emb|CAE69978.1| Hypothetical protein CBG16376 [Caeno... 42 0.028
gi|32563716|ref|NP_496484.2| RNA-binding region RNP-1 family mem... 42 0.028
gi|17562300|ref|NP_505661.1| step II splicing factor (74.5 kD) (... 42 0.028
gi|50748171|ref|XP_421139.1| PREDICTED: similar to KIAA0252 [Gal... 42 0.036
gi|6841130|gb|AAF28918.1| HSPC095 [Homo sapiens] 42 0.036
gi|23508231|ref|NP_700900.1| hypothetical protein [Plasmodium fa... 42 0.036
gi|24308005|ref|NP_055953.1| KIAA0252 [Homo sapiens] >gnl|BL_ORD... 42 0.036
gi|39588136|emb|CAE68060.1| Hypothetical protein CBG13680 [Caeno... 42 0.036
gi|20521862|dbj|BAA13382.2| Similar to Plasmodium falciparum glu... 42 0.036
gi|32417742|ref|XP_329349.1| hypothetical protein [Neurospora cr... 42 0.036
gi|28850293|gb|AAM45317.2| similar to Required for the transfer ... 42 0.036
gi|3789905|gb|AAC67538.1| developmental protein DG1071 [Dictyost... 42 0.036
gi|17554908|ref|NP_497967.1| cyclin-like F-box (3F797) [Caenorha... 41 0.048
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 41 0.048
gi|47937947|gb|AAH71418.1| Unknown (protein for IMAGE:6898978) [... 41 0.048
gi|25395695|pir||G88436 protein T04A8.13 [imported] - Caenorhabd... 41 0.048
gi|23488530|gb|EAA21341.1| hypothetical protein [Plasmodium yoel... 41 0.048
gi|15230232|ref|NP_191274.1| dyskerin, putative / nucleolar prot... 41 0.048
gi|50425421|ref|XP_461304.1| unnamed protein product [Debaryomyc... 41 0.048
gi|17535065|ref|NP_496536.1| topoisomerase II (2M169) [Caenorhab... 41 0.048
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 41 0.048
gi|17505386|ref|NP_492791.1| putative protein, with a transmembr... 41 0.062
gi|17508321|ref|NP_493337.1| eukaryotic DNA topoisomerase I., TO... 41 0.062
gi|39593039|emb|CAE64508.1| Hypothetical protein CBG09238 [Caeno... 41 0.062
gi|24653966|ref|NP_725506.1| CG18255-PA [Drosophila melanogaster... 41 0.062
gi|39589597|emb|CAE66832.1| Hypothetical protein CBG12202 [Caeno... 41 0.062
gi|50551527|ref|XP_503237.1| hypothetical protein [Yarrowia lipo... 41 0.062
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 41 0.062
gi|17505881|ref|NP_492824.1| vamp-associated protein like family... 41 0.062
gi|24653978|ref|NP_725510.1| CG18255-PD [Drosophila melanogaster... 41 0.062
gi|15242667|ref|NP_198850.1| PWWP domain-containing protein [Ara... 41 0.062
gi|7494989|pir||T33123 hypothetical protein B0511.12 - Caenorhab... 41 0.062
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl... 41 0.062
gi|38075623|ref|XP_283757.2| expressed sequence AW553985 [Mus mu... 41 0.062
gi|32564545|ref|NP_871867.1| putative protein, with a transmembr... 41 0.062
gi|37361866|gb|AAQ91046.1| LRRGT00090 [Rattus norvegicus] 40 0.081
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 40 0.081
gi|17559190|ref|NP_506146.1| putative protein, with 2 coiled coi... 40 0.081
gi|50305507|ref|XP_452713.1| unnamed protein product [Kluyveromy... 40 0.081
gi|23509866|ref|NP_702533.1| hypothetical protein [Plasmodium fa... 40 0.081
gi|34495238|gb|AAQ73469.1| erythrocyte binding protein 3 [Plasmo... 40 0.081
gi|50550109|ref|XP_502527.1| hypothetical protein [Yarrowia lipo... 40 0.081
gi|34784456|gb|AAH57473.1| LOC402866 protein [Danio rerio] 40 0.081
gi|9858781|gb|AAG01128.1| BAC19.13 [Lycopersicon esculentum] 40 0.081
gi|17542856|ref|NP_500057.1| putative nuclear protein (4B983) [C... 40 0.081
gi|34907494|ref|NP_915094.1| B1099D03.17 [Oryza sativa (japonica... 40 0.081
gi|50287893|ref|XP_446376.1| unnamed protein product [Candida gl... 40 0.081
gi|50556082|ref|XP_505449.1| hypothetical protein [Yarrowia lipo... 40 0.081
gi|23508673|ref|NP_701342.1| MAEBL, putative [Plasmodium falcipa... 40 0.081
gi|34495237|gb|AAQ73468.1| erythrocyte binding protein 2 [Plasmo... 40 0.081
gi|39591773|emb|CAE71351.1| Hypothetical protein CBG18254 [Caeno... 40 0.081
gi|17565216|ref|NP_503595.1| putative nuclear protein, with a co... 40 0.081
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 40 0.081
gi|530998|gb|AAB04165.1| proline rotamase 40 0.081
gi|23619251|ref|NP_705213.1| hypothetical protein [Plasmodium fa... 40 0.081
gi|49483978|ref|YP_041202.1| putative membrane protein [Staphylo... 40 0.081
gi|7489917|pir||JC6552 DNA topoisomerase (EC 5.99.1.2) - slime m... 40 0.11
gi|1934847|emb|CAA65537.1| DNA topoisomerase; DNA topoisomerase ... 40 0.11
gi|24655483|ref|NP_728652.1| CG7971-PC [Drosophila melanogaster]... 40 0.11
gi|23481991|gb|EAA18109.1| erythrocyte binding protein [Plasmodi... 40 0.11
gi|41054175|ref|NP_956117.1| Unknown (protein for MGC:66480); wu... 40 0.11
gi|24655488|ref|NP_647642.2| CG7971-PA [Drosophila melanogaster]... 40 0.11
gi|34869750|ref|XP_223980.2| similar to RPGR-interacting protein... 40 0.11
gi|23490695|gb|EAA22410.1| hypothetical protein [Plasmodium yoel... 40 0.11
gi|30173132|sp|Q9WU62|INCE_MOUSE Inner centromere protein >gnl|B... 40 0.11
gi|50551847|ref|XP_503398.1| hypothetical protein [Yarrowia lipo... 40 0.11
gi|50292141|ref|XP_448503.1| unnamed protein product [Candida gl... 40 0.11
gi|30851505|gb|AAH52414.1| Inner centromere protein [Mus musculus] 40 0.11
gi|26349413|dbj|BAC38346.1| unnamed protein product [Mus musculu... 40 0.11
gi|39580674|emb|CAE61356.1| Hypothetical protein CBG05197 [Caeno... 40 0.11
gi|50256956|gb|EAL19674.1| hypothetical protein CNBG3020 [Crypto... 40 0.11
gi|32419006|ref|XP_329981.1| hypothetical protein [Neurospora cr... 40 0.11
gi|23488160|gb|EAA21247.1| Formin Homology 2 Domain, putative [P... 40 0.11
gi|46431840|gb|EAK91364.1| hypothetical protein CaO19.188 [Candi... 40 0.11
gi|4102980|gb|AAD09328.1| virulent strain associated lipoprotein... 40 0.11
gi|37680892|ref|NP_935501.1| translation initiation factor 2 [Vi... 40 0.11
gi|39589781|emb|CAE67016.1| Hypothetical protein CBG12417 [Caeno... 40 0.11
gi|27365057|ref|NP_760585.1| Translation initiation factor 2 [Vi... 40 0.11
gi|23466721|ref|ZP_00122308.1| COG0532: Translation initiation f... 40 0.11
gi|24655493|ref|NP_728653.1| CG7971-PB [Drosophila melanogaster]... 40 0.11
gi|14717413|gb|AAK72618.1| unknown [Entamoeba histolytica] 40 0.11
gi|42662574|ref|XP_088636.5| cylicin, basic protein of sperm hea... 40 0.14
gi|17562894|ref|NP_506088.1| putative nuclear protein (43.5 kD) ... 40 0.14
gi|7506280|pir||T23908 hypothetical protein R04F11.3 - Caenorhab... 40 0.14
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto... 40 0.14
gi|17554502|ref|NP_497888.1| putative nuclear protein, with 2 co... 40 0.14
gi|46440428|gb|EAK99734.1| hypothetical protein CaO19.7492 [Cand... 40 0.14
gi|6678946|ref|NP_032660.1| microtubule-associated protein 1 B; ... 40 0.14
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 40 0.14
gi|24644588|ref|NP_731075.1| CG31367-PA [Drosophila melanogaster... 40 0.14
gi|630734|pir||S43597 coiled-coil protein homolog R07E5.6 - Caen... 40 0.14
gi|34880553|ref|XP_228973.2| similar to hypothetical protein FLJ... 40 0.14
gi|31242837|ref|XP_321849.1| ENSANGP00000020303 [Anopheles gambi... 40 0.14
gi|23509352|ref|NP_702019.1| hypothetical protein [Plasmodium fa... 40 0.14
gi|42661171|ref|XP_290758.4| KIAA0553 protein [Homo sapiens] 40 0.14
gi|7513015|pir||T00329 hypothetical protein KIAA0553 - human (fr... 40 0.14
gi|17535279|ref|NP_496331.1| structural maintenance of chromosom... 40 0.14
gi|39585902|emb|CAE61316.1| Hypothetical protein CBG05151 [Caeno... 40 0.14
gi|6323566|ref|NP_013637.1| Nucleolar peptidyl-prolyl cis-trans ... 40 0.14
gi|50756763|ref|XP_415310.1| PREDICTED: similar to heavy neurofi... 40 0.14
gi|544124|sp|P35663|CYL1_HUMAN Cylicin I (Multiple-band polypept... 40 0.14
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 40 0.14
gi|32410929|ref|XP_325945.1| hypothetical protein [Neurospora cr... 40 0.14
gi|18858059|ref|NP_572502.1| CG1785-PA [Drosophila melanogaster]... 40 0.14
gi|23488733|gb|EAA21388.1| mature-parasite-infected erythrocyte ... 40 0.14
gi|38106086|gb|EAA52437.1| hypothetical protein MG05129.4 [Magna... 40 0.14
gi|32029693|ref|ZP_00132676.1| COG0532: Translation initiation f... 40 0.14
gi|16805048|ref|NP_473077.1| hypothetical protein [Plasmodium fa... 40 0.14
gi|34878626|ref|XP_214600.2| similar to hypothetical protein FLJ... 39 0.18
gi|50552886|ref|XP_503853.1| hypothetical protein [Yarrowia lipo... 39 0.18
gi|17550336|ref|NP_510658.1| TBP-Associated transcription Factor... 39 0.18
gi|6851387|gb|AAF29539.1| triadin 1 [Rattus norvegicus] 39 0.18
gi|6322648|ref|NP_012721.1| Putative positive regulator of manno... 39 0.18
gi|2980817|emb|CAA82046.1| MNN4 [Saccharomyces cerevisiae] 39 0.18
gi|50256625|gb|EAL19348.1| hypothetical protein CNBH0420 [Crypto... 39 0.18
gi|34858978|ref|XP_238127.2| similar to phosphoprotein [Rattus n... 39 0.18
gi|31212791|ref|XP_315380.1| ENSANGP00000024735 [Anopheles gambi... 39 0.18
gi|20087017|gb|AAL10507.1| maebl [Plasmodium knowlesi] 39 0.18
gi|15218071|ref|NP_173516.1| DEAD box RNA helicase, putative [Ar... 39 0.18
gi|30687294|ref|NP_194393.3| expressed protein [Arabidopsis thal... 39 0.18
gi|159333|gb|AAA20179.1| glycoprotein 96-92 39 0.18
gi|20260450|gb|AAM13123.1| putative protein [Arabidopsis thalian... 39 0.18
gi|31212789|ref|XP_315379.1| ENSANGP00000020890 [Anopheles gambi... 39 0.18
gi|28564139|gb|AAO32448.1| MNN4 [Saccharomyces bayanus] 39 0.18
gi|17505635|ref|NP_491917.1| putative nuclear protein, with 2 co... 39 0.18
gi|38105817|gb|EAA52198.1| hypothetical protein MG04890.4 [Magna... 39 0.18
gi|15723144|emb|CAA23015.1| topoisomerase I alpha [Takifugu rubr... 39 0.18
gi|48130462|ref|XP_396665.1| similar to hypothetical protein [Ap... 39 0.18
gi|12643892|sp|Q9UKJ3|Y553_HUMAN Hypothetical protein KIAA0553 >... 39 0.18
gi|50311997|ref|XP_456030.1| unnamed protein product [Kluyveromy... 39 0.18
gi|17221669|gb|AAL36455.1| circumsporozoite protein [Plasmodium ... 39 0.18
gi|17534591|ref|NP_495100.1| putative protein, with 4 coiled coi... 39 0.18
gi|462702|sp|P16884|NFH_RAT Neurofilament triplet H protein (200... 39 0.18
gi|42733645|gb|AAS38609.1| hypothetical protein [Dictyostelium d... 37 0.19
gi|25388077|pir||JC7673 dynein intermediate chain homolog - newt... 37 0.19
gi|50745936|ref|XP_420305.1| PREDICTED: similar to transcription... 39 0.24
gi|23593313|ref|NP_473064.2| hypothetical protein [Plasmodium fa... 39 0.24
gi|39597162|emb|CAE59389.1| Hypothetical protein CBG02746 [Caeno... 39 0.24
gi|25009763|gb|AAN71055.1| AT12326p [Drosophila melanogaster] >g... 39 0.24
gi|50731371|ref|XP_417244.1| PREDICTED: similar to DNA polymeras... 39 0.24
gi|31216396|ref|XP_316223.1| ENSANGP00000017802 [Anopheles gambi... 39 0.24
gi|39593526|emb|CAE61818.1| Hypothetical protein CBG05788 [Caeno... 39 0.24
gi|15228587|ref|NP_189551.1| glycine-rich protein [Arabidopsis t... 39 0.24
gi|205680|gb|AAA41692.1| high molecular weight neurofilament 39 0.24
gi|23509028|ref|NP_701696.1| hypothetical protein [Plasmodium fa... 39 0.24
gi|25990101|gb|AAN75020.1| chromosome scaffold protein p85 [Mone... 39 0.24
gi|50344727|ref|NP_001002037.1| ibd2069; hepatoma-derived growth... 39 0.24
gi|7494310|pir||B71609 hypothetical protein PFB0680w - malaria p... 39 0.24
gi|46228298|gb|EAK89197.1| hypothetical protein with signal pept... 39 0.24
gi|40806973|gb|AAH65279.1| FLJ10006 protein [Homo sapiens] 39 0.24
gi|17533631|ref|NP_496363.1| nucampholin, LEThal LET-858 (104.3 ... 39 0.24
gi|7710040|ref|NP_057901.1| inner centromere protein [Mus muscul... 39 0.24
gi|34899982|ref|NP_911337.1| Neurofilament triplet M protein-lik... 39 0.24
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 39 0.24
gi|50545487|ref|XP_500281.1| hypothetical protein [Yarrowia lipo... 39 0.24
gi|18088421|gb|AAH20726.1| SCEL protein [Homo sapiens] 39 0.24
gi|49618989|gb|AAT68079.1| nucleolin [Danio rerio] 39 0.24
gi|21739669|emb|CAD38875.1| hypothetical protein [Homo sapiens] 39 0.24
gi|15607012|ref|NP_214394.1| initiation factor IF-2 [Aquifex aeo... 39 0.24
gi|17556188|ref|NP_497536.1| translation initiation factor (133.... 39 0.24
gi|38103245|gb|EAA49965.1| hypothetical protein MG10674.4 [Magna... 39 0.24
gi|23482296|gb|EAA18317.1| hypothetical protein [Plasmodium yoel... 35 0.31
gi|21064849|gb|AAM29654.1| SD12335p [Drosophila melanogaster] 39 0.31
gi|32566156|ref|NP_501620.2| myosin head and M protein repeat (... 39 0.31
gi|2133452|pir||S65469 DNA topoisomerase (EC 5.99.1.2) - Caenorh... 39 0.31
gi|7108770|gb|AAF36532.1| IF2 protein [Drosophila melanogaster] 39 0.31
gi|24656849|ref|NP_651974.1| CG10840-PB [Drosophila melanogaster... 39 0.31
gi|8134743|sp|Q28820|TRDN_RABIT Triadin >gnl|BL_ORD_ID|1941517 g... 39 0.31
gi|17507217|ref|NP_492424.1| retinoblastoma binding protein 6 li... 39 0.31
gi|47217980|emb|CAG02263.1| unnamed protein product [Tetraodon n... 39 0.31
gi|7498235|pir||T20382 hypothetical protein D2089.1 - Caenorhabd... 39 0.31
gi|49077162|ref|XP_402478.1| hypothetical protein UM04863.1 [Ust... 39 0.31
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n... 39 0.31
gi|39586313|emb|CAE66724.1| Hypothetical protein CBG12070 [Caeno... 39 0.31
gi|18425086|ref|NP_569037.1| expressed protein [Arabidopsis thal... 39 0.31
gi|39591381|emb|CAE73435.1| Hypothetical protein CBG20878 [Caeno... 39 0.31
gi|23480480|gb|EAA17030.1| O1, putative [Plasmodium yoelii yoelii] 39 0.31
gi|25153309|ref|NP_741039.1| serine/aRginine rich pre-mRNA SPlic... 39 0.31
gi|50255255|gb|EAL17991.1| hypothetical protein CNBK3420 [Crypto... 39 0.31
gi|23613117|ref|NP_703439.1| RNA polymerase I [Plasmodium falcip... 39 0.31
gi|7500635|pir||T21861 hypothetical protein F36F2.3 - Caenorhabd... 39 0.31
gi|7509394|pir||T26467 hypothetical protein Y11D7A.14 - Caenorha... 39 0.31
gi|1144491|gb|AAC48498.1| cardiac triadin isoform 3 >gnl|BL_ORD_... 39 0.31
gi|23508164|ref|NP_700834.1| hypothetical protein [Plasmodium fa... 39 0.31
gi|50409715|ref|XP_456900.1| unnamed protein product [Debaryomyc... 39 0.31
gi|28829606|gb|AAO52123.1| similar to Plasmodium falciparum. Hyp... 39 0.31
gi|23619502|ref|NP_705464.1| hypothetical protein [Plasmodium fa... 36 0.31
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 38 0.40
gi|34495216|gb|AAQ73456.1| erythrocyte binding protein 3 [Plasmo... 38 0.40
gi|23509309|ref|NP_701976.1| hypothetical protein [Plasmodium fa... 38 0.40
gi|48104706|ref|XP_392964.1| similar to ENSANGP00000012035 [Apis... 38 0.40
gi|7494464|pir||T09127 probable erythrocyte-binding protein MAEB... 38 0.40
gi|24659555|ref|NP_729188.1| CG32394-PA [Drosophila melanogaster... 38 0.40
gi|17558380|ref|NP_504774.1| putative nuclear protein, with a co... 38 0.40
gi|46439737|gb|EAK99051.1| hypothetical protein CaO19.13145 [Can... 38 0.40
gi|34495215|gb|AAQ73455.1| erythrocyte binding protein 2 [Plasmo... 38 0.40
gi|33417092|gb|AAH56003.1| LOC398686 protein [Xenopus laevis] 38 0.40
gi|50306375|ref|XP_453161.1| unnamed protein product [Kluyveromy... 38 0.40
gi|23483084|gb|EAA18870.1| hypothetical protein [Plasmodium yoel... 38 0.40
gi|42761572|gb|AAS45390.1| similar to Babesia bigemina. 200 kDa ... 38 0.40
gi|23508775|ref|NP_701443.1| hypothetical protein [Plasmodium fa... 38 0.40
gi|34898162|ref|NP_910427.1| contains ESTs AU100718(C12270),C264... 38 0.40
gi|49522807|gb|AAH74646.1| Unknown (protein for MGC:69349) [Xeno... 38 0.40
gi|32413146|ref|XP_327053.1| hypothetical protein [Neurospora cr... 38 0.40
gi|39587629|emb|CAE58567.1| Hypothetical protein CBG01732 [Caeno... 38 0.40
gi|18376023|emb|CAB91757.2| related to replication factor C prot... 38 0.40
gi|7531147|sp|Q9ZF28|IF2_KLEOX Translation initiation factor IF-... 38 0.40
gi|23480764|gb|EAA17238.1| similar to RNA helicases, putative [P... 38 0.40
gi|1262277|gb|AAA96781.1| nucleolar phosphoprotein [Tetrahymena ... 38 0.40
gi|40788884|dbj|BAA09925.2| KIAA0155 [Homo sapiens] 38 0.40
gi|15235733|ref|NP_192495.1| hypothetical protein [Arabidopsis t... 38 0.40
gi|49106588|ref|XP_411440.1| hypothetical protein AN7303.2 [Aspe... 38 0.40
gi|34394410|dbj|BAC83508.1| nucleolin-related protein NRP-like [... 38 0.40
gi|46143831|ref|ZP_00133959.2| COG3064: Membrane protein involve... 38 0.40
gi|50753280|ref|XP_413937.1| PREDICTED: similar to KIAA1561 prot... 38 0.40
gi|7661950|ref|NP_055448.1| SH2 domain binding protein 1; TPR-co... 38 0.40
gi|7510771|pir||T29919 hypothetical protein ZC449.5 - Caenorhabd... 38 0.53
gi|38079560|ref|XP_355579.1| similar to myeloid/lymphoid or mixe... 38 0.53
gi|2136369|pir||I54367 X-linked nuclear protein - human >gnl|BL_... 38 0.53
gi|46442204|gb|EAL01495.1| hypothetical protein CaO19.7048 [Cand... 38 0.53
gi|21724191|gb|AAM28345.1| RPS6 [Culicoides sonorensis] 38 0.53
gi|15865325|emb|CAC82442.1| putative non-ribosomal nucleolar pro... 38 0.53
gi|21622344|emb|CAD37044.1| related to chromatin assembly comple... 38 0.53
gi|50555924|ref|XP_505370.1| hypothetical protein [Yarrowia lipo... 38 0.53
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 38 0.53
gi|37999865|sp|Q8BRH4|MLL3_MOUSE Myeloid/lymphoid or mixed-linea... 38 0.53
gi|49477175|ref|YP_035507.1| conserved hypothetical protein [Bac... 38 0.53
gi|7304957|ref|NP_038761.1| chromatin assembly factor 1, subunit... 38 0.53
gi|34907612|ref|NP_915153.1| P0696G06.24 [Oryza sativa (japonica... 38 0.53
gi|19424218|ref|NP_598232.1| hepatoma-derived growth factor-rela... 38 0.53
gi|49092700|ref|XP_407811.1| hypothetical protein AN3674.2 [Aspe... 38 0.53
gi|17509751|ref|NP_490771.1| putative nuclear protein, with a co... 38 0.53
gi|42780752|ref|NP_977999.1| penicillin-binding protein [Bacillu... 38 0.53
gi|17570615|ref|NP_508857.1| putative protein (XF654) [Caenorhab... 38 0.53
gi|33086440|gb|AAP92532.1| Ab1-013 [Rattus norvegicus] 38 0.53
gi|558071|gb|AAC47831.1| polymorphic antigen [Plasmodium falcipa... 38 0.53
gi|7715445|gb|AAF68038.1| centrosome-associated zinc finger prot... 38 0.53
gi|46140133|ref|XP_391757.1| hypothetical protein FG11581.1 [Gib... 38 0.53
gi|28175675|gb|AAH45114.1| Gm1959 protein [Mus musculus] 38 0.53
gi|27781329|gb|AAH42930.1| LOC398452 protein [Xenopus laevis] 38 0.53
gi|46433489|gb|EAK92927.1| hypothetical protein CaO19.13986 [Can... 38 0.53
gi|39597397|emb|CAE59627.1| Hypothetical protein CBG03040 [Caeno... 38 0.53
gi|16800784|ref|NP_471052.1| similar to minor capsid protein 160... 38 0.53
gi|32405850|ref|XP_323538.1| hypothetical protein [Neurospora cr... 38 0.53
gi|24308177|ref|NP_060439.1| hypothetical protein FLJ10006 [Homo... 38 0.53
gi|37360418|dbj|BAC98187.1| mKIAA1506 protein [Mus musculus] 38 0.53
gi|39597992|emb|CAE68684.1| Hypothetical protein CBG14595 [Caeno... 38 0.53
gi|33086446|gb|AAP92535.1| Ab1-042 [Rattus norvegicus] 38 0.53
gi|21309834|gb|AAM19759.1| glutamic acid-rich protein cNBL1500 [... 38 0.53
gi|50309789|ref|XP_454907.1| unnamed protein product [Kluyveromy... 38 0.53
gi|15146212|gb|AAK83589.1| AT3g57150/F24I3_230 [Arabidopsis thal... 38 0.53
gi|46431856|gb|EAK91379.1| hypothetical protein CaO19.7818 [Cand... 38 0.53
gi|50120311|ref|YP_049478.1| TolA protein [Erwinia carotovora su... 38 0.53
gi|32411593|ref|XP_326277.1| hypothetical protein [Neurospora cr... 37 0.69
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno... 37 0.69
gi|32410957|ref|XP_325959.1| hypothetical protein [Neurospora cr... 37 0.69
gi|20336207|ref|NP_612115.1| transcriptional regulator ATRX isof... 37 0.69
gi|42407352|dbj|BAD08813.1| unknown protein [Oryza sativa (japon... 37 0.69
gi|50747736|ref|XP_420968.1| PREDICTED: similar to SH2 domain bi... 37 0.69
gi|22024126|ref|NP_610786.2| CG8545-PA [Drosophila melanogaster]... 37 0.69
gi|39591236|emb|CAE73289.1| Hypothetical protein CBG20708 [Caeno... 37 0.69
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 37 0.69
gi|1778351|gb|AAB40698.1| putative DNA dependent ATPase and heli... 37 0.69
gi|23612234|ref|NP_703814.1| ribonuclease, putative [Plasmodium ... 37 0.69
gi|29789026|ref|NP_036739.1| neurofilament, heavy polypeptide [R... 37 0.69
gi|2306809|gb|AAC51657.1| X-linked nuclear protein [Homo sapiens] 37 0.69
gi|547644|sp|Q02508|HGV2_HALRO Protein HGV2 >gnl|BL_ORD_ID|13642... 37 0.69
gi|39587112|emb|CAE57579.1| Hypothetical protein CBG00558 [Caeno... 37 0.69
gi|6178156|dbj|BAA86200.1| nucleolin like protein CiRGG1 [Ciona ... 37 0.69
gi|39594466|emb|CAE72044.1| Hypothetical protein CBG19126 [Caeno... 37 0.69
gi|46109630|ref|XP_381873.1| hypothetical protein FG01697.1 [Gib... 37 0.69
gi|20336209|ref|NP_000480.2| transcriptional regulator ATRX isof... 37 0.69
gi|38502929|sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX ... 37 0.69
gi|17380440|sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX ... 37 0.69
gi|21429606|gb|AAM49796.1| heavy neurofilament NF-H [Rattus norv... 37 0.69
gi|213235|gb|AAA49279.1| electromotor neuron-associated protein 37 0.69
gi|33354053|dbj|BAC81110.1| ATRX [Homo sapiens] 37 0.69
gi|38502928|sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX ... 37 0.69
gi|24020878|gb|AAN40837.1| heavy neurofilament protein [Canis fa... 37 0.69
gi|17567971|ref|NP_508381.1| thioredoxin-like protein p19 (30.2 ... 37 0.69
gi|6680201|ref|NP_032259.1| hepatoma-derived growth factor-relat... 37 0.69
gi|13259497|ref|NP_002883.2| retinoblastoma-binding protein 1 is... 37 0.69
gi|29570466|gb|AAO91715.1| Hypothetical protein F53H1.4b [Caenor... 37 0.69
gi|1710030|sp|P29374|RBB1_HUMAN Retinoblastoma-binding protein 1... 37 0.69
gi|50547935|ref|XP_501437.1| hypothetical protein [Yarrowia lipo... 37 0.69
gi|205686|gb|AAA41695.1| heavy neurofilament subunit 37 0.69
gi|49119081|gb|AAH72746.1| Unknown (protein for IMAGE:5048405) [... 37 0.69
gi|7512482|pir||I38614 helicase II - human >gnl|BL_ORD_ID|551646... 37 0.69
gi|26339720|dbj|BAC33523.1| unnamed protein product [Mus musculus] 37 0.69
gi|29570467|gb|AAO91716.1| Hypothetical protein F53H1.4c [Caenor... 37 0.69
gi|7662238|ref|NP_055792.1| apoptotic chromatin condensation ind... 37 0.69
gi|37680460|ref|NP_935069.1| outer membrane integrity protein To... 37 0.69
gi|20336205|ref|NP_612114.1| transcriptional regulator ATRX isof... 37 0.69
gi|27529720|dbj|BAA31645.2| KIAA0670 protein [Homo sapiens] 37 0.69
gi|48097450|ref|XP_391898.1| similar to CG6066-PA [Apis mellifera] 37 0.69
gi|50754265|ref|XP_429273.1| PREDICTED: hypothetical protein XP_... 37 0.69
gi|40804952|gb|AAR91744.1| topoisomerase II [Trichomonas vaginalis] 37 0.69
gi|13259499|ref|NP_075376.1| retinoblastoma-binding protein 1 is... 37 0.69
gi|7513059|pir||T00365 hypothetical protein KIAA0670 - human (fr... 37 0.69
gi|7715437|gb|AAF68034.1| centrosome-associated zinc finger prot... 37 0.69
gi|1778352|gb|AAB40699.1| putative DNA dependent ATPase and heli... 37 0.69
gi|17537899|ref|NP_494907.1| surfeit locus protein 6 (54.3 kD) (... 37 0.69
gi|7494158|pir||T28156 DNA-directed RNA polymerase homolog - mal... 37 0.69
gi|50557280|ref|XP_506048.1| hypothetical protein [Yarrowia lipo... 37 0.69
gi|27365499|ref|NP_761027.1| TolA protein [Vibrio vulnificus CMC... 37 0.69
gi|46442861|gb|EAL02147.1| hypothetical protein CaO19.843 [Candi... 37 0.69
gi|13259501|ref|NP_075377.1| retinoblastoma-binding protein 1 is... 37 0.69
gi|25148366|ref|NP_500064.2| zn-finger-like, PHD finger family m... 37 0.69
gi|298684|gb|AAB25834.1| retinoblastoma binding protein 1 isofor... 37 0.69
gi|32410425|ref|XP_325693.1| predicted protein [Neurospora crass... 37 0.69
gi|17509191|ref|NP_491919.1| putative nuclear protein, with 3 co... 37 0.69
gi|39588177|emb|CAE68102.1| Hypothetical protein CBG13742 [Caeno... 37 0.69
gi|13277669|gb|AAH03741.1| Hdgfrp2 protein [Mus musculus] 37 0.69
gi|39587509|emb|CAE58447.1| Hypothetical protein CBG01584 [Caeno... 37 0.69
gi|42658959|ref|XP_098762.6| KIAA1416 protein [Homo sapiens] 37 0.69
gi|25395995|pir||G88637 protein F53H1.4 [imported] - Caenorhabdi... 37 0.69
gi|32564526|ref|NP_871983.1| surfeit locus protein 6 (2F234) [Ca... 37 0.69
gi|21283410|ref|NP_646498.1| hypothetical protein [Staphylococcu... 37 0.69
gi|34874861|ref|XP_237000.2| similar to opioid growth factor rec... 37 0.69
gi|13195767|gb|AAB25835.2| retinoblastoma binding protein 1 isof... 37 0.69
gi|298682|gb|AAB25833.1| retinoblastoma binding protein 1 isofor... 37 0.69
gi|17861848|gb|AAL39401.1| GM03068p [Drosophila melanogaster] 37 0.69
gi|34852059|ref|XP_215306.2| similar to DEAD/H (Asp-Glu-Ala-Asp/... 37 0.90
gi|46229415|gb|EAK90233.1| membrane protein with multiple cystei... 37 0.90
gi|17539584|ref|NP_500689.1| putative protein, with 2 coiled coi... 37 0.90
gi|39597669|emb|CAE68360.1| Hypothetical protein CBG14099 [Caeno... 37 0.90
gi|32409809|ref|XP_325385.1| predicted protein [Neurospora crass... 37 0.90
gi|34853474|ref|XP_215469.2| similar to Microtubule-associated p... 37 0.90
gi|32564850|ref|NP_871879.1| bromodomain containing protein fami... 37 0.90
gi|24657526|ref|NP_728981.1| CG32251-PA [Drosophila melanogaster... 37 0.90
gi|23509121|ref|NP_701789.1| hypothetical protein [Plasmodium fa... 37 0.90
gi|565108|gb|AAB31278.1| triadin 1=95 kda junction-specific prot... 37 0.90
gi|50426451|ref|XP_461822.1| unnamed protein product [Debaryomyc... 37 0.90
gi|32403722|ref|XP_322474.1| hypothetical protein [Neurospora cr... 37 0.90
gi|15599938|ref|NP_253432.1| translation initiation factor IF-2 ... 37 0.90
gi|16648923|gb|AAL24313.1| Unknown protein [Arabidopsis thaliana] 37 0.90
gi|50550845|ref|XP_502895.1| hypothetical protein [Yarrowia lipo... 37 0.90
gi|23612672|ref|NP_704233.1| hypothetical protein [Plasmodium fa... 37 0.90
gi|27817830|dbj|BAC55524.2| connectin/titin N2A-PEVK [Mus musculus] 37 0.90
gi|347377|gb|AAC37520.1| MLL-AF4 der(11) fusion protein >gnl|BL_... 37 0.90
gi|119357|sp|P14400|ENP1_TORCA Electromotor neuron-associated pr... 37 0.90
gi|32406786|ref|XP_324006.1| predicted protein [Neurospora crass... 37 0.90
gi|39595358|emb|CAE60395.1| Hypothetical protein CBG03997 [Caeno... 37 0.90
gi|49338108|gb|AAT64377.1| heat shock protein 82 [Steganacarus m... 37 0.90
gi|39589312|emb|CAE74341.1| Hypothetical protein CBG22059 [Caeno... 37 0.90
gi|38081223|ref|XP_359088.1| similar to pORF2 [Mus musculus] 37 0.90
gi|32451811|gb|AAH54663.1| Zgc:66236 protein [Danio rerio] 37 0.90
gi|46444105|gb|EAL03382.1| hypothetical protein CaO19.4945 [Cand... 37 0.90
gi|45768859|gb|AAH67639.1| Zgc:85804 protein [Danio rerio] 37 0.90
gi|23619234|ref|NP_705196.1| hypothetical protein [Plasmodium fa... 37 0.90
gi|15223583|ref|NP_176058.1| expressed protein [Arabidopsis thal... 37 0.90
gi|39584941|emb|CAE64365.1| Hypothetical protein CBG09052 [Caeno... 37 0.90
gi|50551099|ref|XP_503023.1| hypothetical protein [Yarrowia lipo... 37 0.90
gi|47211224|emb|CAF92780.1| unnamed protein product [Tetraodon n... 37 0.90
gi|4557509|ref|NP_001331.1| cylicin 2 [Homo sapiens] >gnl|BL_ORD... 37 0.90
gi|345890|pir||A44265 trithorax homolog HTX, version 2 - human 37 0.90
gi|5174569|ref|NP_005924.1| myeloid/lymphoid or mixed-lineage le... 37 0.90
gi|48096455|ref|XP_392460.1| similar to BMKETTIN [Apis mellifera] 37 0.90
gi|34305635|gb|AAQ63624.1| myeloid/lymphoid or mixed-lineage leu... 37 0.90
gi|1170364|sp|Q03164|HRX_HUMAN Zinc finger protein HRX (ALL-1) (... 37 0.90
gi|1490271|emb|CAA93625.1| ALL-1 protein [Homo sapiens] 37 0.90
>gi|17552222|ref|NP_497831.1| putative nuclear protein, with a coiled
coil domain, of bilaterial origin (45.1 kD) (3F258)
[Caenorhabditis elegans]
gi|2496897|sp|Q09252|YQ56_CAEEL HYPOTHETICAL 45.1 KD PROTEIN C16C10.6
IN CHROMOSOME III
gi|7496096|pir||T19327 hypothetical protein C16C10.6 - Caenorhabditis
elegans
gi|3874384|emb|CAA86744.1| Hypothetical protein C16C10.6
[Caenorhabditis elegans]
Length = 392
Score = 593 bits (1528), Expect = e-168
Identities = 316/392 (80%), Positives = 316/392 (80%)
Frame = -1
Query: 1179 MASKRHVGLNIRKKDEPKAAPIRVSSVFGXXXXXDNVPATATNMASASVIRVQKAAEREH 1000
MASKRHVGLNIRKKDEPKAAPIRVSSVFG DNVPATATNMASASVIRVQKAAEREH
Sbjct: 1 MASKRHVGLNIRKKDEPKAAPIRVSSVFGDDDDDDNVPATATNMASASVIRVQKAAEREH 60
Query: 999 QKAEAEDPTIFDYDGNYDEIQAIKNEKKEEARKADKNRESKYAENIIKAHAXXXXXXXXX 820
QKAEAEDPTIFDYDGNYDEIQAIKNEKKEEARKADKNRESKYAENIIKAHA
Sbjct: 61 QKAEAEDPTIFDYDGNYDEIQAIKNEKKEEARKADKNRESKYAENIIKAHARRQLEQFSR 120
Query: 819 XXXXXXXXXXXEGDEFDDKEVFVTGAYRKQQEEVKKHREQEAEEAAFNDMTSVQKQKLWE 640
EGDEFDDKEVFVTGAYRKQQEEVKKHREQEAEEAAFNDMTSVQKQKLWE
Sbjct: 121 EERQQLREREKEGDEFDDKEVFVTGAYRKQQEEVKKHREQEAEEAAFNDMTSVQKQKLWE 180
Query: 639 IGMGRTLLNDLARDPTAIKQRKKEQKNVRKREDSDEEIDPKPEKSDKKPAEKLKKSIYSD 460
IGMGRTLLNDLARDPTAIKQRKKEQKNVRKREDSDEEIDPKPEKSDKKPAEKLKKSIYSD
Sbjct: 181 IGMGRTLLNDLARDPTAIKQRKKEQKNVRKREDSDEEIDPKPEKSDKKPAEKLKKSIYSD 240
Query: 459 DSDEEKAPKPPQKNFEGDLKPGLNTVSKKKATTHAERIRQRNYTPTPPSSDDEGXXXXXX 280
DSDEEKAPKPPQKNFEGDLKPGLNTVSKKKATTHAERIRQRNYTPTPPSSDDEG
Sbjct: 241 DSDEEKAPKPPQKNFEGDLKPGLNTVSKKKATTHAERIRQRNYTPTPPSSDDEGARAPRA 300
Query: 279 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKSEKAXXXXXXXXXXXXXXXKEARLDGLK 100
EKSEKA KEARLDGLK
Sbjct: 301 RRRTSSPSPTSRKSIESRESGSRRSPEGKSEKSEKAPKISLKDKLKPKKIDKEARLDGLK 360
Query: 99 EILKQRNTEEDIEAARQRYFERKEQGIVVPPL 4
EILKQRNTEEDIEAARQRYFERKEQGIVVPPL
Sbjct: 361 EILKQRNTEEDIEAARQRYFERKEQGIVVPPL 392