Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C06A5_11
(852 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17505504|ref|NP_491737.1| RING zinc finger containing protein... 466 e-130
gi|32564044|ref|NP_871837.1| putative nuclear protein family mem... 357 2e-97
gi|17505506|ref|NP_491738.1| RiNg Finger protein (rnf-1) [Caenor... 142 1e-32
gi|31746687|gb|AAB52442.2| Ring finger protein protein 1 [Caenor... 140 3e-32
gi|39589340|emb|CAE74369.1| Hypothetical protein CBG22094 [Caeno... 80 6e-14
gi|17505905|ref|NP_492366.1| SecA-type chloroplast protein trans... 60 6e-08
gi|39589729|emb|CAE66964.1| Hypothetical protein CBG12358 [Caeno... 58 2e-07
gi|47216988|emb|CAG04930.1| unnamed protein product [Tetraodon n... 53 7e-06
gi|17509103|ref|NP_491267.1| SecA-type chloroplast protein trans... 53 1e-05
gi|39579379|emb|CAE74739.1| Hypothetical protein CBG22559 [Caeno... 52 1e-05
gi|15240646|ref|NP_196857.1| protein kinase family protein / ank... 52 2e-05
gi|50540516|ref|NP_001002723.1| zgc:92594 [Danio rerio] >gnl|BL_... 51 4e-05
gi|24665272|ref|NP_648886.1| CG16807-PA [Drosophila melanogaster... 50 5e-05
gi|46249651|gb|AAH68934.1| LOC397847 protein [Xenopus laevis] 50 6e-05
gi|1488047|gb|AAB05873.1| RING finger protein 50 6e-05
gi|17737481|ref|NP_523776.1| CG4909-PA [Drosophila melanogaster]... 50 6e-05
gi|7141241|gb|AAF37265.1| Plenty of SH3s [Drosophila melanogaster] 50 6e-05
gi|37547504|ref|XP_086409.5| KIAA2025 protein [Homo sapiens] 49 1e-04
gi|50751154|ref|XP_422281.1| PREDICTED: similar to KIAA2025 prot... 49 1e-04
gi|50511255|dbj|BAD32613.1| mKIAA2025 protein [Mus musculus] 49 1e-04
gi|20178303|sp|Q13049|HT2A_HUMAN Zinc-finger protein HT2A (72 kD... 49 1e-04
gi|27477053|ref|NP_444314.1| tripartite motif protein 32 [Mus mu... 49 1e-04
gi|21706608|gb|AAH34104.1| Tripartite motif protein 32 [Mus musc... 49 1e-04
gi|27714689|ref|XP_233039.1| similar to tripartite motif protein... 49 1e-04
gi|17509101|ref|NP_491266.1| tripartite motif protein TRIM2 (88.... 49 2e-04
gi|17542872|ref|NP_500811.1| predicted CDS, ankyrin-repeat conta... 49 2e-04
gi|7508073|pir||T29211 hypothetical protein T20F5.6 - Caenorhabd... 49 2e-04
gi|7496652|pir||T15689 hypothetical protein C28G1.3 - Caenorhabd... 48 2e-04
gi|47215445|emb|CAF97006.1| unnamed protein product [Tetraodon n... 48 2e-04
gi|25153296|ref|NP_741866.1| ring finger family member (XJ448) [... 48 2e-04
gi|39588856|emb|CAE69486.1| Hypothetical protein CBG15689 [Caeno... 48 3e-04
gi|17533953|ref|NP_494245.1| RING zinc finger containing protein... 48 3e-04
gi|47228275|emb|CAG07670.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|47218690|emb|CAG12414.1| unnamed protein product [Tetraodon n... 47 4e-04
gi|39585253|emb|CAE57496.1| Hypothetical protein CBG00468 [Caeno... 47 4e-04
gi|42661764|ref|XP_377554.1| similar to hypothetical protein MGC... 47 4e-04
gi|6912426|ref|NP_036342.1| TAT-interactive protein, 72-KD; trip... 47 4e-04
gi|16445412|ref|NP_434698.1| ret finger protein 2; candidate tum... 47 4e-04
gi|8928179|sp|O60858|RPF2_HUMAN Ret finger protein 2 (Leukemia a... 47 4e-04
gi|34879349|ref|XP_225981.2| similar to RIKEN cDNA 9130023G24 [R... 47 4e-04
gi|27370480|ref|NP_766554.1| SH3 domain containing ring finger 2... 47 4e-04
gi|12407425|gb|AAG53501.1| tripartite motif protein TRIM13 beta ... 47 4e-04
gi|26329287|dbj|BAC28382.1| unnamed protein product [Mus musculus] 47 4e-04
gi|25395612|pir||A88284 protein ZK945.5 [imported] - Caenorhabdi... 47 4e-04
gi|39586289|emb|CAE66700.1| Hypothetical protein CBG12045 [Caeno... 47 4e-04
gi|17538007|ref|NP_496180.1| ADP-ribosylation factor domain prot... 47 4e-04
gi|50755228|ref|XP_414662.1| PREDICTED: similar to SH3 domain co... 47 5e-04
gi|12407427|gb|AAG53502.1| tripartite motif protein TRIM13 [Mus ... 47 5e-04
gi|47219366|emb|CAG10995.1| unnamed protein product [Tetraodon n... 47 5e-04
gi|14149754|ref|NP_075722.1| tripartite motif protein 13; ret fi... 47 5e-04
gi|14581675|gb|AAK56791.1| putative transcription factor ret fin... 47 5e-04
gi|34875177|ref|XP_344418.1| similar to tripartite motif protein... 47 5e-04
gi|14009638|gb|AAK51689.1| putative tumor suppressor LEU5/RFP2 [... 47 5e-04
gi|12844086|dbj|BAB26231.1| unnamed protein product [Mus musculu... 47 7e-04
gi|34853282|ref|XP_345327.1| similar to RiNg Finger protein (rnf... 47 7e-04
gi|46250192|gb|AAH68669.1| MGC81061 protein [Xenopus laevis] 47 7e-04
gi|26379548|dbj|BAC25419.1| unnamed protein product [Mus musculus] 47 7e-04
gi|47226889|emb|CAG05781.1| unnamed protein product [Tetraodon n... 46 9e-04
gi|47195169|emb|CAF94043.1| unnamed protein product [Tetraodon n... 46 9e-04
gi|39597154|emb|CAE59381.1| Hypothetical protein CBG02734 [Caeno... 46 9e-04
gi|9837125|gb|AAG00432.1| membrane-associated nucleic acid bindi... 46 0.001
gi|31874062|emb|CAD97947.1| hypothetical protein [Homo sapiens] 46 0.001
gi|27881691|gb|AAH44642.1| Unknown (protein for MGC:52176) [Homo... 46 0.001
gi|50757133|ref|XP_415394.1| PREDICTED: similar to membrane-asso... 46 0.001
gi|17533927|ref|NP_494271.1| major sperm protein domain and Zn-... 46 0.001
gi|17538073|ref|NP_494238.1| ADP-ribosylation factor domain prot... 46 0.001
gi|46250250|gb|AAH68444.1| Unknown (protein for MGC:86976) [Homo... 46 0.001
gi|27436877|ref|NP_775107.1| tripartite motif-containing 59; mou... 46 0.001
gi|34880785|ref|XP_222801.2| similar to KIAA2025 protein [Rattus... 46 0.001
gi|38074631|ref|XP_130233.3| membrane-associated nucleic acid bi... 46 0.001
gi|34853881|ref|XP_231249.2| similar to CG16807-PA [Rattus norve... 46 0.001
gi|21748764|dbj|BAC03481.1| unnamed protein product [Homo sapiens] 46 0.001
gi|39589375|emb|CAE74404.1| Hypothetical protein CBG22136 [Caeno... 46 0.001
gi|25395432|pir||H88071 protein ZK1240.3 [imported] - Caenorhabd... 46 0.001
gi|7499716|pir||T21286 hypothetical protein F23A7.6 - Caenorhabd... 45 0.002
gi|28484764|ref|XP_283711.1| similar to RIKEN cDNA 9130020G10 [M... 45 0.002
gi|17539210|ref|NP_500203.1| tripartite motif protein 50 like (6... 45 0.002
gi|13775218|ref|NP_112587.1| similar to mouse 1110061N23Rik prot... 45 0.002
gi|47506875|gb|AAH70974.1| MGC78802 protein [Xenopus laevis] 45 0.002
gi|50757528|ref|XP_415552.1| PREDICTED: similar to hypothetical ... 45 0.002
gi|18676781|dbj|BAB85025.1| unnamed protein product [Homo sapiens] 45 0.003
gi|47523460|ref|NP_999351.1| tripartite motif protein 50 [Sus sc... 45 0.003
gi|39588341|emb|CAE72692.1| Hypothetical protein CBG19915 [Caeno... 45 0.003
gi|47211208|emb|CAF90165.1| unnamed protein product [Tetraodon n... 45 0.003
gi|47578103|ref|NP_689763.2| SH3 domain containing ring finger 2... 45 0.003
gi|50730893|ref|XP_417067.1| PREDICTED: similar to ret finger pr... 45 0.003
gi|34857890|ref|XP_342269.1| similar to KIAA0517 protein [Rattus... 44 0.003
gi|47123933|gb|AAH70792.1| MGC83839 protein [Xenopus laevis] 44 0.003
gi|50746202|ref|XP_420402.1| PREDICTED: similar to SH3 multiple ... 44 0.003
gi|47227681|emb|CAG09678.1| unnamed protein product [Tetraodon n... 44 0.003
gi|17531269|ref|NP_494234.1| predicted CDS, RING zinc finger con... 44 0.003
gi|28279440|gb|AAH46256.1| Rnf8-prov protein [Xenopus laevis] 44 0.003
gi|39594727|emb|CAE70595.1| Hypothetical protein CBG17264 [Caeno... 44 0.004
gi|26338478|dbj|BAC32910.1| unnamed protein product [Mus musculus] 44 0.004
gi|47939778|gb|AAH72221.1| MGC81405 protein [Xenopus laevis] 44 0.004
gi|47218749|emb|CAG02735.1| unnamed protein product [Tetraodon n... 44 0.004
gi|7513001|pir||T00082 hypothetical protein KIAA0517 - human (fr... 44 0.004
gi|47222746|emb|CAG01713.1| unnamed protein product [Tetraodon n... 44 0.004
gi|14010849|ref|NP_109631.1| tripartite motif protein TRIM2; neu... 44 0.004
gi|13446227|ref|NP_056086.1| tripartite motif-containing 2; trip... 44 0.004
gi|39591328|emb|CAE73381.1| Hypothetical protein CBG20821 [Caeno... 44 0.004
gi|26333433|dbj|BAC30434.1| unnamed protein product [Mus musculus] 44 0.004
gi|30842804|ref|NP_851594.1| tripartite motif protein 50 [Rattus... 44 0.006
gi|30142677|ref|NP_839971.1| tripartite motif protein 50 [Mus mu... 44 0.006
gi|25151067|ref|NP_740796.1| tripartite motif protein 32 like fa... 44 0.006
gi|30794216|ref|NP_112223.1| tripartite motif-containing 56 [Hom... 44 0.006
gi|12848905|dbj|BAB28131.1| unnamed protein product [Mus musculus] 44 0.006
gi|21751638|dbj|BAC04004.1| unnamed protein product [Homo sapiens] 44 0.006
gi|45387641|ref|NP_991170.1| TRAF interacting protein [Danio rer... 44 0.006
gi|29648307|ref|NP_080139.2| mouse RING finger 1; tumor suppress... 44 0.006
gi|47124822|gb|AAH70823.1| MGC83908 protein [Xenopus laevis] 44 0.006
gi|33869766|gb|AAH05847.2| TRIM56 protein [Homo sapiens] 44 0.006
gi|33877724|gb|AAH11882.1| TRIM56 protein [Homo sapiens] 44 0.006
gi|17535019|ref|NP_494227.1| RING zinc finger containing protein... 44 0.006
gi|47227859|emb|CAG09022.1| unnamed protein product [Tetraodon n... 44 0.006
gi|47224983|emb|CAF97398.1| unnamed protein product [Tetraodon n... 44 0.006
gi|31227042|ref|XP_317815.1| ENSANGP00000004820 [Anopheles gambi... 44 0.006
gi|48101591|ref|XP_392690.1| similar to GTP-binding protein ARD-... 44 0.006
gi|17531261|ref|NP_494232.1| zn-finger, RING and Zn-finger, B-bo... 43 0.008
gi|33563311|ref|NP_789804.1| RIKEN cDNA 1110061N23 [Mus musculus... 43 0.008
gi|47222745|emb|CAG01712.1| unnamed protein product [Tetraodon n... 43 0.008
gi|17534001|ref|NP_496523.1| ADP-ribosylation factor domain prot... 43 0.008
gi|17561342|ref|NP_507996.1| protein factor like family member (... 43 0.008
gi|50740527|ref|XP_419487.1| PREDICTED: similar to Ubiquitin lig... 43 0.008
gi|22749455|ref|NP_689950.1| hypothetical protein MGC33993 [Homo... 43 0.008
gi|34147266|ref|NP_899027.1| hypothetical protein C630023L15 [Mu... 43 0.008
gi|26330171|dbj|BAC25078.1| unnamed protein product [Mus musculus] 43 0.008
gi|39591327|emb|CAE73380.1| Hypothetical protein CBG20820 [Caeno... 43 0.010
gi|32564316|ref|NP_494241.2| zn-finger, RING and Zn-finger, B-bo... 43 0.010
gi|50746128|ref|XP_420365.1| PREDICTED: similar to tripartite mo... 43 0.010
gi|34857519|ref|XP_345222.1| similar to RIKEN cDNA 2310035M22 [R... 43 0.010
gi|49117096|gb|AAH72842.1| Unknown (protein for MGC:80218) [Xeno... 43 0.010
gi|39586290|emb|CAE66701.1| Hypothetical protein CBG12046 [Caeno... 43 0.010
gi|25395435|pir||B88072 protein ZK1240.2 [imported] - Caenorhabd... 43 0.010
gi|49257592|gb|AAH74184.1| Unknown (protein for MGC:82029) [Xeno... 43 0.010
gi|49522062|gb|AAH75100.1| Unknown (protein for MGC:79572) [Xeno... 43 0.010
gi|50754723|ref|XP_414478.1| PREDICTED: similar to Zinc finger p... 42 0.013
gi|31746567|gb|AAF60661.2| Hypothetical protein Y47G6A.14 [Caeno... 42 0.013
gi|31241283|ref|XP_321072.1| ENSANGP00000018314 [Anopheles gambi... 42 0.013
gi|7508991|pir||T32840 hypothetical protein W04H10.3 - Caenorhab... 42 0.013
gi|50759253|ref|XP_417589.1| PREDICTED: similar to hypothetical ... 42 0.013
gi|32564296|ref|NP_493768.3| NHL domain containing (nhl-3) [Caen... 42 0.013
gi|17563664|ref|NP_506687.1| membrane-associated nucleic acid bi... 42 0.013
gi|39590419|emb|CAE66158.1| Hypothetical protein CBG11389 [Caeno... 42 0.013
gi|50757994|ref|XP_415709.1| PREDICTED: similar to tripartite mo... 42 0.017
gi|39587801|emb|CAE67819.1| Hypothetical protein CBG13399 [Caeno... 42 0.017
gi|47216281|emb|CAF96577.1| unnamed protein product [Tetraodon n... 42 0.017
gi|39586963|emb|CAE62898.1| Hypothetical protein CBG07087 [Caeno... 42 0.017
gi|48102895|ref|XP_395454.1| similar to Ubiquitin ligase protein... 42 0.017
gi|17549986|ref|NP_509564.1| membrane-associated nucleic acid bi... 42 0.017
gi|46250277|gb|AAH68644.1| LOC397846 protein [Xenopus laevis] 42 0.022
gi|47216792|emb|CAG10114.1| unnamed protein product [Tetraodon n... 42 0.022
gi|41055466|ref|NP_956716.1| hypothetical protein MGC64214 [Dani... 42 0.022
gi|12407375|gb|AAG53476.1| tripartite motif protein TRIM3 isofor... 42 0.022
gi|12407373|gb|AAG53475.1| tripartite motif protein TRIM3 isofor... 42 0.022
gi|47215426|emb|CAG01123.1| unnamed protein product [Tetraodon n... 42 0.022
gi|25153293|ref|NP_509495.2| RING zinc finger containing protein... 42 0.022
gi|39586085|emb|CAE69161.1| Hypothetical protein CBG15192 [Caeno... 42 0.022
gi|32454737|ref|NP_150594.2| tripartite motif-containing 3; brai... 42 0.022
gi|21362992|sp|O75382|TRM3_HUMAN Tripartite motif protein 3 (RIN... 42 0.022
gi|47227079|emb|CAG00441.1| unnamed protein product [Tetraodon n... 42 0.022
gi|15219056|ref|NP_173584.1| preprotein translocase secA family ... 41 0.029
gi|48103749|ref|XP_395638.1| similar to putative scaffolding pro... 41 0.029
gi|4506561|ref|NP_002929.1| ring finger protein 4; small nuclear... 41 0.029
gi|17563724|ref|NP_506726.1| predicted CDS, SecA-type chloroplas... 41 0.029
gi|17553358|ref|NP_497167.1| predicted CDS, zinc-finger protein ... 41 0.029
gi|543840|sp|P36407|ARD1_RAT GTP-binding protein ARD-1 (ADP-ribo... 41 0.029
gi|29789263|ref|NP_109656.1| tripartite motif protein 23; tripar... 41 0.029
gi|25395437|pir||D88072 protein ZK1240.1 [imported] - Caenorhabd... 41 0.029
gi|40788314|dbj|BAA31621.2| KIAA0646 protein [Homo sapiens] 41 0.029
gi|30584345|gb|AAP36421.1| Homo sapiens ring finger protein (C3H... 41 0.029
gi|50415349|gb|AAH77512.1| Unknown (protein for MGC:82681) [Xeno... 41 0.029
gi|50807185|ref|XP_424549.1| PREDICTED: similar to Midline 2 pro... 41 0.029
gi|4504867|ref|NP_003949.1| ring finger protein 8 isoform 1; C3H... 41 0.029
gi|32564318|ref|NP_494239.2| zn-finger, RING and Zn-finger, B-bo... 41 0.029
gi|47940004|gb|AAH72370.1| MGC84499 protein [Xenopus laevis] 41 0.029
gi|32564312|ref|NP_494243.2| zn-finger, RING and Zn-finger, B-bo... 41 0.029
gi|25518647|pir||F86349 hypothetical protein F8K7.7 [imported] -... 41 0.029
gi|17529236|gb|AAL38845.1| putative SecA-type chloroplast protei... 41 0.029
gi|9507057|ref|NP_062055.1| ring finger protein 4 [Rattus norveg... 41 0.029
gi|50747306|ref|XP_420830.1| PREDICTED: similar to RING finger p... 41 0.029
gi|33859620|ref|NP_035408.1| ring finger protein 4 [Mus musculus... 41 0.029
gi|33468961|ref|NP_061368.1| tripartite motif protein 3; ring fi... 41 0.029
gi|13929112|ref|NP_113974.1| ring finger protein 22 [Rattus norv... 41 0.029
gi|47938645|gb|AAH72332.1| LOC432253 protein [Xenopus laevis] 41 0.029
gi|32698740|ref|NP_065921.1| SH3 multiple domains 2; SH3 domain ... 41 0.038
gi|10432612|dbj|BAB13822.1| unnamed protein product [Homo sapiens] 41 0.038
gi|17368629|sp|Q99MV7|RN17_MOUSE RING finger protein 17 >gnl|BL_... 41 0.038
gi|15208641|ref|NP_150230.1| ADP-ribosylation factor domain prot... 41 0.038
gi|34921712|sp|Q8BGX0|ARD1_MOUSE GTP-binding protein ARD-1 (ADP-... 41 0.038
gi|4502197|ref|NP_001647.1| ADP-ribosylation factor domain prote... 41 0.038
gi|26326825|dbj|BAC27156.1| unnamed protein product [Mus musculus] 41 0.038
gi|422756|pir||A46054 GTP-binding protein ARD 1 - human 41 0.038
gi|39588892|emb|CAE69522.1| Hypothetical protein CBG15731 [Caeno... 41 0.038
gi|26354048|dbj|BAC40654.1| unnamed protein product [Mus musculus] 41 0.038
gi|17137804|ref|NP_477509.1| CG5595-PA [Drosophila melanogaster]... 41 0.038
gi|2388783|emb|CAA04797.1| DRING protein [Drosophila melanogaster] 41 0.038
gi|39594794|emb|CAE70662.1| Hypothetical protein CBG17369 [Caeno... 41 0.038
gi|34853747|ref|XP_342184.1| ADP-ribosylation factor domain prot... 41 0.038
gi|1488045|gb|AAB05872.1| RING finger protein 41 0.038
gi|47939821|gb|AAH72302.1| LOC432183 protein [Xenopus laevis] 41 0.038
gi|17536885|ref|NP_496525.1| ADP-ribosylation factor domain prot... 41 0.038
gi|47228454|emb|CAG05274.1| unnamed protein product [Tetraodon n... 41 0.038
gi|15208643|ref|NP_150231.1| ADP-ribosylation factor domain prot... 41 0.038
gi|21392032|gb|AAM48370.1| LD44641p [Drosophila melanogaster] 40 0.049
gi|50761533|ref|XP_424752.1| PREDICTED: similar to GTP-binding p... 40 0.049
gi|41282041|ref|NP_941371.1| SH3 multiple domains 2 isoform 2; p... 40 0.049
gi|10946922|ref|NP_067481.1| SH3 multiple domains 2 isoform 1; p... 40 0.049
gi|49077754|ref|XP_402700.1| hypothetical protein UM05085.1 [Ust... 40 0.049
gi|47213267|emb|CAG12384.1| unnamed protein product [Tetraodon n... 40 0.049
gi|39591333|emb|CAE73386.1| Hypothetical protein CBG20826 [Caeno... 40 0.049
gi|22902089|gb|AAC60292.2| fKIAA0680 [Takifugu rubripes] 40 0.049
gi|47223709|emb|CAF99318.1| unnamed protein product [Tetraodon n... 40 0.049
gi|37574100|ref|NP_932129.1| RIKEN cDNA F730114J12 [Mus musculus... 40 0.049
gi|50510955|dbj|BAD32463.1| mKIAA1494 protein [Mus musculus] 40 0.049
gi|26352916|dbj|BAC40088.1| unnamed protein product [Mus musculus] 40 0.049
gi|24649543|ref|NP_651214.1| CG13605-PA [Drosophila melanogaster... 40 0.049
gi|47224345|emb|CAG09191.1| unnamed protein product [Tetraodon n... 40 0.049
gi|50786249|ref|XP_423490.1| PREDICTED: similar to Tripartite mo... 40 0.049
gi|38454266|ref|NP_942059.1| putative scaffolding protein POSH [... 40 0.049
gi|39586523|emb|CAE73650.1| Hypothetical protein CBG21151 [Caeno... 40 0.049
gi|21490003|ref|NP_038922.1| ring finger protein 17; Max dimeriz... 40 0.064
gi|39580294|emb|CAE73081.1| Hypothetical protein CBG20457 [Caeno... 40 0.064
gi|4827065|ref|NP_005073.1| tripartite motif-containing 25; Zinc... 40 0.064
gi|17556116|ref|NP_497677.1| putative protein, with at least 4 t... 40 0.064
gi|50734173|ref|XP_418995.1| PREDICTED: similar to RIKEN cDNA A9... 40 0.064
gi|47202955|emb|CAF94885.1| unnamed protein product [Tetraodon n... 40 0.064
gi|15079952|gb|AAH11763.1| TRIM4 protein [Homo sapiens] >gnl|BL_... 40 0.064
gi|47220874|emb|CAG03081.1| unnamed protein product [Tetraodon n... 40 0.064
gi|6323060|ref|NP_013132.1| Single-stranded DNA-dependent ATPase... 40 0.064
gi|39598079|emb|CAE68771.1| Hypothetical protein CBG14711 [Caeno... 40 0.064
gi|15011941|ref|NP_149082.1| tripartite motif protein TRIM4 isof... 40 0.064
gi|39591330|emb|CAE73383.1| Hypothetical protein CBG20823 [Caeno... 40 0.064
gi|33469244|gb|AAQ19671.1| malin [Homo sapiens] 40 0.064
gi|39586534|emb|CAE73661.1| Hypothetical protein CBG21169 [Caeno... 40 0.064
gi|42656052|ref|XP_377555.1| similar to RIKEN cDNA 5830442J12 [H... 40 0.084
gi|50752528|ref|XP_422816.1| PREDICTED: similar to tumor suppres... 40 0.084
gi|34785654|gb|AAH57094.1| Unknown (protein for MGC:73514) [Mus ... 40 0.084
gi|37535002|ref|NP_921803.1| putative PGPD14 protein (pollen ger... 40 0.084
gi|26324804|dbj|BAC26156.1| unnamed protein product [Mus musculu... 40 0.084
gi|19075245|ref|NP_587745.1| zf-C3H4C zinc finger protein [Schiz... 40 0.084
gi|48128426|ref|XP_396629.1| similar to ENSANGP00000020736 [Apis... 40 0.084
gi|50543428|ref|XP_499880.1| hypothetical protein [Yarrowia lipo... 40 0.084
gi|30023818|ref|NP_835226.1| tripartite motif protein 50A; tripa... 40 0.084
gi|29465650|gb|AAL91072.1| tripartite motif protein 50 isoform b... 40 0.084
gi|34873114|ref|XP_233724.2| similar to RIKEN cDNA 9430015G10 [R... 40 0.084
gi|283833|pir||A43906 nuclear phosphoprotein xnf7 - African claw... 40 0.084
gi|15221860|ref|NP_173311.1| zinc finger (C3HC4-type RING finger... 40 0.084
gi|17567151|ref|NP_508270.1| tripartite motif protein TRIM2 like... 40 0.084
gi|40255283|ref|NP_940988.2| malin [Homo sapiens] >gnl|BL_ORD_ID... 40 0.084
gi|47224831|emb|CAG06401.1| unnamed protein product [Tetraodon n... 40 0.084
gi|50759404|ref|XP_425752.1| PREDICTED: similar to hypothetical ... 40 0.084
gi|15234955|ref|NP_192753.1| zinc finger (C3HC4-type RING finger... 39 0.11
gi|1311667|gb|AAB35876.1| nuclear factor 7 [Xenopus laevis] 39 0.11
gi|39598081|emb|CAE68773.1| Hypothetical protein CBG14715 [Caeno... 39 0.11
gi|27734873|ref|NP_775828.1| ring finger protein 152 [Homo sapie... 39 0.11
gi|280546|pir||S28275 hypothetical protein F54G8.4 - Caenorhabdi... 39 0.11
gi|17553622|ref|NP_499028.1| NHL domain containing (109.1 kD) (n... 39 0.11
gi|39585013|emb|CAE62664.1| Hypothetical protein CBG06802 [Caeno... 39 0.11
gi|47215415|emb|CAG01112.1| unnamed protein product [Tetraodon n... 39 0.11
gi|257212|gb|AAB23590.1| nucleotide-binding protein with zinc-fi... 39 0.11
gi|15221223|ref|NP_177577.1| zinc finger (C3HC4-type RING finger... 39 0.11
gi|21592563|gb|AAM64512.1| putative RING zinc finger protein [Ar... 39 0.11
gi|50510567|dbj|BAD32269.1| mKIAA0646 protein [Mus musculus] 39 0.11
gi|47123203|gb|AAH70851.1| LOC431932 protein [Xenopus laevis] 39 0.11
gi|47124700|gb|AAH70612.1| MGC81341 protein [Xenopus laevis] 39 0.11
gi|12855490|dbj|BAB30354.1| unnamed protein product [Mus musculus] 39 0.11
gi|23956112|ref|NP_067394.1| ring finger protein 8; ActA binding... 39 0.11
gi|39586215|emb|CAE66626.1| Hypothetical protein CBG11962 [Caeno... 39 0.11
gi|17556196|ref|NP_497528.1| predicted CDS, tripartite motif pro... 39 0.14
gi|47222975|emb|CAF99131.1| unnamed protein product [Tetraodon n... 39 0.14
gi|39590276|emb|CAE66014.1| Hypothetical protein CBG11206 [Caeno... 39 0.14
gi|15208660|ref|NP_003132.2| 52kD Ro/SSA autoantigen; Sjogren sy... 39 0.14
gi|38679905|ref|NP_775818.2| hypothetical protein LOC201292 [Hom... 39 0.14
gi|15226289|ref|NP_180361.1| zinc finger (C3HC4-type RING finger... 39 0.14
gi|14994115|gb|AAK76432.1| SSA1 [Homo sapiens] 39 0.14
gi|30520249|ref|NP_848894.1| RIKEN cDNA A930029B02 gene [Mus mus... 39 0.14
gi|33878170|gb|AAH21259.1| LOC201292 protein [Homo sapiens] 39 0.14
gi|27680501|ref|XP_219409.1| similar to hypothetical protein FLJ... 39 0.14
gi|34871437|ref|XP_220473.2| similar to hypothetical protein [Ra... 39 0.14
gi|7248892|gb|AAF43710.1| Cbl proto-oncogene protein [Xenopus la... 39 0.14
gi|47227861|emb|CAG09024.1| unnamed protein product [Tetraodon n... 39 0.14
gi|17553362|ref|NP_497169.1| predicted CDS, tripartite motif pro... 39 0.14
gi|30687050|ref|NP_850278.1| zinc finger (C3HC4-type RING finger... 39 0.14
gi|25151349|ref|NP_496089.2| ARF-related in C-term, ARD family, ... 39 0.19
gi|47212269|emb|CAF96465.1| unnamed protein product [Tetraodon n... 39 0.19
gi|28804294|dbj|BAC58029.1| probable RING-B-box-coiled coil prot... 39 0.19
gi|15234956|ref|NP_192754.1| zinc finger (C3HC4-type RING finger... 39 0.19
gi|21450806|ref|NP_659488.1| hypothetical protein MGC4734 [Homo ... 39 0.19
gi|47222920|emb|CAF99076.1| unnamed protein product [Tetraodon n... 39 0.19
gi|23943803|ref|NP_705724.1| RIKEN cDNA 5830442J12 [Mus musculus... 39 0.19
gi|47212248|emb|CAF93161.1| unnamed protein product [Tetraodon n... 39 0.19
gi|38569180|emb|CAD40832.2| OSJNBa0086B14.4 [Oryza sativa (japon... 39 0.19
gi|7510990|pir||T27752 hypothetical protein ZK1320.6 - Caenorhab... 39 0.19
gi|50416449|gb|AAH78005.1| Unknown (protein for IMAGE:4959220) [... 39 0.19
gi|4105798|gb|AAD02556.1| PGPD14 [Petunia x hybrida] 39 0.19
gi|38091370|ref|XP_111186.2| similar to hypothetical protein [Mu... 38 0.24
gi|17510013|ref|NP_491164.1| RING zinc finger containing protein... 38 0.24
gi|50405111|ref|YP_054203.1| hypothetical protein, RING Zn-finge... 38 0.24
gi|41471313|gb|AAS07397.1| unknown [Homo sapiens] 38 0.24
gi|14670266|ref|NP_148977.1| tripartite motif protein TRIM4 isof... 38 0.24
gi|17542374|ref|NP_500945.1| tripartite motif-containing 2 like ... 38 0.24
gi|38092305|ref|XP_359262.1| similar to hypothetical protein [Mu... 38 0.24
gi|321074|pir||S28418 probable zinc-binding protein - Iberian ri... 38 0.24
gi|584704|sp|Q02084|A33_PLEWA Zinc-binding protein A33 >gnl|BL_O... 38 0.24
gi|41351076|gb|AAH65891.1| LOC402959 protein [Danio rerio] 38 0.24
gi|41055764|ref|NP_956469.1| similar to tripartite motif protein... 38 0.24
gi|41235779|ref|NP_958761.1| similar to tripartite motif-contain... 38 0.24
gi|28278996|gb|AAH45615.1| A130009K11Rik protein [Mus musculus] 38 0.24
gi|24650103|ref|NP_733111.1| CG5071-PA [Drosophila melanogaster]... 38 0.24
gi|39589410|emb|CAE74439.1| Hypothetical protein CBG22172 [Caeno... 38 0.24
gi|50256761|gb|EAL19481.1| hypothetical protein CNBG4280 [Crypto... 38 0.24
gi|39591331|emb|CAE73384.1| Hypothetical protein CBG20824 [Caeno... 38 0.24
gi|15451615|gb|AAK98739.1| Hypothetical protein with similarity ... 38 0.24
gi|37718893|gb|AAR01764.1| expressed protein [Oryza sativa (japo... 38 0.24
gi|29245606|gb|EAA37235.1| GLP_91_8176_7298 [Giardia lamblia ATC... 38 0.24
gi|24650101|ref|NP_651406.1| CG5071-PB [Drosophila melanogaster]... 38 0.24
gi|39589263|emb|CAE57996.1| Hypothetical protein CBG01059 [Caeno... 38 0.32
gi|29246617|gb|EAA38207.1| GLP_13_15577_14618 [Giardia lamblia A... 38 0.32
gi|15219551|ref|NP_171873.1| zinc finger (C3HC4-type RING finger... 38 0.32
gi|25145382|ref|NP_497780.2| BReast and ovarian Cancer susceptib... 38 0.32
gi|47215450|emb|CAF97011.1| unnamed protein product [Tetraodon n... 38 0.32
gi|22024206|ref|NP_611390.2| CG15105-PA [Drosophila melanogaster... 38 0.32
gi|50305881|ref|XP_452901.1| unnamed protein product [Kluyveromy... 38 0.32
gi|47224884|emb|CAG06454.1| unnamed protein product [Tetraodon n... 38 0.32
gi|39586291|emb|CAE66702.1| Hypothetical protein CBG12047 [Caeno... 38 0.32
gi|7497098|pir||T19770 hypothetical protein C36A4.8 - Caenorhabd... 38 0.32
gi|38524612|ref|NP_942150.1| tripartite motif-containing 50C [Ho... 38 0.32
gi|34860175|ref|XP_344968.1| similar to hypothetical protein FLJ... 38 0.32
gi|9635264|ref|NP_059162.1| ORF14 [Xestia c-nigrum granulovirus]... 38 0.32
gi|32880219|ref|NP_872596.1| Sjogren syndrome antigen A1 (52kDa,... 38 0.32
gi|21357313|ref|NP_649596.1| CG10981-PA [Drosophila melanogaster... 37 0.42
gi|15226078|ref|NP_179128.1| zinc finger (C3HC4-type RING finger... 37 0.42
gi|28484812|ref|XP_286106.1| similar to ring finger protein 129 ... 37 0.42
gi|34875088|ref|XP_224231.2| similar to hypothetical protein [Ra... 37 0.42
gi|38073535|ref|XP_355250.1| similar to KIAA2025 protein [Mus mu... 37 0.42
gi|32414701|ref|XP_327830.1| hypothetical protein [Neurospora cr... 37 0.42
gi|23593295|ref|NP_473016.2| hypothetical protein [Plasmodium fa... 37 0.42
gi|15241453|ref|NP_199241.1| zinc finger (C3HC4-type RING finger... 37 0.42
gi|7494154|pir||F71614 chromatinic RING finger DRING protein hom... 37 0.42
gi|31560638|ref|NP_033303.2| 52kD Ro/SSA autoantigen; Sjogren sy... 37 0.42
gi|3024571|sp|Q62191|RO52_MOUSE 52 kDa Ro protein (Sjogren syndr... 37 0.42
gi|15220067|ref|NP_175132.1| zinc finger (C3HC4-type RING finger... 37 0.42
gi|24644441|ref|NP_731017.1| CG10981-PB [Drosophila melanogaster... 37 0.42
gi|15218393|ref|NP_177367.1| zinc finger (C3HC4-type RING finger... 37 0.42
gi|21536798|gb|AAM61130.1| RING-H2 zinc finger protein ATL3, put... 37 0.42
gi|23508752|ref|NP_701420.1| hypothetical protein [Plasmodium fa... 37 0.42
gi|40539033|gb|AAR87290.1| expressed protein [Oryza sativa (japo... 37 0.42
gi|49077394|ref|XP_402562.1| hypothetical protein UM04947.1 [Ust... 37 0.54
gi|13905262|gb|AAH06929.1| Traip protein [Mus musculus] 37 0.54
gi|47228165|emb|CAF97794.1| unnamed protein product [Tetraodon n... 37 0.54
gi|39586244|emb|CAE66655.1| Hypothetical protein CBG11992 [Caeno... 37 0.54
gi|26347621|dbj|BAC37459.1| unnamed protein product [Mus musculus] 37 0.54
gi|41208934|ref|XP_372750.1| similar to ret finger protein-like ... 37 0.54
gi|49115834|gb|AAH73577.1| Unknown (protein for MGC:82874) [Xeno... 37 0.54
gi|24762433|ref|NP_611847.2| CG5591-PA [Drosophila melanogaster]... 37 0.54
gi|39595761|emb|CAE67264.1| Hypothetical protein CBG12711 [Caeno... 37 0.54
gi|48101992|ref|XP_392730.1| similar to NHL domain containing (n... 37 0.54
gi|47204111|emb|CAG14116.1| unnamed protein product [Tetraodon n... 37 0.54
gi|50284977|ref|XP_444917.1| unnamed protein product [Candida gl... 37 0.54
gi|38101531|gb|EAA48481.1| hypothetical protein MG00139.4 [Magna... 37 0.54
gi|46124783|ref|XP_386945.1| hypothetical protein FG06769.1 [Gib... 37 0.54
gi|31560535|ref|NP_035764.2| TRAF-interacting protein [Mus muscu... 37 0.54
gi|2039306|gb|AAB52994.1| mTRIP [Mus musculus] 37 0.54
gi|16924209|gb|AAH17374.1| TRAF-interacting protein [Mus musculus] 37 0.54
gi|50755936|ref|XP_425254.1| PREDICTED: similar to topoisomerase... 37 0.54
gi|2132275|pir||S69076 hypothetical protein YPR093c - yeast (Sac... 37 0.54
gi|27228994|ref|NP_080062.2| RIKEN cDNA 9130020G10 [Mus musculus... 37 0.54
gi|37362706|ref|NP_015418.2| Hypothetical ORF; Ypr093cp [Sacchar... 37 0.54
gi|30155118|ref|XP_292796.2| similar to ret finger protein-like ... 37 0.54
gi|47213477|emb|CAF91134.1| unnamed protein product [Tetraodon n... 37 0.54
gi|39598043|emb|CAE68735.1| Hypothetical protein CBG14665 [Caeno... 37 0.54
gi|34896014|ref|NP_909351.1| ESTs AU075348(C11252),C98151(C0804)... 37 0.54
gi|2039304|gb|AAB52993.1| hTRIP [Homo sapiens] 37 0.54
gi|50539992|ref|NP_001002466.1| zgc:92894 [Danio rerio] >gnl|BL_... 37 0.71
gi|6453574|emb|CAB61339.1| carotenoid regulatory protein [Mucor ... 37 0.71
gi|1770499|emb|CAA69165.1| put. ring protein [Homo sapiens] 37 0.71
gi|48716403|dbj|BAD23012.1| RING zinc finger protein-like [Oryza... 37 0.71
gi|48098133|ref|XP_393984.1| similar to ENSANGP00000019879 [Apis... 37 0.71
gi|28422507|gb|AAH46935.1| LOC398559 protein [Xenopus laevis] 37 0.71
gi|49903336|gb|AAH76671.1| Unknown (protein for MGC:79623) [Xeno... 37 0.71
gi|15239865|ref|NP_199155.1| zinc finger (C3HC4-type RING finger... 37 0.71
gi|50732635|ref|XP_425968.1| PREDICTED: similar to checkpoint wi... 37 0.71
gi|39590842|emb|CAE65215.1| Hypothetical protein CBG10090 [Caeno... 37 0.71
gi|21363032|sp|Q9BZY9|TM31_HUMAN Tripartite motif protein 31 >gn... 37 0.71
gi|50756669|ref|XP_415267.1| PREDICTED: similar to ring finger p... 37 0.71
gi|34852211|ref|XP_228012.2| similar to RING1 protein [Rattus no... 37 0.71
gi|17826764|emb|CAD18905.1| ring finger protein 1 [Macaca mulatta] 37 0.71
gi|48102864|ref|XP_395448.1| similar to Cas-Br-M (murine) ectrop... 37 0.71
gi|47087091|ref|NP_997714.1| ring finger protein 1 [Rattus norve... 37 0.71
gi|2239144|emb|CAA73381.1| transcription repressor Ring1A [Mus m... 37 0.71
gi|14041698|emb|CAC38442.1| dJ1033B10.8.2 (Ring finger protein 1... 37 0.71
gi|4506535|ref|NP_002922.1| ring finger protein 1 [Homo sapiens]... 37 0.71
gi|12275862|gb|AAG50166.1| tripartite motif protein TRIM31 beta ... 37 0.71
gi|33416737|gb|AAH56131.1| MGC69169 protein [Xenopus laevis] 37 0.71
gi|50418106|gb|AAH77164.1| Unknown (protein for MGC:91888) [Dani... 37 0.71
gi|30354168|gb|AAH51866.1| RING1 protein [Homo sapiens] >gnl|BL_... 37 0.71
gi|31241101|ref|XP_320974.1| ENSANGP00000019879 [Anopheles gambi... 37 0.71
gi|46438498|gb|EAK97828.1| hypothetical protein CaO19.976 [Candi... 36 0.93
gi|48475210|gb|AAT44279.1| putative zinc finger protein [Oryza s... 36 0.93
gi|50757803|ref|XP_415653.1| PREDICTED: similar to Zinc finger p... 36 0.93
gi|6323276|ref|NP_013348.1| Hypothetical ORF; Ylr247cp [Saccharo... 36 0.93
gi|24660927|ref|NP_648224.1| CG7037-PB [Drosophila melanogaster]... 36 0.93
gi|21707222|gb|AAH33871.1| TRIM50C protein [Homo sapiens] 36 0.93
gi|48475186|gb|AAT44255.1| unknown protein [Oryza sativa (japoni... 36 0.93
gi|39583298|emb|CAE60090.1| Hypothetical protein CBG03614 [Caeno... 36 0.93
gi|46125555|ref|XP_387331.1| hypothetical protein FG07155.1 [Gib... 36 0.93
gi|21554128|gb|AAM63208.1| unknown [Arabidopsis thaliana] 36 0.93
gi|32414387|ref|XP_327673.1| hypothetical protein [Neurospora cr... 36 0.93
gi|16445352|ref|NP_008959.2| tripartite motif protein 31 isoform... 36 0.93
gi|21594048|gb|AAM65966.1| unknown [Arabidopsis thaliana] 36 0.93
gi|18409246|ref|NP_564959.1| zinc finger (C3HC4-type RING finger... 36 0.93
gi|37536508|ref|NP_922556.1| putative ring finger protein [Oryza... 36 0.93
gi|1842453|gb|AAC47487.1| D-cbl [Drosophila melanogaster] 36 0.93
gi|17505791|ref|NP_491223.1| ADP-ribosylation factor domain prot... 36 0.93
gi|24660931|ref|NP_729382.1| CG7037-PA [Drosophila melanogaster]... 36 0.93
gi|16445354|ref|NP_438111.1| tripartite motif protein 31 isoform... 36 0.93
gi|15218042|ref|NP_173506.1| zinc finger (C3HC4-type RING finger... 36 0.93
gi|37538597|ref|XP_351724.1| similar to tripartite motif protein... 36 0.93
gi|46849791|ref|NP_033572.1| tripartite motif protein 25; estrog... 36 0.93
gi|39591332|emb|CAE73385.1| Hypothetical protein CBG20825 [Caeno... 36 0.93
gi|47124939|gb|AAH70806.1| MGC83879 protein [Xenopus laevis] 36 0.93
gi|39582166|emb|CAE71498.1| Hypothetical protein CBG18425 [Caeno... 36 0.93
gi|30984486|ref|NP_851918.1| immediate early protein ICP0 [Cerco... 36 1.2
gi|38102352|gb|EAA49201.1| hypothetical protein MG00859.4 [Magna... 36 1.2
gi|48097880|ref|XP_391967.1| similar to CG15105-PA [Apis mellifera] 36 1.2
gi|15229763|ref|NP_189961.1| zinc finger (C3HC4-type RING finger... 36 1.2
gi|34865987|ref|XP_345982.1| similar to TRAF interacting protein... 36 1.2
gi|39591345|emb|CAE73398.1| Hypothetical protein CBG20839 [Caeno... 36 1.2
gi|2239142|emb|CAA73380.1| polycomb-M33 interacting protein Ring... 36 1.2
gi|338490|gb|AAA36651.1| 52-kD SS-A/Ro autoantigen 36 1.2
gi|17985999|ref|NP_536771.1| ring finger protein 36 [Mus musculu... 36 1.2
gi|29747979|gb|AAH50815.1| Ring finger protein 36 [Mus musculus] 36 1.2
gi|15226628|ref|NP_182278.1| zinc finger (C3HC4-type RING finger... 36 1.2
gi|30685297|ref|NP_193839.3| BRCT domain-containing protein / zi... 36 1.2
gi|46126071|ref|XP_387589.1| hypothetical protein FG07413.1 [Gib... 36 1.2
gi|34881393|ref|XP_229087.2| similar to ring finger protein 2 [R... 36 1.2
gi|21555237|gb|AAM63811.1| putative RING zinc finger protein [Ar... 36 1.2
gi|48098234|ref|XP_392021.1| similar to zn-finger, RING and Zn-f... 36 1.2
gi|7486585|pir||T04938 hypothetical protein F7J7.10 - Arabidopsi... 36 1.2
gi|15228658|ref|NP_189573.1| expressed protein [Arabidopsis thal... 36 1.2
gi|50552924|ref|XP_503872.1| hypothetical protein [Yarrowia lipo... 36 1.2
gi|46403229|gb|AAS92634.1| ring finger protein 2 [Danio rerio] 36 1.2
gi|48716363|dbj|BAD22974.1| zinc finger (C3HC4-type RING finger)... 36 1.2
gi|39591326|emb|CAE73379.1| Hypothetical protein CBG20819 [Caeno... 36 1.2
gi|17533955|ref|NP_494244.1| b-box zinc finger containing protei... 36 1.2
gi|24653345|ref|NP_610866.1| CG17048-PA [Drosophila melanogaster... 36 1.2
gi|7486979|pir||T10649 hypothetical protein T13K14.230 - Arabido... 36 1.2
gi|28828506|gb|AAO51114.1| similar to Plasmodium falciparum. Hyp... 36 1.2
gi|46136681|ref|XP_390032.1| hypothetical protein FG09856.1 [Gib... 36 1.2
gi|20386036|gb|AAM21558.1| MEK1 interacting protein 1 [Dictyoste... 36 1.2
gi|27469632|gb|AAH41725.1| Rfwd1-prov protein [Xenopus laevis] 36 1.2
gi|15223041|ref|NP_177767.1| zinc finger (C3HC4-type RING finger... 36 1.2
gi|11994767|dbj|BAB03123.1| RING zinc finger protein-like [Arabi... 36 1.2
gi|19698963|gb|AAL91217.1| unknown protein [Arabidopsis thaliana... 36 1.2
gi|6572993|gb|AAF17506.1| Ring finger protein 1b [Danio rerio] 36 1.2
gi|6005747|ref|NP_009143.1| ring finger protein 2 [Homo sapiens]... 36 1.2
gi|26354897|dbj|BAC41075.1| unnamed protein product [Mus musculus] 36 1.2
gi|27712522|ref|XP_222726.1| similar to ring finger protein 2 [R... 36 1.2
gi|47497988|ref|NP_998872.1| hypothetical protein MGC69339 [Xeno... 36 1.2
gi|42733971|gb|AAS38871.1| hypothetical protein [Dictyostelium d... 36 1.2
gi|15223093|ref|NP_172283.1| zinc finger (C3HC4-type RING finger... 36 1.2
gi|34996481|ref|NP_571288.1| ring finger protein 2; ring finger ... 36 1.2
gi|28828426|gb|AAL96730.2| similar to Dictyostelium discoideum (... 36 1.2
gi|45198738|ref|NP_985767.1| AFR220Wp [Eremothecium gossypii] >g... 36 1.2
gi|47215614|emb|CAG11645.1| unnamed protein product [Tetraodon n... 36 1.2
gi|17543448|ref|NP_502615.1| ADP-ribosylation factor domain prot... 36 1.2
gi|17543450|ref|NP_502624.1| ADP-ribosylation factor domain prot... 36 1.2
gi|50553338|ref|XP_504080.1| hypothetical protein [Yarrowia lipo... 36 1.2
gi|49092730|ref|XP_407826.1| hypothetical protein AN3689.2 [Aspe... 36 1.2
gi|41052984|dbj|BAD07893.1| zinc finger (C3HC4-type RING finger)... 36 1.2
gi|50757584|ref|XP_425348.1| PREDICTED: similar to hypothetical ... 36 1.2
gi|40807469|ref|NP_005870.2| TRAF interacting protein [Homo sapi... 36 1.2
gi|41615268|ref|NP_963766.1| NEQ485 [Nanoarchaeum equitans Kin4-... 36 1.2
gi|45184872|ref|NP_982590.1| AAR049Cp [Eremothecium gossypii] >g... 35 1.6
gi|37791464|gb|AAR03708.1| recombination activating gene-1 prote... 35 1.6
gi|7497019|pir||T15762 hypothetical protein C34E10.5 - Caenorhab... 35 1.6
gi|47678659|emb|CAG30450.1| RFPL3 [Homo sapiens] 35 1.6
gi|19173130|ref|NP_596933.1| hypothetical protein [Encephalitozo... 35 1.6
gi|18043336|gb|AAH20102.1| Trim11 protein [Mus musculus] 35 1.6
gi|15237991|ref|NP_197262.1| zinc finger (C3HC4-type RING finger... 35 1.6
gi|49117816|gb|AAH72732.1| Unknown (protein for MGC:79078) [Xeno... 35 1.6
gi|16716455|ref|NP_444398.1| tripartite motif protein 11 [Mus mu... 35 1.6
gi|21630277|ref|NP_660215.1| tripartite motif-containing 11 [Hom... 35 1.6
gi|22760588|dbj|BAC11254.1| unnamed protein product [Homo sapiens] 35 1.6
gi|47217298|emb|CAG12506.1| unnamed protein product [Tetraodon n... 35 1.6
gi|7497825|pir||T15826 hypothetical protein C52E12.1 - Caenorhab... 35 1.6
gi|40353773|ref|NP_056246.2| BIA2 protein [Homo sapiens] 35 1.6
gi|41150690|ref|XP_372655.1| similar to RIKEN cDNA 9930039A11 ge... 35 1.6
gi|2565166|gb|AAC53539.1| Rnf4 [Mus musculus] 35 1.6
gi|22122567|ref|NP_666189.1| cDNA sequence BC026666 [Mus musculu... 35 1.6
gi|49089986|ref|XP_406565.1| hypothetical protein AN2428.2 [Aspe... 35 1.6
gi|34870771|ref|XP_340807.1| similar to tripartite motif protein... 35 1.6
gi|7522155|pir||T30807 TRAF interacting protein - Fugu rubripes ... 35 1.6
gi|17550652|ref|NP_508904.1| patched related protein translocate... 35 1.6
gi|20340241|gb|AAM19707.1| putative RING zinc finger protein-lik... 35 1.6
gi|32565518|ref|NP_495439.2| zn-finger, RING and Zn-finger, C2H2... 35 1.6
gi|47228068|emb|CAF97697.1| unnamed protein product [Tetraodon n... 35 1.6
gi|15219716|ref|NP_171931.1| zinc finger (C3HC4-type RING finger... 35 1.6
gi|39592530|emb|CAE63607.1| Hypothetical protein CBG08098 [Caeno... 35 1.6
>gi|17505504|ref|NP_491737.1| RING zinc finger containing protein
family member (31.6 kD) (1G584) [Caenorhabditis elegans]
gi|7495483|pir||T25523 hypothetical protein C06A5.8 -
Caenorhabditis elegans
gi|1943784|gb|AAB52441.1| Hypothetical protein C06A5.8a
[Caenorhabditis elegans]
Length = 283
Score = 466 bits (1199), Expect = e-130
Identities = 238/283 (84%), Positives = 238/283 (84%)
Frame = -1
Query: 852 MSATKSEMXXXXXXXXXXXXXXXAFPLIGDFLEEFLKCQVCCTNYNETTKLARGLHCGHT 673
MSATKSEM AFPLIGDFLEEFLKCQVCCTNYNETTKLARGLHCGHT
Sbjct: 1 MSATKSEMPADVASVTDSSAASPAFPLIGDFLEEFLKCQVCCTNYNETTKLARGLHCGHT 60
Query: 672 FCTECIKTMQKYGNSAYLECPSCRAETKCDIAAVSTNFAIMELIRKCGFLGPEKPEEPPM 493
FCTECIKTMQKYGNSAYLECPSCRAETKCDIAAVSTNFAIMELIRKCGFLGPEKPEEPPM
Sbjct: 61 FCTECIKTMQKYGNSAYLECPSCRAETKCDIAAVSTNFAIMELIRKCGFLGPEKPEEPPM 120
Query: 492 KQAAQPQLEQTIDELIDEGYRLLIADVKADLMAKFEQLRDVSKTSTIEATKADLEVLCDS 313
KQAAQPQLEQTIDELIDEGYRLLIADVKADLMAKFEQLRDVSKTSTIEATKADLEVLCDS
Sbjct: 121 KQAAQPQLEQTIDELIDEGYRLLIADVKADLMAKFEQLRDVSKTSTIEATKADLEVLCDS 180
Query: 312 VKEAVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKPCAEKKSPAQPERSSSLVRGFQ 133
VKEAVY EKPCAEKKSPAQPERSSSLVRGFQ
Sbjct: 181 VKEAVYEADLEYSYDEEESDEDEEENEDEEDVEEEEEKPCAEKKSPAQPERSSSLVRGFQ 240
Query: 132 IGLSRLFRNRRIHTEHLQVDHGAIATKLETRAACTEKSDNVKK 4
IGLSRLFRNRRIHTEHLQVDHGAIATKLETRAACTEKSDNVKK
Sbjct: 241 IGLSRLFRNRRIHTEHLQVDHGAIATKLETRAACTEKSDNVKK 283