Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C05C8_1
(786 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17561778|ref|NP_504835.1| dauer or Aging adult Overexpression... 481 e-135
gi|39594448|emb|CAE72026.1| Hypothetical protein CBG19108 [Caeno... 439 e-122
gi|17506167|ref|NP_491258.1| dauer or Aging adult Overexpression... 271 1e-71
gi|39586282|emb|CAE66693.1| Hypothetical protein CBG12033 [Caeno... 271 1e-71
gi|17506169|ref|NP_491257.1| dauer or Aging adult Overexpression... 271 1e-71
gi|17561780|ref|NP_506197.1| dauer or Aging adult Overexpression... 259 3e-68
gi|39583907|emb|CAE63997.1| Hypothetical protein CBG08591 [Caeno... 251 1e-65
gi|25396616|pir||E89251 protein ZC455.10 [imported] - Caenorhabd... 227 2e-58
gi|12841084|dbj|BAB25071.1| unnamed protein product [Mus musculus] 129 5e-29
gi|29144947|gb|AAH43129.1| FK506 binding protein 9 [Mus musculus] 129 7e-29
gi|20072768|gb|AAH26133.1| Fkbp9 protein [Mus musculus] 129 7e-29
gi|23396603|sp|Q9Z247|FKB9_MOUSE FK506 binding protein 9 precurs... 129 7e-29
gi|27532952|ref|NP_036186.1| FK506 binding protein 9 [Mus muscul... 128 1e-28
gi|23396584|sp|O95302|FKB9_HUMAN FK506 binding protein 9 (Peptid... 127 3e-28
gi|33469985|ref|NP_009201.2| FK506 binding protein 9; rotamase; ... 127 3e-28
gi|34855934|ref|XP_216153.2| similar to FK506 binding protein 9 ... 127 3e-28
gi|27696835|gb|AAH43741.1| Fkbp9-prov protein [Xenopus laevis] 125 1e-27
gi|6434851|gb|AAF08340.1| peptidyl-prolyl cis-trans isomerase [B... 123 5e-27
gi|18034674|gb|AAL57621.1| 65kDa FK506-binding protein [Mus musc... 122 7e-27
gi|34784603|gb|AAH57719.1| MGC68882 protein [Xenopus laevis] 122 9e-27
gi|6806907|ref|NP_034351.1| FK506 binding protein 10; FK506 bind... 122 1e-26
gi|21361895|ref|NP_068758.2| FK506 binding protein 10, 65 kDa; F... 121 2e-26
gi|49119195|gb|AAH72927.1| Unknown (protein for MGC:80429) [Xeno... 121 2e-26
gi|31873404|emb|CAD97695.1| hypothetical protein [Homo sapiens] 120 2e-26
gi|10438296|dbj|BAB15220.1| unnamed protein product [Homo sapiens] 120 2e-26
gi|21751369|dbj|BAC03954.1| unnamed protein product [Homo sapiens] 120 2e-26
gi|23396594|sp|Q96AY3|FK10_HUMAN FK506 binding protein 10 precur... 120 2e-26
gi|27694894|gb|AAH43844.1| MGC53657 protein [Xenopus laevis] 120 2e-26
gi|47077820|dbj|BAD18781.1| unnamed protein product [Homo sapiens] 120 2e-26
gi|27661294|ref|XP_215196.1| similar to binding protein [Rattus ... 118 1e-25
gi|6679805|ref|NP_032046.1| FK506 binding protein 2; FK506 bindi... 118 1e-25
gi|17149842|ref|NP_004461.2| FK506-binding protein 2 precursor; ... 118 1e-25
gi|7025503|gb|AAF35906.1| FK506-binding protein [Xenopus laevis] 118 1e-25
gi|47206340|emb|CAF89659.1| unnamed protein product [Tetraodon n... 118 2e-25
gi|50417104|gb|AAH78307.1| Unknown (protein for MGC:100902) [Dan... 118 2e-25
gi|39992415|gb|AAH64418.1| FKBP9 protein [Homo sapiens] 117 4e-25
gi|45382327|ref|NP_990178.1| CFKBP/SMAP protein [Gallus gallus] ... 116 5e-25
gi|47216127|emb|CAG10001.1| unnamed protein product [Tetraodon n... 116 6e-25
gi|182640|gb|AAA58473.1| rapamycin-binding protein 114 2e-24
gi|17540882|ref|NP_502056.1| FK506 Binding protein family (15.5 ... 114 3e-24
gi|4102827|gb|AAD01595.1| peptidyl-prolyl cis-trans isomerase [B... 111 2e-23
gi|31207709|ref|XP_312821.1| ENSANGP00000016706 [Anopheles gambi... 110 3e-23
gi|39593692|emb|CAE61984.1| Hypothetical protein CBG05991 [Caeno... 110 4e-23
gi|34873708|ref|XP_340902.1| similar to 65kDa FK506-binding prot... 109 6e-23
gi|47210995|emb|CAF95827.1| unnamed protein product [Tetraodon n... 108 1e-22
gi|21356629|ref|NP_650101.1| CG14715-PA [Drosophila melanogaster... 108 2e-22
gi|28279178|gb|AAH45938.1| Wu:fc27c03 protein [Danio rerio] 107 3e-22
gi|30842644|emb|CAD91435.1| Binding protein 2 like protein [Cras... 103 3e-21
gi|31211943|ref|XP_314956.1| ENSANGP00000019325 [Anopheles gambi... 103 4e-21
gi|34906954|ref|NP_914824.1| rapamycin-binding protein-like [Ory... 102 7e-21
gi|628056|pir||JT0748 FK506-binding protein - Botryllus schlosse... 102 7e-21
gi|4102825|gb|AAD01594.1| peptidyl-prolyl cis-trans isomerase [D... 100 3e-20
gi|2129623|pir||S71238 probable peptidylprolyl isomerase (EC 5.2... 100 5e-20
gi|15239019|ref|NP_199669.1| FK506-binding protein 2-2 (FKBP15-2... 100 5e-20
gi|50258182|gb|EAL20876.1| hypothetical protein CNBE2370 [Crypto... 99 1e-19
gi|23396588|sp|Q41649|FKB2_VICFA FK506-binding protein 2 precurs... 98 2e-19
gi|27664728|ref|XP_217041.1| similar to FK506 binding protein 11... 98 2e-19
gi|15277331|ref|NP_077131.2| FK506 binding protein 11 [Mus muscu... 98 2e-19
gi|47848114|dbj|BAD21897.1| putative peptidylprolyl isomerase [O... 97 5e-19
gi|38174807|emb|CAD42633.1| putative immunophilin [Hordeum vulga... 97 5e-19
gi|12859176|dbj|BAB31559.1| unnamed protein product [Mus musculus] 97 5e-19
gi|50808685|ref|XP_424615.1| PREDICTED: similar to FK506 binding... 96 7e-19
gi|50545423|ref|XP_500249.1| hypothetical protein [Yarrowia lipo... 96 9e-19
gi|28317187|gb|AAD27854.2| GM07659p [Drosophila melanogaster] 95 2e-18
gi|4102829|gb|AAD01596.1| peptidyl-prolyl cis-trans isomerase [O... 94 3e-18
gi|17352457|ref|NP_476973.1| CG9847-PA [Drosophila melanogaster]... 94 4e-18
gi|24657035|ref|NP_726074.1| CG9847-PB [Drosophila melanogaster]... 94 4e-18
gi|7706131|ref|NP_057678.1| FK506 binding protein precursor; FK5... 93 6e-18
gi|48141404|ref|XP_397224.1| similar to ENSANGP00000019325 [Apis... 93 7e-18
gi|42761405|dbj|BAD11570.1| putative 70 kDa peptidylprolyl isome... 93 7e-18
gi|2129622|pir||S71237 probable peptidylprolyl isomerase (EC 5.2... 92 1e-17
gi|18404471|ref|NP_566762.1| FK506-binding protein 2-1 (FKBP15-1... 92 1e-17
gi|49076118|ref|XP_402070.1| hypothetical protein UM04455.1 [Ust... 92 1e-17
gi|22970827|ref|ZP_00017852.1| hypothetical protein [Chloroflexu... 92 2e-17
gi|38347494|emb|CAE05842.2| OSJNBa0091C07.4 [Oryza sativa (japon... 92 2e-17
gi|6320727|ref|NP_010807.1| Membrane-bound peptidyl-prolyl cis-t... 92 2e-17
gi|38197003|gb|AAH07443.2| FKBP9 protein [Homo sapiens] 92 2e-17
gi|50288887|ref|XP_446873.1| unnamed protein product [Candida gl... 91 2e-17
gi|27802741|emb|CAD60686.1| SI:dZ167C3.2 (novel protein similar ... 91 3e-17
gi|14041716|emb|CAC38783.1| putative FK506-binding protein [Sube... 91 3e-17
gi|49122465|ref|XP_412480.1| hypothetical protein AN8343.2 [Aspe... 91 3e-17
gi|21593622|gb|AAM65589.1| immunophilin (FKBP15-1) [Arabidopsis ... 90 5e-17
gi|30687816|ref|NP_189160.3| peptidyl-prolyl cis-trans isomerase... 90 5e-17
gi|1354207|gb|AAB82061.1| rof1 [Arabidopsis thaliana] 90 5e-17
gi|9294180|dbj|BAB02082.1| peptidylprolyl isomerase; FK506-bindi... 90 5e-17
gi|50760843|ref|XP_418157.1| PREDICTED: similar to 65kDa FK506-b... 90 6e-17
gi|39580470|emb|CAE60702.1| Hypothetical protein CBG04365 [Caeno... 90 6e-17
gi|27801585|emb|CAD60658.1| SI:dZ202L16.2 (novel protein) [Danio... 89 1e-16
gi|34099839|gb|AAQ57208.1| FK506-binding protein 7 [Homo sapiens] 89 1e-16
gi|48735388|gb|AAH72422.1| FKBP9L protein [Homo sapiens] 89 1e-16
gi|3023751|sp|Q43207|FKB7_WHEAT 70 kDa peptidylprolyl isomerase ... 89 1e-16
gi|11360205|pir||T42709 hypothetical protein DKFZp586I0821.1 - h... 88 2e-16
gi|46130465|ref|ZP_00165335.2| COG0545: FKBP-type peptidyl-proly... 88 2e-16
gi|13021672|gb|AAK11511.1| FK506-binding protein [Xenopus laevis] 87 4e-16
gi|48890665|ref|ZP_00324301.1| COG0545: FKBP-type peptidyl-proly... 87 5e-16
gi|46118843|ref|ZP_00175700.2| COG0545: FKBP-type peptidyl-proly... 86 9e-16
gi|5138924|gb|AAD40379.1| FK506-binding protein [Homo sapiens] 86 9e-16
gi|15239016|ref|NP_199668.1| peptidyl-prolyl cis-trans isomerase... 86 9e-16
gi|50750385|ref|XP_421981.1| PREDICTED: similar to FK506-binding... 86 1e-15
gi|30585159|gb|AAP36852.1| Homo sapiens FK506 binding protein 7 ... 85 2e-15
gi|31317231|ref|NP_851939.1| FK506-binding protein 7 isoform 2 p... 85 2e-15
gi|17507845|ref|NP_493256.1| FK506 Binding protein family (fkb-8... 85 2e-15
gi|33866159|ref|NP_897718.1| FKBP-type peptidyl-prolyl cis-trans... 84 3e-15
gi|34856452|ref|XP_215758.2| similar to FK506-binding protein [R... 84 4e-15
gi|33861849|ref|NP_893410.1| FKBP-type peptidyl-prolyl cis-trans... 83 6e-15
gi|50416503|gb|AAH77190.1| Unknown (protein for IMAGE:4057027) [... 82 1e-14
gi|45507350|ref|ZP_00159695.1| COG0545: FKBP-type peptidyl-proly... 82 1e-14
gi|6806909|ref|NP_034352.1| FK506 binding protein 7; FK506 bindi... 82 1e-14
gi|46312256|ref|ZP_00212854.1| COG0545: FKBP-type peptidyl-proly... 82 1e-14
gi|33862614|ref|NP_894174.1| FKBP-type peptidyl-prolyl cis-trans... 82 1e-14
gi|23618829|ref|NP_057189.1| FK506-binding protein 7 isoform 1 p... 82 1e-14
gi|16329650|ref|NP_440378.1| FKBP-type peptidyl-prolyl cis-trans... 82 2e-14
gi|10121715|gb|AAG13337.1| peptidyl-proline isomerase [Gillichth... 82 2e-14
gi|48784588|ref|ZP_00280954.1| COG0545: FKBP-type peptidyl-proly... 82 2e-14
gi|863008|gb|AAA68610.1| rotamase 81 2e-14
gi|25143187|ref|NP_740925.1| FK506 Binding protein family, rotam... 81 2e-14
gi|47229576|emb|CAG06772.1| unnamed protein product [Tetraodon n... 81 2e-14
gi|17228073|ref|NP_484621.1| FKBP-type peptidyl-prolyl cis-trans... 81 2e-14
gi|46323457|ref|ZP_00223821.1| COG0545: FKBP-type peptidyl-proly... 80 4e-14
gi|26991004|ref|NP_746429.1| peptidyl-prolyl cis-trans isomerase... 80 4e-14
gi|6434853|gb|AAF08341.1| peptidyl-prolyl cis-trans isomerase [B... 80 4e-14
gi|50422817|ref|XP_459986.1| unnamed protein product [Debaryomyc... 80 4e-14
gi|23129112|ref|ZP_00110945.1| COG0545: FKBP-type peptidyl-proly... 80 5e-14
gi|46109052|ref|XP_381584.1| hypothetical protein FG01408.1 [Gib... 80 6e-14
gi|4102831|gb|AAD01597.1| peptidyl-prolyl cis-trans isomerase [B... 80 6e-14
gi|24215250|ref|NP_712731.1| FKBP-type peptidyl-prolyl cis-trans... 80 6e-14
gi|47085913|ref|NP_998314.1| zgc:64082 [Danio rerio] >gnl|BL_ORD... 79 1e-13
gi|6323482|ref|NP_013554.1| Nuclear protein, putative peptidyl-p... 78 2e-13
gi|45383498|ref|NP_989661.1| FK506 binding protein 1A, 12kDa [Ga... 78 2e-13
gi|6580969|gb|AAF18387.1| FK506-binding protein FKBP59 [Drosophi... 78 2e-13
gi|38564729|gb|AAR23804.1| putative immunophilin/FKBP-type pepti... 77 3e-13
gi|4758384|ref|NP_004108.1| FK506 binding protein 5; FK506-bindi... 77 4e-13
gi|28373494|pdb|1KT0|A Chain A, Structure Of The Large Fkbp-Like... 77 4e-13
gi|22298646|ref|NP_681893.1| FKBP-type peptidyl-prolyl cis-trans... 77 4e-13
gi|1145816|gb|AAA86245.1| FKBP54 77 4e-13
gi|24583150|ref|NP_524895.2| CG4535-PA [Drosophila melanogaster]... 77 4e-13
gi|17945344|gb|AAL48728.1| RE16407p [Drosophila melanogaster] 77 4e-13
gi|33240816|ref|NP_875758.1| FKBP-type peptidyl-prolyl cis-trans... 77 4e-13
gi|34535989|dbj|BAC87500.1| unnamed protein product [Homo sapiens] 77 4e-13
gi|41017244|sp|Q9XT11|FKB5_AOTNA FK506-binding protein 5 (Peptid... 77 5e-13
gi|41017243|sp|Q9XSI2|FKB5_SAGOE FK506-binding protein 5 (Peptid... 77 5e-13
gi|24181420|gb|AAM33435.1| FKBP [Giardia lamblia ATCC 50803] >gn... 77 5e-13
gi|50304571|ref|XP_452241.1| unnamed protein product [Kluyveromy... 77 5e-13
gi|3929348|sp|O60046|FKB2_NEUCR FK506-binding protein 2 precurso... 77 5e-13
gi|50876534|emb|CAG36374.1| probable peptidyl-prolyl cis-trans i... 77 5e-13
gi|34858492|ref|XP_342764.1| similar to p59 immunophilin [Rattus... 77 5e-13
gi|24655568|ref|NP_523792.2| CG11001-PA [Drosophila melanogaster... 76 7e-13
gi|38047771|gb|AAR09788.1| similar to Drosophila melanogaster FK... 76 7e-13
gi|38048605|gb|AAR10205.1| similar to Drosophila melanogaster FK... 76 7e-13
gi|41017242|sp|Q9XSH5|FKB5_SAIBB FK506-binding protein 5 (Peptid... 76 9e-13
gi|50259846|gb|EAL22514.1| hypothetical protein CNBB3920 [Crypto... 76 9e-13
gi|1942962|pdb|1ROT| Structure Of Fkbp59-I, The N-Terminal Doma... 76 9e-13
gi|32405734|ref|XP_323480.1| hypothetical protein [Neurospora cr... 76 9e-13
gi|31239875|ref|XP_320351.1| ENSANGP00000014046 [Anopheles gambi... 76 9e-13
gi|122768|sp|P27124|FKB4_RABIT FK506-binding protein 4 (Peptidyl... 76 9e-13
gi|46108354|ref|XP_381235.1| hypothetical protein FG01059.1 [Gib... 75 1e-12
gi|42527892|ref|NP_972990.1| peptidyl-prolyl cis-trans isomerase... 75 1e-12
gi|1346013|sp|P48375|FKB1_DROME 12 kDa FK506-binding protein (FK... 75 1e-12
gi|4323037|gb|AAD16171.1| macrolide-binding protein FKBP12 [Cryp... 75 1e-12
gi|45190755|ref|NP_985009.1| AER150Wp [Eremothecium gossypii] >g... 75 1e-12
gi|29250652|gb|EAA42142.1| GLP_480_30680_31744 [Giardia lamblia ... 75 2e-12
gi|50761302|ref|XP_419266.1| PREDICTED: similar to FK506-binding... 75 2e-12
gi|7437329|pir||T06489 probable peptidylprolyl isomerase (EC 5.2... 75 2e-12
gi|4503729|ref|NP_002005.1| FK506-binding protein 4; FK506-bindi... 75 2e-12
gi|6560679|gb|AAF16717.1| FK506-binding protein [Manduca sexta] 75 2e-12
gi|27574036|pdb|1N1A|A Chain A, Crystal Structure Of The N-Termi... 75 2e-12
gi|50513335|pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of... 75 2e-12
gi|50293711|ref|XP_449267.1| unnamed protein product [Candida gl... 74 3e-12
gi|14270308|emb|CAC39452.1| immunophilin FKBP-52 [Mus musculus] 74 3e-12
gi|47824782|emb|CAG30551.1| FKBP12 protein (FK506 binding protei... 74 3e-12
gi|46364596|ref|ZP_00227193.1| COG0545: FKBP-type peptidyl-proly... 74 3e-12
gi|13097417|gb|AAH03447.1| FK506 binding protein 4 [Mus musculus] 74 3e-12
gi|6753882|ref|NP_034349.1| FK506 binding protein 4 [Mus musculu... 74 3e-12
gi|50729367|ref|XP_416485.1| PREDICTED: similar to FK506-binding... 74 3e-12
gi|46019950|emb|CAG25527.1| putative FK506-binding protein [Sube... 74 3e-12
gi|1942335|pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin ... 74 3e-12
gi|21220134|ref|NP_625913.1| peptidyl-prolyl cis-trans isomerase... 74 3e-12
gi|45383045|ref|NP_989898.1| FK506 binding protein 12.6 [Gallus ... 74 3e-12
gi|37520410|ref|NP_923787.1| FKBP-type peptidyl-prolyl cis-trans... 74 3e-12
gi|31202137|ref|XP_310016.1| ENSANGP00000015211 [Anopheles gambi... 74 3e-12
gi|38104100|gb|EAA50717.1| hypothetical protein MG04476.4 [Magna... 74 3e-12
gi|46911949|emb|CAG18747.1| putative FKBP-type peptidyl-prolyl c... 74 5e-12
gi|23397340|sp|P18203|FKB1_BOVIN FK506-binding protein 1A (Pepti... 74 5e-12
gi|627752|pir||A61431 peptidylprolyl isomerase (EC 5.2.1.8) FKBP... 74 5e-12
gi|17985953|ref|NP_445760.1| FK506 binding protein 2; FK506 bind... 74 5e-12
gi|10438522|dbj|BAB15266.1| unnamed protein product [Homo sapiens] 74 5e-12
gi|27469642|gb|AAH41748.1| FKBP1B protein [Xenopus laevis] 74 5e-12
gi|41017225|sp|Q95L05|FKB5_CERAE FK506-binding protein 5 (Peptid... 73 6e-12
gi|6324194|ref|NP_014264.1| Peptidyl-prolyl cis-trans isomerase ... 73 6e-12
gi|3660040|pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With R... 73 6e-12
gi|34852256|ref|XP_342104.1| similar to FKBP51 [Rattus norvegicus] 73 6e-12
gi|34496160|ref|NP_900375.1| probable FkbP-type peptidyl-prolyl ... 73 6e-12
gi|443331|pdb|1YAT| Fk-506 Binding Protein (12 Kd, Yeast) Compl... 73 6e-12
gi|1079072|pir||JC4090 FK506-binding 39k protein - fruit fly (Dr... 73 6e-12
gi|24647110|ref|NP_524364.2| CG6226-PA [Drosophila melanogaster]... 73 6e-12
gi|32420467|ref|XP_330677.1| hypothetical protein [Neurospora cr... 73 8e-12
gi|32476267|ref|NP_869261.1| macrophage infectivity potentiator ... 73 8e-12
gi|50303599|ref|XP_451741.1| unnamed protein product [Kluyveromy... 73 8e-12
gi|47123059|gb|AAH70730.1| MGC83716 protein [Xenopus laevis] 72 1e-11
gi|46250071|gb|AAH68678.1| MGC81078 protein [Xenopus laevis] 72 1e-11
gi|15675967|ref|NP_273093.1| FKBP-type peptidyl-prolyl cis-trans... 72 1e-11
gi|10121024|pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Ho... 72 1e-11
gi|14041718|emb|CAC38784.1| putative FK506-binding protein [Sube... 72 1e-11
gi|47115163|emb|CAG28541.1| FKBP1A [Homo sapiens] 72 1e-11
gi|50303143|ref|XP_451509.1| unnamed protein product [Kluyveromy... 72 1e-11
gi|7487577|pir||T10215 hypothetical protein T30C3.20 - Arabidops... 72 1e-11
gi|6753884|ref|NP_034350.1| FK506 binding protein 5; FK506 bindi... 72 1e-11
gi|18416534|ref|NP_567717.1| immunophilin-related / FKBP-type pe... 72 1e-11
gi|38111279|gb|EAA56879.1| hypothetical protein MG07234.4 [Magna... 72 1e-11
gi|15806839|ref|NP_295562.1| peptidyl-prolyl cis-trans isomerase... 72 1e-11
gi|46435142|gb|EAK94530.1| hypothetical protein CaO19.1030 [Cand... 72 1e-11
gi|150259|gb|AAA25455.1| rotamase 72 1e-11
gi|4503725|ref|NP_000792.1| FK506-binding protein 1A; FK506-bind... 72 1e-11
gi|30585003|gb|AAP36774.1| Homo sapiens FK506 binding protein 1A... 72 1e-11
gi|229919|pdb|1FKF| FK506 Binding Protein (FKBP) Complex With I... 72 1e-11
gi|15793291|ref|NP_283113.1| peptidyl-prolyl cis-trans isomerase... 72 1e-11
gi|281747|pir||A40211 FK506-inhibitable rotamase - Neisseria men... 72 1e-11
gi|49092548|ref|XP_407735.1| hypothetical protein AN3598.2 [Aspe... 72 1e-11
gi|46435189|gb|EAK94576.1| hypothetical protein CaO19.8632 [Cand... 72 1e-11
gi|50420673|ref|XP_458873.1| unnamed protein product [Debaryomyc... 72 2e-11
gi|38147035|gb|AAR11883.1| putative FK506-binding protein [Strep... 72 2e-11
gi|49066702|ref|XP_397641.1| hypothetical protein UM00026.1 [Ust... 72 2e-11
gi|41387128|ref|NP_957106.1| hypothetical protein MGC73381 [Dani... 72 2e-11
gi|38344553|emb|CAD40958.2| OSJNBa0027P08.21 [Oryza sativa (japo... 71 2e-11
gi|39997372|ref|NP_953323.1| FKBP-type peptidyl-prolyl cis-trans... 71 2e-11
gi|47940054|gb|AAH71516.1| FK506 binding protein 4 [Danio rerio] 71 3e-11
gi|38048463|gb|AAR10134.1| similar to Drosophila melanogaster FK... 71 3e-11
gi|34499246|ref|NP_903461.1| probable FkbP-type peptidyl-prolyl ... 71 3e-11
gi|41393101|ref|NP_958877.1| FK506 binding protein 4 [Danio reri... 70 4e-11
gi|45521388|ref|ZP_00172908.1| COG0545: FKBP-type peptidyl-proly... 70 4e-11
gi|37551354|ref|XP_059776.2| similar to FK506-binding protein 1A... 70 4e-11
gi|50292417|ref|XP_448641.1| unnamed protein product [Candida gl... 70 4e-11
gi|1843430|dbj|BAA13153.1| FK506-binding protein 12 [Rattus norv... 70 4e-11
gi|19112049|ref|NP_595257.1| peptidyl-prolyl cis-trans isomerase... 70 4e-11
gi|27764334|emb|CAD60614.1| unnamed protein product [Podospora a... 70 4e-11
gi|46048916|ref|NP_989972.1| putative FK506-binding protein [Gal... 70 5e-11
gi|38257019|dbj|BAD01553.1| FK506 binding protein [Malassezia pa... 70 5e-11
gi|6679803|ref|NP_032045.1| FK506 binding protein 1a; FK506 bind... 70 5e-11
gi|405104|gb|AAA69654.1| FKBP immunophilin homolog 70 5e-11
gi|38197325|gb|AAH61673.1| MGC68829 protein [Xenopus laevis] 70 5e-11
gi|4758380|ref|NP_004107.1| FK506-binding protein 1B isoform a; ... 70 5e-11
gi|405098|gb|AAA69648.1| FKBP immunophilin homolog 70 5e-11
gi|48770992|ref|ZP_00275335.1| COG0545: FKBP-type peptidyl-proly... 70 5e-11
gi|627733|pir||A53924 FK-506-binding protein FKBP-12.6 - bovine ... 70 5e-11
gi|50604246|gb|AAH78078.1| Unknown (protein for MGC:82987) [Xeno... 70 5e-11
gi|50554149|ref|XP_504483.1| hypothetical protein [Yarrowia lipo... 70 5e-11
gi|49093168|ref|XP_408045.1| hypothetical protein AN3908.2 [Aspe... 70 7e-11
gi|18700445|dbj|BAB85190.1| FK506-binding protein [Bombyx mori] ... 70 7e-11
gi|50843600|ref|YP_056827.1| FK506-binding protein/peptidyl-prol... 70 7e-11
gi|1827930|pdb|1BKF| Fk506 Binding Protein Fkbp Mutant R42kH87V... 70 7e-11
gi|405100|gb|AAA69652.1| FKBP immunophilin homolog 70 7e-11
gi|8388702|emb|CAB94114.1| peptidylprolyl isomerase/immunophilin... 70 7e-11
gi|6323566|ref|NP_013637.1| Nucleolar peptidyl-prolyl cis-trans ... 70 7e-11
gi|50293923|ref|XP_449373.1| unnamed protein product [Candida gl... 69 9e-11
gi|39654843|pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans... 69 9e-11
gi|17561782|ref|NP_508026.1| FK506 Binding protein family (48.1 ... 69 9e-11
gi|2499773|sp|Q26486|FKB4_SPOFR 46 kDa FK506-binding nuclear pro... 69 1e-10
gi|41152406|ref|NP_956239.1| Unknown (protein for MGC:73373); wu... 69 1e-10
gi|45198582|ref|NP_985611.1| AFR064Cp [Eremothecium gossypii] >g... 69 1e-10
gi|6647517|sp|O42123|FKB1_XENLA FK506-binding protein 1A (Peptid... 69 1e-10
gi|6010069|emb|CAB57241.1| putative peptidyl-prolyl cis-trans is... 69 1e-10
gi|541023|pir||S39850 FKBP immunophilin homolog - Neisseria lact... 69 1e-10
gi|15239110|ref|NP_196161.1| immunophilin, putative / FKBP-type ... 69 1e-10
gi|8923659|ref|NP_060416.1| FK506 binding protein 14, 22 kDa; FK... 68 2e-10
gi|530998|gb|AAB04165.1| proline rotamase 68 2e-10
gi|30584013|gb|AAP36255.1| Homo sapiens FK506 binding protein 3,... 68 2e-10
gi|39581872|emb|CAE60766.1| Hypothetical protein CBG04454 [Caeno... 68 2e-10
gi|1827611|pdb|1PBK| Homologous Domain Of Human Fkbp25 68 2e-10
gi|49080272|gb|AAT49997.1| PA3717 [synthetic construct] 68 2e-10
gi|15598912|ref|NP_252406.1| probable peptidyl-prolyl cis-trans ... 68 2e-10
gi|31096347|gb|AAP43506.1| FK506-binding protein FKBP12 [Schizop... 68 2e-10
gi|17545503|ref|NP_518905.1| PROBABLE FKBP-TYPE PEPTIDYL-PROLYL ... 68 2e-10
gi|19113486|ref|NP_596694.1| Peptidyl Prolyl cis-trans isomerase... 68 2e-10
gi|4503727|ref|NP_002004.1| FK506-binding protein 3; FK506-bindi... 68 2e-10
gi|6015154|sp|O46638|FKB3_RABIT FK506-binding protein 3 (Peptidy... 68 3e-10
gi|23956366|ref|NP_705801.1| FK506 binding protein 14; cDNA sequ... 68 3e-10
gi|110055|pir||S14529 transition protein 2 - mouse >gnl|BL_ORD_I... 68 3e-10
gi|405088|gb|AAB60058.1| FKBP immunophilin homolog >gnl|BL_ORD_I... 68 3e-10
gi|12083613|ref|NP_073166.1| FK506 binding protein 1b; FK506 bin... 68 3e-10
gi|47205223|emb|CAF93877.1| unnamed protein product [Tetraodon n... 68 3e-10
gi|41724968|ref|ZP_00151778.1| COG0545: FKBP-type peptidyl-proly... 68 3e-10
gi|47229173|emb|CAG03925.1| unnamed protein product [Tetraodon n... 68 3e-10
gi|11182150|emb|CAC16180.1| bA314N13.4 (FK506-binding protein 1A... 68 3e-10
gi|23396604|sp|Q9Z2I2|FKBB_MOUSE FK506-binding protein 1B (Pepti... 68 3e-10
gi|30248110|ref|NP_840180.1| FKBP-type peptidyl-prolyl cis-trans... 68 3e-10
gi|1169686|sp|P26884|FKB3_BOVIN FK506-binding protein 3 (Peptidy... 68 3e-10
gi|49659849|gb|AAT68224.1| GekBS021P [Gekko japonicus] 68 3e-10
gi|23103950|ref|ZP_00090422.1| COG0545: FKBP-type peptidyl-proly... 68 3e-10
gi|110056|pir||S14538 transition protein - mouse 68 3e-10
gi|37524433|ref|NP_927777.1| FKBP-type peptidyl-prolyl cis-trans... 67 3e-10
gi|25244466|gb|AAN72433.1| FK506 binding protein 12.6 [Oryctolag... 67 3e-10
gi|47229440|emb|CAF99428.1| unnamed protein product [Tetraodon n... 67 3e-10
gi|23489896|gb|EAA21798.1| FK506-binding protein [Plasmodium yoe... 67 3e-10
gi|50417906|gb|AAH78342.1| Unknown (protein for MGC:91851) [Dani... 67 4e-10
gi|13812004|ref|NP_113134.1| FK506-binding protein 5(PEPTIDYL-PR... 67 4e-10
gi|40254558|ref|NP_058559.2| FK506 binding protein 1b; FK506 bin... 67 4e-10
gi|19569939|gb|AAL92248.1| similar to Thermosynechococcus elonga... 67 6e-10
gi|47219173|emb|CAG01836.1| unnamed protein product [Tetraodon n... 67 6e-10
gi|83901|pir||JN0320 rapamycin-binding protein - yeast (Candida ... 67 6e-10
gi|42523382|ref|NP_968762.1| peptidyl-prolyl cis-trans isomerase... 67 6e-10
gi|45519612|ref|ZP_00171163.1| COG0545: FKBP-type peptidyl-proly... 67 6e-10
gi|405110|gb|AAA69653.1| FKBP immunophilin homolog 67 6e-10
gi|50084230|ref|YP_045740.1| peptidyl-prolyl cis-trans isomerase... 67 6e-10
gi|48845378|ref|ZP_00299660.1| COG0545: FKBP-type peptidyl-proly... 67 6e-10
gi|27664664|ref|XP_216717.1| similar to 25 kDa FK506-binding pro... 67 6e-10
gi|7305061|ref|NP_038930.1| FK506 binding protein 3; FK506-bindi... 67 6e-10
gi|24372048|ref|NP_716090.1| peptidyl-prolyl cis-trans isomerase... 66 7e-10
gi|29245172|gb|EAA36827.1| GLP_398_14010_13363 [Giardia lamblia ... 66 7e-10
gi|15640381|ref|NP_230008.1| peptidyl-prolyl cis-trans isomerase... 66 7e-10
gi|47222038|emb|CAG08293.1| unnamed protein product [Tetraodon n... 66 1e-09
gi|16766742|ref|NP_462357.1| FKBP-type peptidyl-prolyl cis-trans... 66 1e-09
gi|27529746|dbj|BAC53894.1| FKBP12 [Tetrahymena thermophila] 66 1e-09
gi|47222640|emb|CAG00074.1| unnamed protein product [Tetraodon n... 66 1e-09
gi|322265|pir||A43328 peptidylprolyl isomerase (EC 5.2.1.8) FKBP... 66 1e-09
gi|120226|sp|P28725|FKBP_STRCH FK506-binding protein (Peptidyl-p... 66 1e-09
gi|50413205|ref|XP_457224.1| unnamed protein product [Debaryomyc... 66 1e-09
gi|31198905|ref|XP_308400.1| ENSANGP00000019080 [Anopheles gambi... 66 1e-09
gi|17507843|ref|NP_493257.1| FK506 Binding protein family (32.4 ... 66 1e-09
gi|28899552|ref|NP_799157.1| peptidyl-prolyl cis-trans isomerase... 66 1e-09
gi|50258621|gb|EAL21308.1| hypothetical protein CNBD3620 [Crypto... 65 1e-09
gi|29833229|ref|NP_827863.1| putative FK-506 binding protein, pe... 65 1e-09
gi|21436485|gb|AAM51567.1| immunophilin FK506 binding protein FK... 65 1e-09
gi|27364730|ref|NP_760258.1| FKBP-type peptidyl-prolyl cis-trans... 65 1e-09
gi|37681221|ref|NP_935830.1| FKBP-type peptidyl-prolyl cis-trans... 65 1e-09
gi|39935612|ref|NP_947888.1| FKBP-type peptidyl-prolyl cis-trans... 65 2e-09
gi|15242472|ref|NP_199380.1| FK506-binding protein 1 (FKBP13) [A... 65 2e-09
gi|21535744|emb|CAD35362.1| FK506 binding protein 1 [Arabidopsis... 65 2e-09
gi|15598458|ref|NP_251952.1| probable peptidyl-prolyl cis-trans ... 65 2e-09
gi|46164128|ref|ZP_00136617.2| COG0545: FKBP-type peptidyl-proly... 65 2e-09
gi|22324680|gb|AAM95632.1| FK506 binding protein 4 [Rattus norve... 65 2e-09
gi|27525282|emb|CAC82550.1| putative peptidyl-prolyl cis-trans i... 65 2e-09
gi|46187616|ref|ZP_00126935.2| COG0545: FKBP-type peptidyl-proly... 65 2e-09
gi|108463|pir||A40050 peptidylprolyl isomerase (EC 5.2.1.8) FKBP... 65 2e-09
gi|34855908|ref|XP_342692.1| similar to hypothetical protein MGC... 64 3e-09
gi|47207760|emb|CAF90914.1| unnamed protein product [Tetraodon n... 64 3e-09
gi|30172151|emb|CAD89783.1| peptidylprolyl cis-trans isomerase [... 64 3e-09
gi|49900154|gb|AAH77042.1| Unknown (protein for MGC:89927) [Xeno... 64 3e-09
gi|42523992|ref|NP_969372.1| peptidyl-prolyl cis-trans isomerase... 64 4e-09
gi|50725217|dbj|BAD34151.1| immunophilin-related / FKBP-type pep... 64 4e-09
gi|18420509|ref|NP_568067.1| immunophilin, putative / FKBP-type ... 64 4e-09
gi|27377516|ref|NP_769045.1| Peptidylprolyl isomerase [Bradyrhiz... 64 4e-09
gi|46811223|gb|AAT01905.1| FK506-binding protein 2 precursor [Ps... 64 5e-09
gi|120221|sp|P28870|FKBP_CANAL FK506-binding protein (FKBP) (Pep... 63 6e-09
gi|29348385|ref|NP_811888.1| FKBP-type peptidyl-prolyl cis-trans... 63 8e-09
gi|50122969|ref|YP_052136.1| FkbP-type peptidyl-prolyl cis-trans... 62 1e-08
gi|32035457|ref|ZP_00135418.1| COG0545: FKBP-type peptidyl-proly... 62 1e-08
gi|28869722|ref|NP_792341.1| peptidyl-prolyl cis-trans isomerase... 62 1e-08
gi|50732730|ref|XP_418735.1| PREDICTED: similar to FK506 binding... 62 1e-08
gi|23509147|ref|NP_701815.1| 70 kDa peptidylprolyl isomerase, pu... 62 1e-08
gi|46136349|ref|XP_389866.1| hypothetical protein FG09690.1 [Gib... 62 1e-08
gi|21242842|ref|NP_642424.1| FKBP-type peptidyl-prolyl cis-trans... 62 1e-08
gi|15603214|ref|NP_246288.1| SlyD [Pasteurella multocida Pm70] >... 62 1e-08
gi|21104360|dbj|BAB93450.1| macrophage infectivity protein [Acti... 62 1e-08
gi|46119029|ref|ZP_00175979.2| COG1047: FKBP-type peptidyl-proly... 62 2e-08
gi|15224305|ref|NP_181884.1| immunophilin / FKBP-type peptidyl-p... 61 2e-08
gi|16762830|ref|NP_458447.1| FKBP-type peptidyl-prolyl isomerase... 61 2e-08
gi|21231536|ref|NP_637453.1| FKBP-type peptidyl-prolyl cis-trans... 61 2e-08
gi|25408885|pir||F84867 hypothetical protein At2g43560 [imported... 61 2e-08
gi|47575183|ref|ZP_00245218.1| COG0545: FKBP-type peptidyl-proly... 61 2e-08
gi|42630021|ref|ZP_00155566.1| COG0545: FKBP-type peptidyl-proly... 61 2e-08
gi|48868943|ref|ZP_00322227.1| COG0545: FKBP-type peptidyl-proly... 61 2e-08
gi|49523102|gb|AAH75132.1| Unknown (protein for MGC:81908) [Xeno... 61 2e-08
gi|48855597|ref|ZP_00309756.1| COG0545: FKBP-type peptidyl-proly... 61 3e-08
gi|50757504|ref|XP_415541.1| PREDICTED: similar to KIAA0674 prot... 61 3e-08
gi|29250830|gb|EAA42318.1| GLP_440_54995_54660 [Giardia lamblia ... 61 3e-08
gi|42630853|ref|ZP_00156392.1| COG0545: FKBP-type peptidyl-proly... 61 3e-08
gi|15833452|ref|NP_312225.1| FKBP-type peptidyl-prolyl cis-trans... 60 4e-08
gi|16131226|ref|NP_417806.1| FKBP-type peptidyl-prolyl cis-trans... 60 4e-08
gi|28871042|ref|NP_793661.1| peptidyl-prolyl cis-trans isomerase... 60 4e-08
gi|24114611|ref|NP_709121.1| FKBP-type peptidyl-prolyl cis-trans... 60 4e-08
gi|42543411|pdb|1Q6U|A Chain A, Crystal Structure Of Fkpa From E... 60 4e-08
gi|50725216|dbj|BAD34150.1| immunophilin/FKBP-type peptidyl-prol... 60 4e-08
gi|47225522|emb|CAG12005.1| unnamed protein product [Tetraodon n... 60 4e-08
gi|23472296|ref|ZP_00127622.1| COG0545: FKBP-type peptidyl-proly... 60 4e-08
gi|16272517|ref|NP_438731.1| FKBP-type peptidyl-prolyl cis-trans... 60 4e-08
gi|42543407|pdb|1Q6H|A Chain A, Crystal Structure Of A Truncated... 60 4e-08
gi|50083359|ref|YP_044869.1| FKBP-type 22KD peptidyl-prolyl cis-... 60 5e-08
gi|23102184|ref|ZP_00088705.1| COG0545: FKBP-type peptidyl-proly... 60 5e-08
gi|8134460|sp|O08437|FKBA_AERHY FKBP-type peptidyl-prolyl cis-tr... 60 5e-08
gi|32033469|ref|ZP_00133813.1| COG0545: FKBP-type peptidyl-proly... 60 5e-08
gi|50083360|ref|YP_044870.1| FKBP-type peptidyl-prolyl cis-trans... 60 7e-08
gi|50546503|ref|XP_500721.1| hypothetical protein [Yarrowia lipo... 60 7e-08
gi|34908226|ref|NP_915460.1| P0406G08.28 [Oryza sativa (japonica... 60 7e-08
gi|15233297|ref|NP_191111.1| immunophilin, putative / FKBP-type ... 60 7e-08
gi|46390217|dbj|BAD15648.1| putative FKBP-type peptidyl-prolyl c... 59 9e-08
gi|48855599|ref|ZP_00309758.1| COG0545: FKBP-type peptidyl-proly... 59 9e-08
gi|17546284|ref|NP_519686.1| PUTATIVE FKBP-TYPE PEPTIDYL-PROLYL ... 59 9e-08
gi|22127847|ref|NP_671270.1| FKBP-type peptidyl-prolyl cis-trans... 59 1e-07
gi|19115447|ref|NP_594535.1| putative peptidyl-prolyl cis-trans ... 59 1e-07
gi|12321952|gb|AAG51009.1| FKBP-type peptidyl-prolyl cis-trans i... 59 1e-07
gi|46913998|emb|CAG20780.1| putative peptidyl-prolyl cis-trans i... 59 1e-07
gi|42564086|ref|NP_187840.3| immunophilin, putative / FKBP-type ... 59 1e-07
gi|29561841|emb|CAD87785.1| SI:dZ261O22.2 (novel protein similar... 59 1e-07
gi|16120534|ref|NP_403847.1| peptidyl-prolyl cis-trans isomerase... 59 1e-07
gi|26988446|ref|NP_743871.1| peptidyl-prolyl cis-trans isomerase... 59 2e-07
gi|29245388|gb|EAA37029.1| GLP_16_9499_10515 [Giardia lamblia AT... 59 2e-07
gi|15803860|ref|NP_289894.1| FKBP-type peptidyl-prolyl cis-trans... 59 2e-07
gi|6686804|emb|CAB64724.1| FKBP-l ke gene [Arabidopsis thaliana] 59 2e-07
gi|18252321|gb|AAL66192.1| putative FKBP type peptidyl-prolyl ci... 58 2e-07
gi|50876056|emb|CAG35896.1| probable outer membrane protein MIP ... 58 2e-07
gi|48772123|ref|ZP_00276465.1| COG0545: FKBP-type peptidyl-proly... 58 2e-07
gi|48835366|ref|ZP_00292366.1| COG0545: FKBP-type peptidyl-proly... 58 3e-07
gi|23474002|ref|ZP_00129297.1| COG1047: FKBP-type peptidyl-proly... 58 3e-07
gi|50878004|emb|CAG37844.1| related to peptidyl-prolyl cis-trans... 58 3e-07
gi|47229741|emb|CAG06937.1| unnamed protein product [Tetraodon n... 57 3e-07
gi|12322045|gb|AAG51068.1| FKBP-type peptidyl-prolyl cis-trans i... 57 3e-07
gi|48831308|ref|ZP_00288378.1| COG0545: FKBP-type peptidyl-proly... 57 3e-07
gi|29653968|ref|NP_819660.1| peptidyl-prolyl cis-trans isomerase... 57 3e-07
gi|46229698|gb|EAK90516.1| fkbp'fkbp [Cryptosporidium parvum] 57 3e-07
gi|48862677|ref|ZP_00316572.1| COG0545: FKBP-type peptidyl-proly... 57 3e-07
gi|45914220|ref|ZP_00192555.2| COG1047: FKBP-type peptidyl-proly... 57 4e-07
gi|15601419|ref|NP_233050.1| peptidyl-prolyl cis-trans isomerase... 57 4e-07
gi|21465757|pdb|1JVW|A Chain A, Trypanosoma Cruzi Macrophage Inf... 57 4e-07
gi|12805657|gb|AAH02311.1| Fkbp11 protein [Mus musculus] 57 4e-07
gi|538149|gb|AAA92352.1| peptidyl propyl cis/trans isomerase 57 4e-07
gi|23119633|ref|ZP_00102636.1| COG0545: FKBP-type peptidyl-proly... 57 4e-07
gi|1170958|sp|Q09734|MIP_TRYCR Macrophage infectivity potentiato... 57 4e-07
gi|47224137|emb|CAG13057.1| unnamed protein product [Tetraodon n... 57 6e-07
gi|633644|emb|CAA84280.1| FKBP-33 [Streptomyces chrysomallus] 57 6e-07
gi|629209|pir||S46228 peptidylprolyl isomerase (EC 5.2.1.8) FKBP... 57 6e-07
gi|32029649|ref|ZP_00132643.1| COG0545: FKBP-type peptidyl-proly... 57 6e-07
gi|38636681|dbj|BAD03102.1| putative immunophilin / FKBP-type pe... 56 8e-07
gi|27904951|ref|NP_778077.1| FKBP-type peptidyl-prolyl cis-trans... 56 1e-06
gi|28897059|ref|NP_796664.1| peptidyl-prolyl cis-trans isomerase... 56 1e-06
gi|48839935|ref|ZP_00296864.1| COG1047: FKBP-type peptidyl-proly... 56 1e-06
gi|34914162|ref|NP_918428.1| putative peptidylprolyl isomerase [... 56 1e-06
gi|34540502|ref|NP_904981.1| peptidyl-prolyl cis-trans isomerase... 56 1e-06
gi|20091954|ref|NP_618029.1| peptidylprolyl isomerase [Methanosa... 55 1e-06
gi|48728829|ref|ZP_00262583.1| COG0545: FKBP-type peptidyl-proly... 55 1e-06
gi|24372968|ref|NP_717010.1| peptidyl-prolyl cis-trans isomerase... 55 2e-06
gi|50122528|ref|YP_051695.1| FkbP-type peptidyl-prolyl cis-trans... 55 2e-06
gi|21226483|ref|NP_632405.1| Peptidyl-prolyl cis-trans isomerase... 55 2e-06
gi|23467176|ref|ZP_00122760.1| COG0545: FKBP-type peptidyl-proly... 55 2e-06
gi|48839936|ref|ZP_00296865.1| COG1047: FKBP-type peptidyl-proly... 55 2e-06
gi|38704245|ref|NP_313212.2| FKBP-type 22KD peptidyl-prolyl cis-... 55 2e-06
gi|26251113|ref|NP_757153.1| FKBP-type 22 kDa peptidyl-prolyl ci... 55 2e-06
gi|27366959|ref|NP_762486.1| FKBP-type peptidyl-prolyl cis-trans... 55 2e-06
gi|49176472|ref|NP_418628.3| FKBP-type 22KD peptidyl-prolyl cis-... 55 2e-06
gi|37676735|ref|NP_937131.1| FKBP-type peptidyl-prolyl cis-trans... 55 2e-06
gi|28900400|ref|NP_800055.1| peptidyl-prolyl cis-trans isomerase... 55 2e-06
gi|33469943|ref|NP_878247.1| similar to FK506 binding protein 9 ... 55 2e-06
gi|24115480|ref|NP_709990.1| FKBP-type 22KD peptidyl-prolyl cis-... 55 2e-06
gi|48861465|ref|ZP_00315366.1| COG0545: FKBP-type peptidyl-proly... 55 2e-06
gi|46131543|ref|ZP_00169814.2| COG0545: FKBP-type peptidyl-proly... 54 3e-06
gi|34556812|ref|NP_906627.1| PEPTIDYL-PROLYL CIS-TRANS ISOMERASE... 54 3e-06
gi|37678586|ref|NP_933195.1| FKBP-type peptidyl-prolyl cis-trans... 54 4e-06
gi|27364187|ref|NP_759715.1| FKBP-type peptidyl-prolyl cis-trans... 54 4e-06
gi|49075098|ref|XP_401638.1| hypothetical protein UM04023.1 [Ust... 54 4e-06
gi|24372650|ref|NP_716692.1| FKBP-type peptidyl-prolyl cis-trans... 54 4e-06
gi|23467650|ref|ZP_00123230.1| COG0545: FKBP-type peptidyl-proly... 54 4e-06
gi|32028638|ref|ZP_00131794.1| COG0545: FKBP-type peptidyl-proly... 54 4e-06
gi|20091955|ref|NP_618030.1| peptidylprolyl isomerase [Methanosa... 54 5e-06
gi|16763214|ref|NP_458831.1| probable FkbP-type peptidyl-prolyl ... 54 5e-06
gi|49127134|ref|XP_412768.1| hypothetical protein AN8631.2 [Aspe... 54 5e-06
gi|21226484|ref|NP_632406.1| Peptidyl-prolyl cis-trans isomerase... 54 5e-06
gi|48855598|ref|ZP_00309757.1| COG0545: FKBP-type peptidyl-proly... 54 5e-06
gi|16123678|ref|NP_406991.1| FKBP-type peptidyl-prolyl cis-trans... 53 6e-06
gi|6686802|emb|CAB64723.1| FKBP like protein [Arabidopsis thaliana] 53 6e-06
gi|29387364|gb|AAH48292.1| Similar to FK506 binding protein 11, ... 53 6e-06
gi|15232828|ref|NP_187617.1| immunophilin, putative / FKBP-type ... 53 6e-06
gi|50122795|ref|YP_051962.1| FkbP-type 16 kDa peptidyl-prolyl ci... 53 8e-06
gi|46914838|emb|CAG21615.1| putative peptidyl-prolyl cis-trans i... 53 8e-06
gi|48839934|ref|ZP_00296863.1| COG1047: FKBP-type peptidyl-proly... 52 1e-05
gi|32470858|ref|NP_863851.1| FKBP-type peptidyl-prolyl cis-trans... 52 1e-05
gi|40882253|emb|CAF06078.1| probable peptidylprolyl isomerase (F... 52 1e-05
gi|26987420|ref|NP_742845.1| peptidyl-prolyl cis-trans isomerase... 52 1e-05
gi|24372722|ref|NP_716764.1| peptidyl-prolyl cis-trans isomerase... 52 1e-05
gi|23465585|ref|NP_696188.1| Fk506-binding protein [Bifidobacter... 52 1e-05
gi|21672779|ref|NP_660846.1| FKBP-type peptidyl-prolyl cis-trans... 52 2e-05
gi|18605575|gb|AAH22900.1| Fkbp11 protein [Mus musculus] 52 2e-05
gi|34394609|dbj|BAC83911.1| immunophilin / FKBP-type peptidyl-pr... 51 2e-05
gi|15642563|ref|NP_232196.1| peptidyl-prolyl cis-trans isomerase... 51 2e-05
gi|33152887|ref|NP_874240.1| FKBP-type peptidyl-prolyl cis-trans... 51 2e-05
gi|34497817|ref|NP_902032.1| fkbp-type peptidyl-prolyl cis-trans... 51 2e-05
gi|15804798|ref|NP_290839.1| FKBP-type 22KD peptidyl-prolyl cis-... 51 2e-05
gi|49079582|gb|AAT49908.1| PA4572 [synthetic construct] 51 2e-05
gi|23464953|ref|NP_695556.1| possible secreted peptidyl-prolyl c... 51 2e-05
gi|34914148|ref|NP_918421.1| putative peptidylprolyl isomerase [... 51 2e-05
gi|45356045|dbj|BAD12460.1| peptidylprolyl cis-trans isomerase [... 51 2e-05
gi|15599768|ref|NP_253262.1| peptidyl-prolyl cis-trans isomerase... 51 2e-05
gi|11362461|pir||T46954 peptidylprolyl isomerase (EC 5.2.1.8) [v... 51 2e-05
gi|48854373|ref|ZP_00308536.1| COG0545: FKBP-type peptidyl-proly... 51 2e-05
gi|141004|sp|P21863|FKBX_PSEFL Probable FKBP-type 16 kDa peptidy... 51 3e-05
gi|46580973|ref|YP_011781.1| peptidyl-prolyl cis-trans isomerase... 50 4e-05
gi|15795153|dbj|BAB03141.1| unnamed protein product [Arabidopsis... 50 4e-05
gi|42659249|ref|XP_376903.1| KIAA0674 protein [Homo sapiens] 50 4e-05
gi|48861376|ref|ZP_00315278.1| COG1047: FKBP-type peptidyl-proly... 50 4e-05
gi|7437328|pir||T12197 immunophilin - fava bean >gnl|BL_ORD_ID|1... 50 4e-05
gi|7513061|pir||T00363 hypothetical protein KIAA0674 - human (fr... 50 4e-05
gi|39995491|ref|NP_951442.1| peptidyl-prolyl cis-trans isomerase... 50 4e-05
gi|23470186|ref|ZP_00125519.1| COG1047: FKBP-type peptidyl-proly... 50 4e-05
gi|23396593|sp|Q91XW8|FKB6_MOUSE FK506-binding protein 6 (Peptid... 50 5e-05
gi|26354863|dbj|BAC41058.1| unnamed protein product [Mus musculus] 50 5e-05
gi|15809008|ref|NP_291049.1| FK506 binding protein 6; FK506-bind... 50 5e-05
gi|20091956|ref|NP_618031.1| peptidylprolyl isomerase [Methanosa... 50 5e-05
gi|21536548|gb|AAM60880.1| immunophilin [Arabidopsis thaliana] 50 5e-05
gi|15618571|ref|NP_224857.1| FKBP-type peptidyl-prolyl cis-trans... 50 5e-05
gi|14039866|gb|AAK53413.1| FK506 binding protein [Mus musculus] 50 5e-05
gi|48728816|ref|ZP_00262570.1| COG1047: FKBP-type peptidyl-proly... 50 5e-05
gi|15603763|ref|NP_246837.1| unknown [Pasteurella multocida Pm70... 50 5e-05
>gi|17561778|ref|NP_504835.1| dauer or Aging adult Overexpression
DAO-1, FK506 Binding protein family (29.1 kD) (fkb-3)
[Caenorhabditis elegans]
gi|7495419|pir||T31741 hypothetical protein C05C8.3 -
Caenorhabditis elegans
gi|2291254|gb|AAB65370.1| Fk506-binding protein family protein 3
[Caenorhabditis elegans]
Length = 261
Score = 481 bits (1238), Expect = e-135
Identities = 237/261 (90%), Positives = 237/261 (90%)
Frame = +1
Query: 1 MLKSIIASALFAICWAANDRSWTTDEGVXXXXXXXXGDSKCKIKSESGDQLEQFYKLSDK 180
MLKSIIASALFAICWAANDRSWTTDEGV GDSKCKIKSESGDQLEQFYKLSDK
Sbjct: 1 MLKSIIASALFAICWAANDRSWTTDEGVKIEIIKKIGDSKCKIKSESGDQLEQFYKLSDK 60
Query: 181 EGKVIGSNFGQKPYTFTLGKGEVIHGMEIAMEGMCVGEQRKVIIPPXXXXXXXXXXXXXX 360
EGKVIGSNFGQKPYTFTLGKGEVIHGMEIAMEGMCVGEQRKVIIPP
Sbjct: 61 EGKVIGSNFGQKPYTFTLGKGEVIHGMEIAMEGMCVGEQRKVIIPPEQGFDEDGDEVEGK 120
Query: 361 XXTLYYFVELKSIFRPKPGAKWITDEGVHIHITHEVEGCTEKAQAGDTLHQQYTLNLEDG 540
TLYYFVELKSIFRPKPGAKWITDEGVHIHITHEVEGCTEKAQAGDTLHQQYTLNLEDG
Sbjct: 121 GETLYYFVELKSIFRPKPGAKWITDEGVHIHITHEVEGCTEKAQAGDTLHQQYTLNLEDG 180
Query: 541 SFIDSSWSRNRPFIFKMGSGQVIKGMDIAMEGMCQGEKRKVVIPPELAYGENGRPPAIPG 720
SFIDSSWSRNRPFIFKMGSGQVIKGMDIAMEGMCQGEKRKVVIPPELAYGENGRPPAIPG
Sbjct: 181 SFIDSSWSRNRPFIFKMGSGQVIKGMDIAMEGMCQGEKRKVVIPPELAYGENGRPPAIPG 240
Query: 721 NSYLHFDLSLEKLVRPGKEEL 783
NSYLHFDLSLEKLVRPGKEEL
Sbjct: 241 NSYLHFDLSLEKLVRPGKEEL 261