Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= C02B8_3
(1044 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25151989|ref|NP_509369.2| GenBank Accession Number in like (X... 678 0.0
gi|7495185|pir||T15375 hypothetical protein C02B8.6 - Caenorhabd... 671 0.0
gi|39580751|emb|CAE64137.1| Hypothetical protein CBG08753 [Caeno... 100 7e-20
gi|17558984|ref|NP_505917.1| GenBank Accession Number in like (5... 84 4e-15
gi|39592025|emb|CAE75245.1| Hypothetical protein CBG23202 [Caeno... 82 2e-14
gi|39583156|emb|CAE61374.1| Hypothetical protein CBG05216 [Caeno... 77 7e-13
gi|25145461|ref|NP_740943.1| GenBank Accession Number in like (1... 72 2e-11
gi|39583157|emb|CAE61375.1| Hypothetical protein CBG05218 [Caeno... 72 2e-11
gi|39598041|emb|CAE68733.1| Hypothetical protein CBG14663 [Caeno... 70 1e-10
gi|39598043|emb|CAE68735.1| Hypothetical protein CBG14665 [Caeno... 62 2e-08
gi|39589410|emb|CAE74439.1| Hypothetical protein CBG22172 [Caeno... 62 3e-08
gi|27729755|ref|XP_217722.1| similar to RIKEN cDNA 2610509H23 [R... 55 2e-06
gi|14042108|dbj|BAB55108.1| unnamed protein product [Homo sapiens] 55 3e-06
gi|14042704|dbj|BAB55359.1| unnamed protein product [Homo sapiens] 55 3e-06
gi|33636758|ref|NP_112225.2| ring finger protein 146; dactylidin... 55 3e-06
gi|27229062|ref|NP_080794.2| RIKEN cDNA 2610509H23 [Mus musculus... 55 3e-06
gi|14042318|dbj|BAB55196.1| unnamed protein product [Homo sapiens] 55 3e-06
gi|49065454|emb|CAG38545.1| RNF146 [Homo sapiens] 55 3e-06
gi|50769365|ref|XP_423089.1| PREDICTED: similar to ring finger p... 54 8e-06
gi|49114947|gb|AAH72810.1| Unknown (protein for MGC:80151) [Xeno... 54 8e-06
gi|49659845|gb|AAT68222.1| GekBS019P [Gekko japonicus] 53 1e-05
gi|47224066|emb|CAG12895.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|45200880|ref|NP_986450.1| AGL217Wp [Eremothecium gossypii] >g... 52 3e-05
gi|41054111|ref|NP_956148.1| ring finger protein 146 [Danio reri... 51 4e-05
gi|17550652|ref|NP_508904.1| patched related protein translocate... 51 4e-05
gi|34366000|gb|AAA82454.2| Hypothetical protein C26B9.6 [Caenorh... 51 4e-05
gi|39589411|emb|CAE74440.1| Hypothetical protein CBG22173 [Caeno... 50 7e-05
gi|47219120|emb|CAG01783.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|24666894|ref|NP_649138.2| CG8786-PB [Drosophila melanogaster]... 49 2e-04
gi|29249613|gb|EAA41121.1| GLP_306_45927_45298 [Giardia lamblia ... 48 3e-04
gi|17944341|gb|AAL48063.1| RE69393p [Drosophila melanogaster] 48 3e-04
gi|38344689|emb|CAD40247.2| OSJNBb0096E05.11 [Oryza sativa (japo... 48 4e-04
gi|46437312|gb|EAK96661.1| hypothetical protein CaO19.9527 [Cand... 47 0.001
gi|38079060|ref|XP_131865.3| similar to hypothetical protein FLJ... 47 0.001
gi|29841140|gb|AAP06153.1| similar to GenBank Accession Number A... 47 0.001
gi|31234203|ref|XP_319022.1| ENSANGP00000013356 [Anopheles gambi... 46 0.001
gi|48097068|ref|XP_393681.1| similar to hypothetical protein FLJ... 46 0.002
gi|41058217|ref|XP_371216.1| hypothetical protein XP_375683 [Hom... 45 0.003
gi|50290499|ref|XP_447681.1| unnamed protein product [Candida gl... 45 0.003
gi|34872516|ref|XP_216592.2| similar to hypothetical protein FLJ... 45 0.004
gi|50303933|ref|XP_451914.1| unnamed protein product [Kluyveromy... 45 0.004
gi|46136625|ref|XP_390004.1| hypothetical protein FG09828.1 [Gib... 44 0.005
gi|6755340|ref|NP_035410.1| tripartite motif protein 10; ring fi... 44 0.005
gi|18203572|sp|Q9WUH5|TRMA_MOUSE Tripartite motif protein 10 (RI... 44 0.005
gi|30186177|gb|AAH51632.1| Tripartite motif protein 10 [Mus musc... 44 0.005
gi|22775495|dbj|BAC11916.1| similar to A. thaliana AT4g08590 [Ar... 44 0.006
gi|50420525|ref|XP_458799.1| unnamed protein product [Debaryomyc... 44 0.006
gi|31212367|ref|XP_315168.1| ENSANGP00000021574 [Anopheles gambi... 44 0.006
gi|31242849|ref|XP_321855.1| ENSANGP00000020354 [Anopheles gambi... 44 0.006
gi|46124783|ref|XP_386945.1| hypothetical protein FG06769.1 [Gib... 44 0.006
gi|31212369|ref|XP_315169.1| ENSANGP00000025073 [Anopheles gambi... 44 0.006
gi|49089108|ref|XP_406305.1| hypothetical protein AN2168.2 [Aspe... 44 0.008
gi|34852124|ref|XP_227944.2| similar to Tripartite motif protein... 44 0.008
gi|47117344|sp|O19085|TRMA_PIG Tripartite motif protein 10 (RING... 44 0.008
gi|46237686|emb|CAE84058.1| tripartite motif-containing 10 [Ratt... 44 0.008
gi|5734771|gb|AAD50036.1| Similar to transcription factors [Arab... 43 0.010
gi|34858863|ref|XP_215027.2| similar to tripartite motif protein... 43 0.010
gi|25405372|pir||D96540 hypothetical protein F11F12.23 [imported... 43 0.010
gi|34852122|ref|XP_345078.1| similar to tripartite motif-contain... 43 0.010
gi|46237687|emb|CAE84059.1| tripartite motif-containing 40 [Ratt... 43 0.010
gi|18403061|ref|NP_564568.1| SNF2 domain-containing protein / he... 43 0.010
gi|48098234|ref|XP_392021.1| similar to zn-finger, RING and Zn-f... 43 0.014
gi|47228423|emb|CAG05243.1| unnamed protein product [Tetraodon n... 43 0.014
gi|38082336|ref|XP_111691.3| similar to tripartite motif-contain... 43 0.014
gi|6319590|ref|NP_009672.1| Protein that recognizes and binds da... 42 0.018
gi|26324804|dbj|BAC26156.1| unnamed protein product [Mus musculu... 42 0.018
gi|34785654|gb|AAH57094.1| Unknown (protein for MGC:73514) [Mus ... 42 0.018
gi|42566339|ref|NP_192599.2| zinc finger (C3HC4-type RING finger... 42 0.018
gi|172320|gb|AAA34930.1| excision repair protein 42 0.018
gi|7487608|pir||T00949 hypothetical protein T3F12.10 - Arabidops... 42 0.018
gi|37595555|ref|NP_060301.2| ring finger protein 125 [Homo sapiens] 42 0.018
gi|13874603|dbj|BAB46910.1| hypothetical protein [Macaca fascicu... 42 0.018
gi|7020569|dbj|BAA91182.1| unnamed protein product [Homo sapiens] 42 0.018
gi|15080562|gb|AAH12021.1| Ring finger protein 125 [Homo sapiens] 42 0.018
gi|7487036|pir||T01825 hypothetical protein T15F16.7 - Arabidops... 42 0.018
gi|49457847|ref|NP_001001857.1| zinc finger protein 313 [Xenopus... 42 0.023
gi|15218910|ref|NP_176778.1| zinc finger (C3HC4-type RING finger... 42 0.023
gi|48374375|gb|AAT42019.1| ZFP313 protein [Oryzias latipes] 42 0.023
gi|50752130|ref|XP_422667.1| PREDICTED: similar to KIAA0794 prot... 42 0.023
gi|25372670|pir||A96685 probable RING zinc finger protein F15E12... 42 0.023
gi|34365759|gb|AAQ65191.1| At1g66050 [Arabidopsis thaliana] 42 0.023
gi|47212269|emb|CAF96465.1| unnamed protein product [Tetraodon n... 42 0.023
gi|31982207|ref|NP_783608.2| RIKEN cDNA 9230105E10 gene [Mus mus... 42 0.023
gi|42562989|ref|NP_176779.2| zinc finger (C3HC4-type RING finger... 42 0.023
gi|28480484|ref|XP_133616.2| tripartite motif protein 6 [Mus mus... 42 0.030
gi|38328498|gb|AAH62252.1| Unknown (protein for IMAGE:864596) [M... 42 0.030
gi|39592530|emb|CAE63607.1| Hypothetical protein CBG08098 [Caeno... 42 0.030
gi|15384797|emb|CAC59701.1| peroxin-2 [Trypanosoma brucei] 42 0.030
gi|26329457|dbj|BAC28467.1| unnamed protein product [Mus musculus] 42 0.030
gi|12407415|gb|AAG53496.1| tripartite motif protein TRIM10 beta ... 42 0.030
gi|15241791|ref|NP_198771.1| zinc finger (C3HC4-type RING finger... 42 0.030
gi|6625539|emb|CAB63935.1| putative acid finger protein [Sus scr... 42 0.030
gi|12407413|gb|AAG53495.1| tripartite motif protein TRIM10 alpha... 42 0.030
gi|5803147|ref|NP_006769.1| tripartite motif-containing 10 isofo... 42 0.030
gi|38503304|sp|Q7YR32|TRMA_PANTR Tripartite motif protein 10 (RI... 42 0.030
gi|50403805|sp|Q9UDY6|TRMA_HUMAN Tripartite motif protein 10 (RI... 42 0.030
gi|48102321|ref|XP_395333.1| similar to ENSANGP00000015768 [Apis... 42 0.030
gi|16519561|ref|NP_439893.1| tripartite motif-containing 10 isof... 42 0.030
gi|20141865|sp|P15533|TM30_MOUSE Tripartite motif protein 30 (Do... 41 0.040
gi|16549281|dbj|BAB70792.1| unnamed protein product [Homo sapiens] 41 0.040
gi|13529425|gb|AAH05447.1| Trim30 protein [Mus musculus] 41 0.040
gi|12407361|gb|AAG53469.1| tripartite motif protein TRIM30 isofo... 41 0.040
gi|30685297|ref|NP_193839.3| BRCT domain-containing protein / zi... 41 0.040
gi|46136681|ref|XP_390032.1| hypothetical protein FG09856.1 [Gib... 41 0.040
gi|7486585|pir||T04938 hypothetical protein F7J7.10 - Arabidopsi... 41 0.040
gi|19698963|gb|AAL91217.1| unknown protein [Arabidopsis thaliana... 41 0.040
gi|29247735|gb|EAA39288.1| GLP_532_16129_17052 [Giardia lamblia ... 41 0.040
gi|6677815|ref|NP_033125.1| tripartite motif protein 30; regulat... 41 0.040
gi|7486979|pir||T10649 hypothetical protein T13K14.230 - Arabido... 41 0.040
gi|12407363|gb|AAG53470.1| tripartite motif protein [Mus musculus] 41 0.040
gi|91257|pir||A30891 regulatory protein rpt-1 - mouse 41 0.040
gi|22027612|ref|NP_066961.2| TNF receptor-associated factor 2; t... 41 0.040
gi|1363002|pir||S56163 tumor necrosis factor type 2 receptor ass... 41 0.040
gi|975273|gb|AAA87706.1| tumor necrosis factor type 2 receptor a... 41 0.040
gi|31874596|emb|CAD98040.1| hypothetical protein [Homo sapiens] 41 0.040
gi|50731640|ref|XP_418304.1| PREDICTED: similar to Peroxisome as... 41 0.052
gi|41055466|ref|NP_956716.1| hypothetical protein MGC64214 [Dani... 41 0.052
gi|49073306|ref|XP_400882.1| hypothetical protein UM03267.1 [Ust... 41 0.052
gi|41201046|ref|XP_062300.4| similar to RING finger protein 18 (... 41 0.052
gi|34853036|ref|XP_231032.2| similar to TNF receptor associated ... 41 0.052
gi|47218050|emb|CAG11455.1| unnamed protein product [Tetraodon n... 41 0.052
gi|26332372|dbj|BAC29916.1| unnamed protein product [Mus musculus] 40 0.068
gi|50303447|ref|XP_451665.1| unnamed protein product [Kluyveromy... 40 0.068
gi|47218518|emb|CAF98050.1| unnamed protein product [Tetraodon n... 40 0.068
gi|7259250|dbj|BAA92754.1| unnamed protein product [Mus musculus] 40 0.068
gi|41150504|ref|XP_370927.1| hypothetical protein LOC146310 [Hom... 40 0.068
gi|46441774|gb|EAL01068.1| hypothetical protein CaO19.229 [Candi... 40 0.068
gi|26354098|dbj|BAC40679.1| unnamed protein product [Mus musculus] 40 0.068
gi|34783232|gb|AAH29501.2| RNF151 protein [Homo sapiens] 40 0.068
gi|34870769|ref|XP_340806.1| similar to tripartite motif protein... 40 0.068
gi|26332439|dbj|BAC29937.1| unnamed protein product [Mus musculus] 40 0.068
gi|33468871|ref|NP_033448.1| Tnf receptor-associated factor 2 [M... 40 0.068
gi|731003|sp|P39429|TRA2_MOUSE TNF receptor associated factor 2 ... 40 0.068
gi|8394121|ref|NP_058930.1| peroxisomal membrane protein 3; pero... 40 0.089
gi|129555|sp|P24392|PEX2_RAT Peroxisome assembly factor-1 (PAF-1... 40 0.089
gi|32414701|ref|XP_327830.1| hypothetical protein [Neurospora cr... 40 0.089
gi|548450|sp|Q06438|PEX2_CRIGR Peroxisome assembly factor-1 (PAF... 40 0.089
gi|17506663|ref|NP_492499.1| SPla/RYanodine receptor SPRY (1J970... 40 0.089
gi|37622899|ref|NP_060543.5| ring finger protein 137; SSA protei... 40 0.089
gi|16923932|gb|AAL31641.1| Ro/SSA1 related protein FLJ10369 [Hom... 40 0.089
gi|15982946|gb|AAL11501.1| SSA protein SS-56 [Homo sapiens] 40 0.089
gi|47215448|emb|CAF97009.1| unnamed protein product [Tetraodon n... 40 0.089
gi|48374377|gb|AAT42020.1| ZFP313 protein [Oncorhynchus mykiss] 40 0.089
gi|34394186|dbj|BAC84638.1| putative Peroxisome assembly protein... 40 0.12
gi|16549336|dbj|BAB70801.1| unnamed protein product [Homo sapiens] 40 0.12
gi|34365285|emb|CAE45973.1| hypothetical protein [Homo sapiens] 40 0.12
gi|7510590|pir||T25935 hypothetical protein ZC13.1 - Caenorhabdi... 40 0.12
gi|23508752|ref|NP_701420.1| hypothetical protein [Plasmodium fa... 40 0.12
gi|5454014|ref|NP_006346.1| tripartite motif-containing 38; Ro/S... 40 0.12
gi|15011944|ref|NP_149083.1| tripartite motif protein TRIM5 isof... 40 0.12
gi|18204217|gb|AAH21258.1| Tripartite motif protein TRIM5, isofo... 40 0.12
gi|15011946|ref|NP_149084.1| tripartite motif protein TRIM5 isof... 40 0.12
gi|37515175|gb|AAQ91892.1| Hypothetical protein ZC13.1b [Caenorh... 40 0.12
gi|14719418|ref|NP_149023.1| tripartite motif protein TRIM5 isof... 40 0.12
gi|38605459|sp|Q9C035|TRM5_HUMAN Tripartite motif protein 5 >gnl... 40 0.12
gi|12407389|gb|AAG53483.1| tripartite motif protein TRIM5 isofor... 40 0.12
gi|31377566|ref|NP_689830.2| hypothetical protein FLJ35794 [Homo... 40 0.12
gi|12407383|gb|AAG53480.1| tripartite motif protein TRIM5 isofor... 40 0.12
gi|20887315|ref|XP_134599.1| RIKEN cDNA 1110031E24 [Mus musculus... 40 0.12
gi|30520320|ref|NP_849163.1| ring finger protein 166; hypothetic... 40 0.12
gi|23487732|gb|EAA21131.1| zinc finger protein-related [Plasmodi... 40 0.12
gi|5174699|ref|NP_006065.1| tripartite motif-containing 22; stim... 39 0.15
gi|39580294|emb|CAE73081.1| Hypothetical protein CBG20457 [Caeno... 39 0.15
gi|47606181|sp|Q8IYM9|TM22_HUMAN Tripartite motif protein 22 (RI... 39 0.15
gi|50554229|ref|XP_504523.1| hypothetical protein [Yarrowia lipo... 39 0.15
gi|26343717|dbj|BAC35515.1| unnamed protein product [Mus musculus] 39 0.15
gi|20070649|gb|AAH26930.1| Tripartite motif-containing 38 [Homo ... 39 0.15
gi|26379538|dbj|BAB29075.2| unnamed protein product [Mus musculus] 39 0.15
gi|46359889|gb|AAS88821.1| putative zinc finger protein [Oryza s... 39 0.15
gi|34871110|ref|XP_220225.2| similar to RIKEN cDNA 1700010O16 [R... 39 0.15
gi|21554064|gb|AAM63145.1| unknown [Arabidopsis thaliana] 39 0.15
gi|15228256|ref|NP_188282.1| SNF2 domain-containing protein / he... 39 0.20
gi|7576235|emb|CAB87983.1| Pex10p [Arabidopsis thaliana] 39 0.20
gi|18401101|ref|NP_565621.1| zinc-binding peroxisomal integral m... 39 0.20
gi|7488142|pir||T00968 probable peroxisome assembly protein PER8... 39 0.20
gi|50757544|ref|XP_415560.1| PREDICTED: similar to TNF receptor-... 39 0.20
gi|50758356|ref|XP_415883.1| PREDICTED: similar to RIKEN cDNA 06... 39 0.20
gi|11994614|dbj|BAB02751.1| unnamed protein product [Arabidopsis... 39 0.20
gi|41110131|ref|XP_047499.5| hypothetical protein XP_047499 [Hom... 39 0.20
gi|33877847|gb|AAH12758.1| LOC149603 protein [Homo sapiens] 39 0.20
gi|37574100|ref|NP_932129.1| RIKEN cDNA F730114J12 [Mus musculus... 39 0.20
gi|34878192|ref|XP_341582.1| similar to hypothetical protein [Ra... 39 0.20
gi|13385712|ref|NP_080481.1| RIKEN cDNA 1700010O16 [Mus musculus... 39 0.20
gi|18395127|ref|NP_564172.1| zinc finger (C3HC4-type RING finger... 39 0.20
gi|9629493|ref|NP_044724.1| hypothetical protein DaV1gp27 [Duck ... 39 0.20
gi|38074380|ref|XP_111412.2| similar to RING finger protein 15 (... 39 0.20
gi|42761564|gb|AAS45382.1| similar to Rattus norvegicus (Rat). P... 39 0.26
gi|14149754|ref|NP_075722.1| tripartite motif protein 13; ret fi... 39 0.26
gi|14581675|gb|AAK56791.1| putative transcription factor ret fin... 39 0.26
gi|16445412|ref|NP_434698.1| ret finger protein 2; candidate tum... 39 0.26
gi|24649543|ref|NP_651214.1| CG13605-PA [Drosophila melanogaster... 39 0.26
gi|26379548|dbj|BAC25419.1| unnamed protein product [Mus musculus] 39 0.26
gi|8928179|sp|O60858|RPF2_HUMAN Ret finger protein 2 (Leukemia a... 39 0.26
gi|21687248|ref|NP_033020.2| peroxisomal membrane protein 3; per... 39 0.26
gi|1709556|sp|P55098|PEX2_MOUSE Peroxisome assembly factor-1 (PA... 39 0.26
gi|34875177|ref|XP_344418.1| similar to tripartite motif protein... 39 0.26
gi|21592718|gb|AAM64667.1| putative peroxisome assembly protein ... 39 0.26
gi|46109372|ref|XP_381744.1| hypothetical protein FG01568.1 [Gib... 39 0.26
gi|15231009|ref|NP_188635.1| SNF2 domain-containing protein / he... 39 0.26
gi|14009638|gb|AAK51689.1| putative tumor suppressor LEU5/RFP2 [... 39 0.26
gi|21392032|gb|AAM48370.1| LD44641p [Drosophila melanogaster] 39 0.26
gi|12407425|gb|AAG53501.1| tripartite motif protein TRIM13 beta ... 39 0.26
gi|12407427|gb|AAG53502.1| tripartite motif protein TRIM13 [Mus ... 39 0.26
gi|47215450|emb|CAF97011.1| unnamed protein product [Tetraodon n... 39 0.26
gi|19114674|ref|NP_593762.1| hypothetical zinc-finger protein [S... 39 0.26
gi|39586052|emb|CAE69128.1| Hypothetical protein CBG15155 [Caeno... 39 0.26
gi|50290855|ref|XP_447860.1| unnamed protein product [Candida gl... 39 0.26
gi|47215415|emb|CAG01112.1| unnamed protein product [Tetraodon n... 39 0.26
gi|34871437|ref|XP_220473.2| similar to hypothetical protein [Ra... 38 0.34
gi|16877522|gb|AAH17017.1| Tripartite motif protein 31, isoform ... 38 0.34
gi|16445352|ref|NP_008959.2| tripartite motif protein 31 isoform... 38 0.34
gi|50757994|ref|XP_415709.1| PREDICTED: similar to tripartite mo... 38 0.34
gi|24233550|ref|NP_694737.1| ring finger protein 33 [Mus musculu... 38 0.34
gi|18411511|ref|NP_567207.1| zinc finger (C3HC4-type RING finger... 38 0.34
gi|16445354|ref|NP_438111.1| tripartite motif protein 31 isoform... 38 0.34
gi|19112215|ref|NP_595423.1| putative DNA repair and recombinati... 38 0.34
gi|7486358|pir||T10542 hypothetical protein F3I3.40 - Arabidopsi... 38 0.34
gi|30584893|gb|AAP36702.1| Homo sapiens tripartite motif-contain... 38 0.34
gi|33878170|gb|AAH21259.1| LOC201292 protein [Homo sapiens] 38 0.44
gi|6319911|ref|NP_009992.1| Protein involved in postreplication ... 38 0.44
gi|38092305|ref|XP_359262.1| similar to hypothetical protein [Mu... 38 0.44
gi|46229845|gb|EAK90663.1| ring domain-containing protein [Crypt... 38 0.44
gi|50303981|ref|XP_451940.1| unnamed protein product [Kluyveromy... 38 0.44
gi|42571335|ref|NP_973758.1| zinc finger (C3HC4-type RING finger... 38 0.44
gi|38091370|ref|XP_111186.2| similar to hypothetical protein [Mu... 38 0.44
gi|42561677|ref|NP_171898.2| zinc finger (C3HC4-type RING finger... 38 0.44
gi|38679905|ref|NP_775818.2| hypothetical protein LOC201292 [Hom... 38 0.44
gi|338490|gb|AAA36651.1| 52-kD SS-A/Ro autoantigen 38 0.44
gi|29245606|gb|EAA37235.1| GLP_91_8176_7298 [Giardia lamblia ATC... 38 0.44
gi|32880219|ref|NP_872596.1| Sjogren syndrome antigen A1 (52kDa,... 38 0.44
gi|50301248|gb|AAT73777.1| TRIM5/cyclophilin A fusion protein [A... 38 0.44
gi|50292251|ref|XP_448558.1| unnamed protein product [Candida gl... 38 0.44
gi|40353773|ref|NP_056246.2| BIA2 protein [Homo sapiens] 38 0.44
gi|20270917|gb|AAM18475.1| VHSV-induced protein [Oncorhynchus my... 38 0.44
gi|18414200|ref|NP_567428.1| zinc finger (C3HC4-type RING finger... 37 0.57
gi|21593293|gb|AAM65242.1| unknown [Arabidopsis thaliana] 37 0.57
gi|47219063|emb|CAG00202.1| unnamed protein product [Tetraodon n... 37 0.57
gi|12653751|gb|AAH00661.1| Peroxisomal membrane protein 3 [Homo ... 37 0.57
gi|27819902|gb|AAL29060.2| LD46714p [Drosophila melanogaster] 37 0.57
gi|50510259|dbj|BAD31463.1| putative zinc finger (C3HC4-type RIN... 37 0.57
gi|50286025|ref|XP_445441.1| unnamed protein product [Candida gl... 37 0.57
gi|28376707|gb|AAO41137.1| unknown protein [Oryza sativa (japoni... 37 0.57
gi|47216792|emb|CAG10114.1| unnamed protein product [Tetraodon n... 37 0.57
gi|47939766|gb|AAH72198.1| MGC81102 protein [Xenopus laevis] 37 0.57
gi|50058098|dbj|BAD27395.1| transactivator protein [Equine herpe... 37 0.57
gi|50313304|ref|YP_053107.1| transcriptional activator [Equine h... 37 0.57
gi|38103751|gb|EAA50416.1| hypothetical protein MG04175.4 [Magna... 37 0.57
gi|21363032|sp|Q9BZY9|TM31_HUMAN Tripartite motif protein 31 >gn... 37 0.57
gi|12275862|gb|AAG50166.1| tripartite motif protein TRIM31 beta ... 37 0.57
gi|47223455|emb|CAF97942.1| unnamed protein product [Tetraodon n... 37 0.57
gi|1770499|emb|CAA69165.1| put. ring protein [Homo sapiens] 37 0.57
gi|34875159|ref|XP_221125.2| similar to 52 kDa Ro protein (Sjogr... 37 0.57
gi|47206993|emb|CAF92401.1| unnamed protein product [Tetraodon n... 37 0.57
gi|1754692|gb|AAB63316.1| contains a deletion of 399 base pairs ... 37 0.57
gi|38086920|ref|XP_195255.2| similar to hypothetical protein FLJ... 37 0.57
gi|21355975|ref|NP_648210.1| CG7081-PA [Drosophila melanogaster]... 37 0.57
gi|40255281|ref|NP_954597.1| tripartite motif protein 30-like [M... 37 0.57
gi|1857417|gb|AAB48828.1| Gim1 [Leishmania donovani] 37 0.57
gi|21450119|ref|NP_659122.1| Np95-like ring finger protein; nucl... 37 0.57
gi|47224884|emb|CAG06454.1| unnamed protein product [Tetraodon n... 37 0.57
gi|515101|pdb|1CHC| Equine Herpes Virus-1 (C3hc4, Or Ring Domai... 37 0.57
gi|38101531|gb|EAA48481.1| hypothetical protein MG00139.4 [Magna... 37 0.75
gi|50554893|ref|XP_504855.1| hypothetical protein [Yarrowia lipo... 37 0.75
gi|4506343|ref|NP_000309.1| peroxisomal membrane protein 3; Pero... 37 0.75
gi|47559193|gb|AAT10388.2| tripartite motif protein TRIM5alpha [... 37 0.75
gi|48994825|gb|AAT48103.1| Trim5 alpha [Cercopithecus aethiops] 37 0.75
gi|50726942|gb|AAT81167.1| TRIM5-alpha [Cercopithecus aethiops] 37 0.75
gi|48994827|gb|AAT48104.1| Trim5 alpha [Cercopithecus aethiops] 37 0.75
gi|31620987|emb|CAD69021.2| tumor necrosis factor receptor assoc... 37 0.75
gi|50418106|gb|AAH77164.1| Unknown (protein for MGC:91888) [Dani... 37 0.75
gi|50761182|ref|XP_418269.1| PREDICTED: similar to ubiquitin-lik... 37 0.75
gi|34904734|ref|NP_913714.1| helicase-like transcription factor-... 37 0.75
gi|41146735|ref|XP_373039.1| similar to ring finger protein 129 ... 37 0.75
gi|6324518|ref|NP_014587.1| Nuclear protein, putative RNA polyme... 37 0.75
gi|38174506|gb|AAH60785.1| TRIM40 protein [Homo sapiens] 37 0.75
gi|9629792|ref|NP_045280.1| 63 [Equine herpesvirus 4] >gnl|BL_OR... 37 0.75
gi|50401219|sp|P62603|TM26_RAT Tripartite motif-containing prote... 37 0.75
gi|38083120|ref|XP_359288.1| similar to Trim26 protein [Mus musc... 37 0.75
gi|12275878|gb|AAG50174.1| tripartite motif protein TRIM26 alpha... 37 0.75
gi|15147232|ref|NP_109623.4| tripartite motif protein 26; zinc f... 37 0.75
gi|50401661|sp|Q99PN3|TM26_MOUSE Tripartite motif-containing pro... 37 0.75
gi|50731710|ref|XP_418336.1| PREDICTED: similar to ring finger p... 37 0.75
gi|44890117|gb|AAS48506.1| tripartite motif-containing 5 gamma i... 37 0.75
gi|20162564|ref|NP_619645.1| tripartite motif-containing 40; rin... 37 0.75
gi|30584367|gb|AAP36432.1| Homo sapiens zinc finger protein 313 ... 37 0.75
gi|44890115|gb|AAS48505.1| tripartite motif-containing 5 alpha i... 37 0.75
gi|48994823|gb|AAT48102.1| Trim5 alpha [Macaca mulatta] 37 0.75
gi|49227389|ref|NP_001001828.1| zinc finger protein 313 [Danio r... 37 0.75
gi|40747978|gb|AAR89523.1| breast cancer 1 [Tetraodon nigroviridis] 37 0.75
gi|19075345|ref|NP_587845.1| hypothetical zinc finger protein; C... 37 0.75
gi|49274651|ref|NP_001001869.1| zinc finger protein 313 [Sus scr... 37 0.75
gi|50401742|sp|Q6J212|Z313_PANTR Zinc finger protein 313 >gnl|BL... 37 0.75
gi|34852035|ref|XP_227946.2| similar to Trim26 protein [Rattus n... 37 0.75
gi|33589239|dbj|BAC81739.1| Np95-like ring finger protein [Mus m... 37 0.75
gi|8923898|ref|NP_061153.1| zinc finger protein 313 [Homo sapien... 37 0.75
gi|26335007|dbj|BAC31204.1| unnamed protein product [Mus musculus] 37 0.75
gi|26348203|dbj|BAC37741.1| unnamed protein product [Mus musculus] 37 0.98
gi|39583298|emb|CAE60090.1| Hypothetical protein CBG03614 [Caeno... 37 0.98
gi|9759291|dbj|BAB09756.1| unnamed protein product [Arabidopsis ... 37 0.98
gi|47228302|emb|CAG07697.1| unnamed protein product [Tetraodon n... 37 0.98
gi|31201849|ref|XP_309872.1| ENSANGP00000023268 [Anopheles gambi... 37 0.98
gi|47499960|gb|AAT28738.1| Zfp313 protein [Xenopus laevis] 37 0.98
gi|16945892|gb|AAL32171.1| chromosome 17 open reading frame 27 [... 37 0.98
gi|46438330|gb|EAK97662.1| hypothetical protein CaO19.10910 [Can... 37 0.98
gi|3850134|emb|CAA21935.1| zinc finger protein [Candida albicans] 37 0.98
gi|50807185|ref|XP_424549.1| PREDICTED: similar to Midline 2 pro... 37 0.98
gi|23312364|ref|NP_690856.1| Np95-like ring finger protein isofo... 37 0.98
gi|50554793|ref|XP_504805.1| hypothetical protein [Yarrowia lipo... 37 0.98
gi|50256761|gb|EAL19481.1| hypothetical protein CNBG4280 [Crypto... 37 0.98
gi|7486064|pir||T05544 hypothetical protein F24A6.70 - Arabidops... 37 0.98
gi|48040531|ref|NP_001001517.1| zinc finger protein 313 [Rattus ... 37 0.98
gi|27229275|ref|NP_109668.2| zinc finger protein 313; zinc finge... 37 0.98
gi|32408171|ref|XP_324567.1| PROTEIN UVS-2 [Neurospora crassa] >... 37 0.98
gi|39594794|emb|CAE70662.1| Hypothetical protein CBG17369 [Caeno... 37 0.98
gi|37932515|gb|AAP76397.1| RAG1 protein [Dendromus mesomelas] 37 0.98
gi|465016|sp|P33288|UVS2_NEUCR Postreplication repair protein uv... 37 0.98
gi|18423281|ref|NP_568760.1| zinc finger (C3HC4-type RING finger... 37 0.98
gi|22328916|ref|NP_194253.2| zinc finger (C3HC4-type RING finger... 37 0.98
gi|17063161|gb|AAL32977.1| AT5g51450/MFG13_16 [Arabidopsis thali... 37 0.98
gi|21593353|gb|AAM65302.1| unknown [Arabidopsis thaliana] 37 0.98
gi|18413797|ref|NP_568096.1| zinc finger (C3HC4-type RING finger... 37 0.98
gi|47123032|gb|AAH70713.1| MGC83471 protein [Xenopus laevis] 37 0.98
gi|50729965|ref|XP_416727.1| PREDICTED: similar to mtprd protein... 36 1.3
gi|47085807|ref|NP_998242.1| ubiquitin-like, containing PHD and ... 36 1.3
gi|17535019|ref|NP_494227.1| RING zinc finger containing protein... 36 1.3
gi|50405111|ref|YP_054203.1| hypothetical protein, RING Zn-finge... 36 1.3
gi|4508005|ref|NP_003440.1| tripartite motif-containing 26; acid... 36 1.3
gi|30314370|gb|AAP12381.1| recombination activating protein 1 [P... 36 1.3
gi|38503306|sp|Q7YR34|TM26_PANTR Tripartite motif-containing pro... 36 1.3
gi|31981596|ref|NP_035061.2| ubiquitin-like, containing PHD and ... 36 1.3
gi|50284767|ref|XP_444811.1| unnamed protein product [Candida gl... 36 1.3
gi|50745194|ref|XP_420016.1| PREDICTED: similar to CG10958-like ... 36 1.3
gi|49618893|gb|AAT68031.1| NP95 [Danio rerio] 36 1.3
gi|7488052|pir||E71405 probable ankyrin - Arabidopsis thaliana >... 36 1.3
gi|29250668|gb|EAA42158.1| GLP_480_59788_60912 [Giardia lamblia ... 36 1.3
gi|27672556|ref|XP_236781.1| similar to Ac2-121 [Rattus norvegic... 36 1.3
gi|31205499|ref|XP_311701.1| ENSANGP00000015141 [Anopheles gambi... 36 1.3
gi|47223121|emb|CAG11256.1| unnamed protein product [Tetraodon n... 36 1.3
gi|7496652|pir||T15689 hypothetical protein C28G1.3 - Caenorhabd... 36 1.3
gi|47227859|emb|CAG09022.1| unnamed protein product [Tetraodon n... 36 1.3
gi|25153296|ref|NP_741866.1| ring finger family member (XJ448) [... 36 1.3
gi|28484812|ref|XP_286106.1| similar to ring finger protein 129 ... 36 1.3
gi|50730893|ref|XP_417067.1| PREDICTED: similar to ret finger pr... 36 1.3
gi|47215678|emb|CAG04762.1| unnamed protein product [Tetraodon n... 36 1.3
gi|38605849|emb|CAD41603.3| OSJNBb0034G17.7 [Oryza sativa (japon... 36 1.3
gi|47523460|ref|NP_999351.1| tripartite motif protein 50 [Sus sc... 36 1.3
gi|50254932|gb|EAL17672.1| hypothetical protein CNBL1870 [Crypto... 36 1.3
gi|48976125|ref|NP_001001767.1| zinc finger protein 313 [Gallus ... 36 1.3
gi|17534479|ref|NP_496634.1| putative protein family member, wit... 36 1.3
gi|38198607|ref|NP_938175.1| si:busm1-57i23.1; si:dz57i23.1 [Dan... 36 1.3
gi|46805057|dbj|BAD17038.1| putative SNF2 domain-containing prot... 36 1.3
gi|46443104|gb|EAL02388.1| hypothetical protein CaO19.10486 [Can... 36 1.3
gi|34100874|gb|AAQ57549.1| recombination activating protein 1 [D... 36 1.3
gi|48142879|ref|XP_393619.1| similar to ENSANGP00000010651 [Apis... 36 1.3
gi|47227861|emb|CAG09024.1| unnamed protein product [Tetraodon n... 36 1.3
gi|19881417|ref|NP_612234.1| putative zinc finger protein [infec... 36 1.3
gi|32404678|ref|XP_322952.1| hypothetical protein ( (AL451013) p... 36 1.7
gi|27660717|ref|XP_219011.1| similar to 52kD Ro/SSA autoantigen ... 36 1.7
gi|26344672|dbj|BAC35985.1| unnamed protein product [Mus musculus] 36 1.7
gi|13386356|ref|NP_083118.1| RIKEN cDNA 1700045I19 [Mus musculus... 36 1.7
gi|50761730|ref|XP_429155.1| PREDICTED: similar to Zgc:63539 [Ga... 36 1.7
gi|46361225|emb|CAG25086.1| c3h4-type ring finger protein, putat... 36 1.7
gi|23612351|ref|NP_703931.1| c3h4-type ring finger protein, puta... 36 1.7
gi|46122409|ref|XP_385758.1| hypothetical protein FG05582.1 [Gib... 36 1.7
gi|34364607|emb|CAE45709.1| hypothetical protein [Homo sapiens] 36 1.7
gi|37622896|ref|NP_079054.3| ring finger protein 127 [Homo sapiens] 36 1.7
gi|34100854|gb|AAQ57539.1| recombination activating protein 1 [T... 36 1.7
gi|26449305|dbj|BAC41780.1| hypothetical protein [Macaca fascicu... 36 1.7
gi|4220590|dbj|BAA74579.1| nuclear protein np95 [Mus musculus] >... 36 1.7
gi|30314382|gb|AAP12387.1| recombination activating protein 1 [D... 36 1.7
gi|30314384|gb|AAP12388.1| recombination activating protein 1 [T... 36 1.7
gi|34100840|gb|AAQ57532.1| recombination activating protein 1 [R... 36 1.7
gi|31198947|ref|XP_308421.1| ENSANGP00000019059 [Anopheles gambi... 36 1.7
gi|30842804|ref|NP_851594.1| tripartite motif protein 50 [Rattus... 36 1.7
gi|30142677|ref|NP_839971.1| tripartite motif protein 50 [Mus mu... 36 1.7
gi|15208660|ref|NP_003132.2| 52kD Ro/SSA autoantigen; Sjogren sy... 36 1.7
gi|14994115|gb|AAK76432.1| SSA1 [Homo sapiens] 36 1.7
gi|23479801|gb|EAA16532.1| similar to CG8974 gene product-relate... 36 1.7
gi|18410010|ref|NP_565037.1| zinc finger (C3HC4-type RING finger... 36 1.7
gi|41124489|ref|XP_371536.1| similar to tripartite motif-contain... 36 1.7
gi|20270353|ref|NP_620155.1| tripartite motif-containing 43 [Hom... 36 1.7
gi|28828361|gb|AAO51011.1| similar to Homo sapiens (Human). Hypo... 36 1.7
gi|7494154|pir||F71614 chromatinic RING finger DRING protein hom... 36 1.7
gi|41054113|ref|NP_956149.1| Unknown (protein for MGC:64185); wu... 36 1.7
gi|38105574|gb|EAA51987.1| hypothetical protein MG03582.4 [Magna... 36 1.7
gi|21750228|dbj|BAC03744.1| unnamed protein product [Homo sapiens] 36 1.7
gi|23593295|ref|NP_473016.2| hypothetical protein [Plasmodium fa... 36 1.7
gi|32404682|ref|XP_322954.1| hypothetical protein ( (AL451013) c... 35 2.2
gi|27708530|ref|XP_228891.1| similar to Hypothetical protein FLJ... 35 2.2
gi|12833017|dbj|BAB22354.1| unnamed protein product [Mus musculus] 35 2.2
gi|12963843|ref|NP_076324.1| tripartite motif protein 12 [Mus mu... 35 2.2
gi|26336597|dbj|BAC31981.1| unnamed protein product [Mus musculus] 35 2.2
gi|34867140|ref|XP_342820.1| similar to p53-binding protein-3 [R... 35 2.2
gi|7503491|pir||T22238 hypothetical protein F45G2.6 - Caenorhabd... 35 2.2
gi|37932573|gb|AAP76426.1| RAG1 protein [Spermophilopsis leptoda... 35 2.2
gi|47215872|emb|CAG12264.1| unnamed protein product [Tetraodon n... 35 2.2
gi|12844768|dbj|BAB26491.1| unnamed protein product [Mus musculus] 35 2.2
gi|50424953|ref|XP_461068.1| unnamed protein product [Debaryomyc... 35 2.2
gi|15919933|dbj|BAB69457.1| p53-binding protein-3 [Mus musculus] 35 2.2
gi|26984649|emb|CAD59123.1| SI:dZ182N13.1 (first exon of novel p... 35 2.2
gi|26251937|gb|AAH40797.1| Topoisomerase 1-binding RING finger [... 35 2.2
gi|29336062|ref|NP_598858.2| topoisomerase 1-binding RING finger... 35 2.2
gi|37932569|gb|AAP76424.1| RAG1 protein [Xerus inauris] 35 2.2
gi|49902960|gb|AAH76205.1| Unknown (protein for IMAGE:7075757) [... 35 2.2
gi|33416737|gb|AAH56131.1| MGC69169 protein [Xenopus laevis] 35 2.2
gi|37932595|gb|AAP76437.1| RAG1 protein [Paraxerus cepapi] 35 2.2
gi|50757803|ref|XP_415653.1| PREDICTED: similar to Zinc finger p... 35 2.2
gi|34100846|gb|AAQ57535.1| recombination activating protein 1 [S... 35 2.2
gi|22326612|ref|NP_196132.2| SNF2 domain-containing protein / he... 35 2.2
gi|9664148|dbj|BAB03715.1| RING-finger protein [Homo sapiens] 35 2.2
gi|34100848|gb|AAQ57536.1| recombination activating protein 1 [T... 35 2.2
gi|31542779|ref|NP_848651.2| hypothetical protein FLJ36180 [Homo... 35 2.2
gi|4566495|gb|AAD23379.1| topoisomerase I-binding RS protein [Ho... 35 2.2
gi|38174276|gb|AAH60884.1| Topoisomerase I binding, arginine/ser... 35 2.2
gi|30314350|gb|AAP12371.1| recombination activating protein 1 [O... 35 2.2
gi|2501723|sp|Q91829|RAG1_XENLA V(D)J recombination activating p... 35 2.2
gi|40805104|ref|NP_005793.2| topoisomerase I binding, arginine/s... 35 2.2
gi|21751880|dbj|BAC04060.1| unnamed protein product [Homo sapiens] 35 2.2
gi|50401217|sp|O77666|TM26_PIG Tripartite motif-containing prote... 35 2.2
gi|10178052|dbj|BAB11535.1| helicase-like transcription factor-l... 35 2.2
gi|50761353|ref|XP_429119.1| PREDICTED: similar to topoisomerase... 35 2.2
gi|32565349|ref|NP_499773.2| TNF Receptor associated Factor homo... 35 2.2
gi|34100838|gb|AAQ57531.1| recombination activating protein 1 [M... 35 2.2
gi|34223821|gb|AAQ63079.1| recombination activating gene 1 [Pero... 35 2.2
gi|9625935|ref|NP_040183.1| unnamed protein product [Human herpe... 35 2.2
gi|21313294|ref|NP_084064.1| RIKEN cDNA 0610013E23 [Mus musculus... 35 2.2
gi|29747762|gb|AAH50796.1| 0610013E23Rik protein [Mus musculus] 35 2.2
gi|32420539|ref|XP_330713.1| hypothetical protein [Neurospora cr... 35 2.2
gi|27370731|gb|AAH37141.1| Topors protein [Mus musculus] 35 2.2
gi|50754723|ref|XP_414478.1| PREDICTED: similar to Zinc finger p... 35 2.2
gi|34223815|gb|AAQ63076.1| recombination activating gene 1 [Phod... 35 2.2
gi|34223807|gb|AAQ63072.1| recombination activating gene 1 [Loph... 35 2.2
gi|27679216|ref|XP_219046.1| similar to 9230105E10Rik protein [R... 35 2.2
gi|34100850|gb|AAQ57537.1| recombination activating protein 1 [U... 35 2.2
gi|23612116|ref|NP_703696.1| hypothetical protein [Plasmodium fa... 35 2.2
gi|41055965|ref|NP_956431.1| similar to RAD18 homolog [Danio rer... 35 2.2
gi|47214622|emb|CAG01463.1| unnamed protein product [Tetraodon n... 35 2.2
gi|24653345|ref|NP_610866.1| CG17048-PA [Drosophila melanogaster... 35 2.2
gi|34223817|gb|AAQ63077.1| recombination activating gene 1 [Meso... 35 2.9
gi|17532249|ref|NP_495279.1| ring finger protein (2G644) [Caenor... 35 2.9
gi|47216793|emb|CAG10115.1| unnamed protein product [Tetraodon n... 35 2.9
gi|37932551|gb|AAP76415.1| RAG1 protein [Sciurus stramineus] 35 2.9
gi|37932561|gb|AAP76420.1| RAG1 protein [Tamiops swinhoei] 35 2.9
gi|37932531|gb|AAP76405.1| RAG1 protein [Phyllotis xanthopygus c... 35 2.9
gi|37932547|gb|AAP76413.1| RAG1 protein [Tamiasciurus hudsonicus] 35 2.9
gi|23337081|gb|AAH37344.1| Recombination activating gene 1 [Homo... 35 2.9
gi|50308525|ref|XP_454265.1| unnamed protein product [Kluyveromy... 35 2.9
gi|37932597|gb|AAP76438.1| RAG1 protein [Paraxerus ochraceus] 35 2.9
gi|37932535|gb|AAP76407.1| RAG1 protein [Aplodontia rufa] 35 2.9
gi|37932557|gb|AAP76418.1| RAG1 protein [Callosciurus erythraeus] 35 2.9
gi|37932559|gb|AAP76419.1| RAG1 protein [Callosciurus prevostii] 35 2.9
gi|34223825|gb|AAQ63081.1| recombination activating gene 1 [Neot... 35 2.9
gi|26984587|emb|CAD59179.1| SI:dZ163L24.4 (novel protein with RI... 35 2.9
gi|29841095|gb|AAP06108.1| hypothetical protein with Meprin and ... 35 2.9
gi|47223678|emb|CAF99287.1| unnamed protein product [Tetraodon n... 35 2.9
gi|37932585|gb|AAP76432.1| RAG1 protein [Marmota sibirica] 35 2.9
gi|37932591|gb|AAP76435.1| RAG1 protein [Protoxerus stangeri] 35 2.9
gi|37932517|gb|AAP76398.1| RAG1 protein [Beamys hindei] 35 2.9
gi|34100866|gb|AAQ57545.1| recombination activating protein 1 [A... 35 2.9
gi|30314358|gb|AAP12375.1| recombination activating protein 1 [H... 35 2.9
gi|37932563|gb|AAP76421.1| RAG1 protein [Dremomys pernyi] 35 2.9
gi|4557841|ref|NP_000439.1| recombination activating gene 1 [Hom... 35 2.9
gi|37932555|gb|AAP76417.1| RAG1 protein [Microsciurus flaviventer] 35 2.9
gi|37932579|gb|AAP76429.1| RAG1 protein [Tamias amoenus] 35 2.9
gi|22749269|ref|NP_689833.1| ring finger protein 129 [Homo sapie... 35 2.9
gi|21312628|ref|NP_082295.1| RIKEN cDNA 2410006N06; U 2-3-0 [Mus... 35 2.9
gi|34223779|gb|AAQ63058.1| recombination activating gene 1 [Cric... 35 2.9
gi|30314356|gb|AAP12374.1| recombination activating protein 1 [B... 35 2.9
gi|9966829|ref|NP_065091.1| ring finger protein 18; testis-speci... 35 2.9
gi|49902001|gb|AAH75020.1| Ring finger protein 18 [Homo sapiens] 35 2.9
gi|34100868|gb|AAQ57546.1| recombination activating protein 1 [T... 35 2.9
gi|25410884|pir||C84421 probable RING-H2 finger protein RHA2b [i... 35 2.9
gi|37932565|gb|AAP76422.1| RAG1 protein [Sundasciurus philippine... 35 2.9
gi|37932577|gb|AAP76428.1| RAG1 protein [Tamias sibiricus] 35 2.9
gi|37932581|gb|AAP76430.1| RAG1 protein [Tamias ruficaudus] 35 2.9
gi|37932575|gb|AAP76427.1| RAG1 protein [Sciurotamias davidianus] 35 2.9
gi|12407373|gb|AAG53475.1| tripartite motif protein TRIM3 isofor... 35 2.9
gi|47215426|emb|CAG01123.1| unnamed protein product [Tetraodon n... 35 2.9
gi|34223829|gb|AAQ63083.1| recombination activating gene 1 [Rhip... 35 2.9
gi|34223827|gb|AAQ63082.1| recombination activating gene 1 [Akod... 35 2.9
gi|47216281|emb|CAF96577.1| unnamed protein product [Tetraodon n... 35 2.9
gi|50406386|ref|XP_456629.1| unnamed protein product [Debaryomyc... 35 2.9
gi|31560638|ref|NP_033303.2| 52kD Ro/SSA autoantigen; Sjogren sy... 35 2.9
gi|3024571|sp|Q62191|RO52_MOUSE 52 kDa Ro protein (Sjogren syndr... 35 2.9
gi|34223819|gb|AAQ63078.1| recombination activating gene 1 [Cric... 35 2.9
gi|33468961|ref|NP_061368.1| tripartite motif protein 3; ring fi... 35 2.9
gi|34223823|gb|AAQ63080.1| recombination activating gene 1 [Reit... 35 2.9
gi|37932589|gb|AAP76434.1| RAG1 protein [Heliosciurus undulatus] 35 2.9
gi|13929112|ref|NP_113974.1| ring finger protein 22 [Rattus norv... 35 2.9
gi|32454737|ref|NP_150594.2| tripartite motif-containing 3; brai... 35 2.9
gi|12407375|gb|AAG53476.1| tripartite motif protein TRIM3 isofor... 35 2.9
gi|21362992|sp|O75382|TRM3_HUMAN Tripartite motif protein 3 (RIN... 35 2.9
gi|37932543|gb|AAP76411.1| RAG1 protein [Glaucomys volans] 35 2.9
gi|33859694|ref|NP_081631.1| RIKEN cDNA 3110001H15 [Mus musculus... 35 2.9
gi|34100836|gb|AAQ57530.1| recombination activating protein 1 [M... 35 2.9
gi|18379162|ref|NP_565253.1| zinc finger (C3HC4-type RING finger... 35 2.9
gi|9631099|ref|NP_047769.1| LdOrf-132 [Lymantria dispar nucleopo... 35 2.9
gi|19173184|ref|NP_596987.1| putative Zn finger protein [Encepha... 35 2.9
gi|49618993|gb|AAT68081.1| RING+BBOX zinc finger protein [Danio ... 35 3.7
gi|37932529|gb|AAP76404.1| RAG1 protein [Sigmodon hispidus] 35 3.7
>gi|25151989|ref|NP_509369.2| GenBank Accession Number in like (XI752)
[Caenorhabditis elegans]
gi|21431932|sp|Q11096|YWZ6_CAEEL Hypothetical RING finger protein
C02B8.6 in chromosome X
gi|16604101|gb|AAA81439.2| Hypothetical protein C02B8.6
[Caenorhabditis elegans]
Length = 347
Score = 678 bits (1750), Expect = 0.0
Identities = 321/347 (92%), Positives = 321/347 (92%)
Frame = -1
Query: 1044 MTDICTICHNTPNRPVRLDCNHEFCYICIKGSIQNDMLNCAVCRRPFDSSIILNLSAQVC 865
MTDICTICHNTPNRPVRLDCNHEFCYICIKGSIQNDMLNCAVCRRPFDSSIILNLSAQVC
Sbjct: 1 MTDICTICHNTPNRPVRLDCNHEFCYICIKGSIQNDMLNCAVCRRPFDSSIILNLSAQVC 60
Query: 864 LKGDAPRXXXXXXXXXXXXXXXVKPDVNLLRAAMNANQNGNRELVAAAPHMXXXXXXXXX 685
LKGDAPR VKPDVNLLRAAMNANQNGNRELVAAAPHM
Sbjct: 61 LKGDAPRDVDDDEEEVQDEEIDVKPDVNLLRAAMNANQNGNRELVAAAPHMNNNGNFHNA 120
Query: 684 XXNYQVPTTSQGMVNQFGWPQFQAHSDFPYTLGYWGNQFPPFWNNAARNWGDVQQAANPV 505
NYQVPTTSQGMVNQFGWPQFQAHSDFPYTLGYWGNQFPPFWNNAARNWGDVQQAANPV
Sbjct: 121 QGNYQVPTTSQGMVNQFGWPQFQAHSDFPYTLGYWGNQFPPFWNNAARNWGDVQQAANPV 180
Query: 504 FAGNNQFLGNTQYNVFPPGQMGLPLPTTNIKMDIRDDEQNSVGGQQGMQTPTAGSDVPTA 325
FAGNNQFLGNTQYNVFPPGQMGLPLPTTNIKMDIRDDEQNSVGGQQGMQTPTAGSDVPTA
Sbjct: 181 FAGNNQFLGNTQYNVFPPGQMGLPLPTTNIKMDIRDDEQNSVGGQQGMQTPTAGSDVPTA 240
Query: 324 AQYNVQANFNVARVKFFWLYSSRGDGWWRFDQRCEKDIEDEFLANKPNMEMYLFGKPYIL 145
AQYNVQANFNVARVKFFWLYSSRGDGWWRFDQRCEKDIEDEFLANKPNMEMYLFGKPYIL
Sbjct: 241 AQYNVQANFNVARVKFFWLYSSRGDGWWRFDQRCEKDIEDEFLANKPNMEMYLFGKPYIL 300
Query: 144 DFVAMRQWQKGNLDAWRQIKRVTSSEFDMHNVKGIAGCHVPNVWTVD 4
DFVAMRQWQKGNLDAWRQIKRVTSSEFDMHNVKGIAGCHVPNVWTVD
Sbjct: 301 DFVAMRQWQKGNLDAWRQIKRVTSSEFDMHNVKGIAGCHVPNVWTVD 347
>gi|7495185|pir||T15375 hypothetical protein C02B8.6 - Caenorhabditis
elegans
Length = 347
Score = 671 bits (1731), Expect = 0.0
Identities = 319/347 (91%), Positives = 319/347 (91%)
Frame = -1
Query: 1044 MTDICTICHNTPNRPVRLDCNHEFCYICIKGSIQNDMLNCAVCRRPFDSSIILNLSAQVC 865
MTDICTICHNTPNRPVR D NHEFCYICIKGSIQNDMLNCAVCRRPFDSSIILNLSAQVC
Sbjct: 1 MTDICTICHNTPNRPVRPDGNHEFCYICIKGSIQNDMLNCAVCRRPFDSSIILNLSAQVC 60
Query: 864 LKGDAPRXXXXXXXXXXXXXXXVKPDVNLLRAAMNANQNGNRELVAAAPHMXXXXXXXXX 685
LKGDAPR VKPDVNLLRAAMNANQNGNRELVAAAPHM
Sbjct: 61 LKGDAPRDVDDDEEEVQDEEIDVKPDVNLLRAAMNANQNGNRELVAAAPHMNNNGNFHNA 120
Query: 684 XXNYQVPTTSQGMVNQFGWPQFQAHSDFPYTLGYWGNQFPPFWNNAARNWGDVQQAANPV 505
NYQVPTTSQGMVNQFGWPQFQAHSDFPYTLGYWGNQFPPFWNNAARNWGDVQQAANPV
Sbjct: 121 QGNYQVPTTSQGMVNQFGWPQFQAHSDFPYTLGYWGNQFPPFWNNAARNWGDVQQAANPV 180
Query: 504 FAGNNQFLGNTQYNVFPPGQMGLPLPTTNIKMDIRDDEQNSVGGQQGMQTPTAGSDVPTA 325
FAGNNQFLGNTQYNVFPPGQMGLPLPTTNIKMDIRDDEQNSVGGQQGMQTPTAGSDVPTA
Sbjct: 181 FAGNNQFLGNTQYNVFPPGQMGLPLPTTNIKMDIRDDEQNSVGGQQGMQTPTAGSDVPTA 240
Query: 324 AQYNVQANFNVARVKFFWLYSSRGDGWWRFDQRCEKDIEDEFLANKPNMEMYLFGKPYIL 145
AQYNVQANFNVARVKFFWLYSSRGDGWWRFDQRCEKDIEDEFLANKPNMEMYLFGKPYIL
Sbjct: 241 AQYNVQANFNVARVKFFWLYSSRGDGWWRFDQRCEKDIEDEFLANKPNMEMYLFGKPYIL 300
Query: 144 DFVAMRQWQKGNLDAWRQIKRVTSSEFDMHNVKGIAGCHVPNVWTVD 4
DFVAMRQWQKGNLDAWRQIKRVTSSEFDMHNVKGIAGCHVPNVWTVD
Sbjct: 301 DFVAMRQWQKGNLDAWRQIKRVTSSEFDMHNVKGIAGCHVPNVWTVD 347