Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= B0491_2
(975 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535735|ref|NP_496421.1| SQuaT SQT-1, ROLler: helically twis... 364 2e-99
gi|115410|sp|P12114|CCS1_CAEEL Cuticle collagen sqt-1 >gnl|BL_OR... 362 5e-99
gi|39597300|emb|CAE59528.1| Hypothetical protein CBG02923 [Caeno... 343 3e-93
gi|17535069|ref|NP_496535.1| COLlagen structural gene (col-84) [... 92 2e-17
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno... 88 3e-16
gi|39597161|emb|CAE59388.1| Hypothetical protein CBG02745 [Caeno... 87 4e-16
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col... 87 4e-16
gi|39596974|emb|CAE59201.1| Hypothetical protein CBG02512 [Caeno... 86 1e-15
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 86 1e-15
gi|687634|gb|AAA62504.1| collagen 85 2e-15
gi|39585781|emb|CAE59983.1| Hypothetical protein CBG03475 [Caeno... 84 5e-15
gi|17542824|ref|NP_501756.1| COLlagen structural gene (col-123) ... 82 2e-14
gi|25395729|pir||H88449 protein F54D8.1 [imported] - Caenorhabdi... 77 8e-13
gi|17553572|ref|NP_498086.1| collagen alpha precursor, DumPY : s... 77 8e-13
gi|17535687|ref|NP_495858.1| ROLler: helically twisted, animals ... 76 1e-12
gi|39597491|emb|CAE59721.1| Hypothetical protein CBG03154 [Caeno... 76 1e-12
gi|17538077|ref|NP_495159.1| COLlagen structural gene (col-74) [... 76 1e-12
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 74 7e-12
gi|39583250|emb|CAE60042.1| Hypothetical protein CBG03553 [Caeno... 73 1e-11
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 67 8e-10
gi|17506747|ref|NP_492013.1| COLlagen structural gene (col-60) [... 59 1e-07
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ... 58 3e-07
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 50 4e-07
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 57 5e-07
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 57 5e-07
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno... 55 2e-06
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno... 55 3e-06
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno... 54 4e-06
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 54 5e-06
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ... 53 9e-06
gi|39595378|emb|CAE60416.1| Hypothetical protein CBG04022 [Caeno... 53 1e-05
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ... 53 1e-05
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ... 53 1e-05
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno... 52 2e-05
gi|25385147|pir||A88640 protein C34H4.4 [imported] - Caenorhabdi... 52 2e-05
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 52 2e-05
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ... 52 2e-05
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno... 52 2e-05
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno... 51 3e-05
gi|17569903|ref|NP_508386.1| COLlagen structural gene (38.6 kD) ... 51 3e-05
gi|39597664|emb|CAE68355.1| Hypothetical protein CBG14092 [Caeno... 51 5e-05
gi|17539868|ref|NP_501416.1| predicted CDS, COLlagen structural ... 50 6e-05
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ... 50 8e-05
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 50 8e-05
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno... 50 1e-04
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-... 50 1e-04
gi|7494765|pir||T29837 hypothetical protein B0222.6 - Caenorhabd... 50 1e-04
gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10) [... 50 1e-04
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ... 50 1e-04
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ... 50 1e-04
gi|39593742|emb|CAE62035.1| Hypothetical protein CBG06051 [Caeno... 49 1e-04
gi|39593739|emb|CAE62032.1| Hypothetical protein CBG06046 [Caeno... 49 1e-04
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 49 1e-04
gi|17506643|ref|NP_492948.1| predicted CDS, COLlagen structural ... 49 1e-04
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [... 49 1e-04
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 49 1e-04
gi|39594542|emb|CAE72120.1| Hypothetical protein CBG19216 [Caeno... 49 1e-04
gi|17540820|ref|NP_500070.1| COLlagen structural gene (28.0 kD) ... 49 2e-04
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ... 49 2e-04
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno... 49 2e-04
gi|17540622|ref|NP_502116.1| predicted CDS, COLlagen structural ... 49 2e-04
gi|17540620|ref|NP_502115.1| COLlagen structural gene (col-126) ... 49 2e-04
gi|17557278|ref|NP_505375.1| COLlagen structural gene (28.8 kD) ... 49 2e-04
gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54) [... 48 3e-04
gi|39586155|emb|CAE69231.1| Hypothetical protein CBG15273 [Caeno... 48 3e-04
gi|39582634|emb|CAE73738.1| Hypothetical protein CBG21264 [Caeno... 48 3e-04
gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79) [... 48 3e-04
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur... 48 3e-04
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 48 3e-04
gi|39582788|emb|CAE74251.1| Hypothetical protein CBG21938 [Caeno... 48 3e-04
gi|39594543|emb|CAE72121.1| Hypothetical protein CBG19217 [Caeno... 48 3e-04
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [... 48 3e-04
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|... 48 4e-04
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 48 4e-04
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 48 4e-04
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 48 4e-04
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno... 48 4e-04
gi|17557174|ref|NP_505670.1| COLlagen structural gene (col-151) ... 48 4e-04
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ... 47 5e-04
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 47 5e-04
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C... 47 5e-04
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 47 5e-04
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [... 47 5e-04
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 47 5e-04
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 47 5e-04
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ... 47 5e-04
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita] 47 5e-04
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno... 47 5e-04
gi|39597391|emb|CAE59620.1| Hypothetical protein CBG03029 [Caeno... 47 5e-04
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 47 5e-04
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ... 47 5e-04
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (... 47 5e-04
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 47 5e-04
gi|17570601|ref|NP_509692.1| COLlagen structural gene (28.7 kD) ... 47 5e-04
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 47 7e-04
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [... 47 7e-04
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno... 47 7e-04
gi|28829296|gb|AAO51838.1| similar to hypothetical protein [Schi... 47 7e-04
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ... 47 9e-04
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ... 47 9e-04
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno... 47 9e-04
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her... 46 0.001
gi|39593374|emb|CAE64844.1| Hypothetical protein CBG09640 [Caeno... 46 0.001
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno... 46 0.001
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno... 46 0.001
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 46 0.001
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno... 46 0.001
gi|84432|pir||JS0170 collagen col-19 - Caenorhabditis elegans >g... 46 0.001
gi|39578830|emb|CAE57099.1| Hypothetical protein CBG24999 [Caeno... 46 0.001
gi|39590997|emb|CAE58777.1| Hypothetical protein CBG01972 [Caeno... 46 0.001
gi|32566102|ref|NP_508100.2| COLlagen structural gene (col-19) [... 46 0.001
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >... 46 0.001
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ... 45 0.002
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno... 45 0.002
gi|17536809|ref|NP_494568.1| COLlagen structural gene (col-72) [... 45 0.002
gi|39596361|emb|CAE69999.1| Hypothetical protein CBG16406 [Caeno... 45 0.002
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno... 45 0.002
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno... 45 0.002
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 45 0.002
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [... 45 0.002
gi|39593314|emb|CAE64784.1| Hypothetical protein CBG09577 [Caeno... 45 0.002
gi|17539040|ref|NP_501123.1| COLlagen structural gene (35.6 kD) ... 45 0.002
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno... 45 0.002
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami... 45 0.002
gi|47218636|emb|CAG04965.1| unnamed protein product [Tetraodon n... 45 0.003
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno... 45 0.003
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno... 45 0.003
gi|39581950|emb|CAE73812.1| Hypothetical protein CBG21362 [Caeno... 45 0.003
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno... 44 0.004
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno... 44 0.004
gi|23613570|ref|NP_704591.1| E1-E2_ATPase/hydrolase, putative [P... 44 0.004
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ... 44 0.004
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno... 44 0.004
gi|17506313|ref|NP_491394.1| predicted CDS, COLlagen structural ... 44 0.004
gi|39583705|emb|CAE63809.1| Hypothetical protein CBG08355 [Caeno... 44 0.004
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ... 44 0.004
gi|17550832|ref|NP_509555.1| COLlagen structural gene (28.5 kD) ... 44 0.006
gi|40788379|dbj|BAA74858.2| KIAA0835 protein [Homo sapiens] 44 0.006
gi|17975763|ref|NP_004526.1| myelin transcription factor 1; prot... 44 0.006
gi|39595642|emb|CAE67144.1| Hypothetical protein CBG12567 [Caeno... 44 0.006
gi|39591910|emb|CAE75130.1| Hypothetical protein CBG23058 [Caeno... 44 0.006
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 44 0.006
gi|39587723|emb|CAE58661.1| Hypothetical protein CBG01830 [Caeno... 44 0.006
gi|23479635|gb|EAA16409.1| glutamic acid-rich protein precursor,... 44 0.007
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 44 0.007
gi|32407190|ref|XP_324184.1| hypothetical protein [Neurospora cr... 44 0.007
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 44 0.007
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [... 44 0.007
gi|39593522|emb|CAE61814.1| Hypothetical protein CBG05782 [Caeno... 44 0.007
gi|17550712|ref|NP_510630.1| COLlagen structural gene (col-187) ... 44 0.007
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 44 0.007
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa... 44 0.007
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA... 44 0.007
gi|39587623|emb|CAE58561.1| Hypothetical protein CBG01723 [Caeno... 43 0.009
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 43 0.009
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 43 0.009
gi|7619739|emb|CAB88203.1| putative cuticular collagen [Globoder... 43 0.009
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ... 43 0.009
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi] 43 0.009
gi|17505428|ref|NP_492035.1| COLlagen structural gene (col-61) [... 43 0.009
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno... 43 0.009
gi|39596219|emb|CAE69856.1| Hypothetical protein CBG16184 [Caeno... 43 0.012
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 43 0.012
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 43 0.012
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 43 0.012
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno... 43 0.012
gi|39597193|emb|CAE59420.1| Hypothetical protein CBG02789 [Caeno... 43 0.012
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno... 43 0.012
gi|46437481|gb|EAK96827.1| hypothetical protein CaO19.10377 [Can... 43 0.012
gi|50405879|ref|XP_456580.1| unnamed protein product [Debaryomyc... 43 0.012
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 43 0.012
gi|33285196|gb|AAF99925.2| Collagen protein 111 [Caenorhabditis ... 42 0.016
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ... 42 0.016
gi|13242546|ref|NP_077559.1| EsV-1-74 [Ectocarpus siliculosus vi... 42 0.016
gi|15223730|ref|NP_177804.1| expressed protein [Arabidopsis thal... 42 0.016
gi|17508175|ref|NP_491106.1| COLlagen structural gene (col-49) [... 42 0.016
gi|45767838|gb|AAH67716.1| Unknown (protein for IMAGE:6965582) [... 42 0.016
gi|17540078|ref|NP_500607.1| COLlagen structural gene (col-111) ... 42 0.016
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 42 0.016
gi|39591984|emb|CAE75204.1| Hypothetical protein CBG23151 [Caeno... 42 0.016
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd... 42 0.016
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 42 0.016
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 42 0.016
gi|17569345|ref|NP_510110.1| COLlagen structural gene (col-182) ... 42 0.016
gi|39588000|emb|CAE57231.1| Hypothetical protein CBG00101 [Caeno... 42 0.021
gi|4322670|gb|AAD16120.1| dentin phosphoryn [Homo sapiens] 42 0.021
gi|17534799|ref|NP_493702.1| COLlagen structural gene (col-69) [... 42 0.021
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 42 0.021
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ... 42 0.021
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 42 0.021
gi|1235974|emb|CAA65474.1| collagen [Globodera pallida] 42 0.021
gi|17506297|ref|NP_492086.1| COLlagen structural gene (col-35) [... 42 0.021
gi|15600941|ref|NP_232571.1| conserved hypothetical protein [Vib... 42 0.021
gi|1513204|gb|AAC48703.1| involucrin 42 0.021
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno... 42 0.021
gi|17539090|ref|NP_502514.1| COLlagen structural gene (col-132) ... 42 0.021
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 42 0.028
gi|46437429|gb|EAK96776.1| hypothetical protein CaO19.2859 [Cand... 42 0.028
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno... 42 0.028
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy... 42 0.028
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat... 42 0.028
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C... 42 0.028
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 42 0.028
gi|21309836|gb|AAM19760.1| glutamic acid-rich protein cNBL1700 [... 42 0.028
gi|115404|sp|P18833|CC08_CAEEL Cuticle collagen 8 precursor >gnl... 42 0.028
gi|17559812|ref|NP_505793.1| COLlagen structural gene (35.1 kD) ... 42 0.028
gi|28830026|gb|AAO52516.1| similar to Kaposi's sarcoma-associate... 42 0.028
gi|39582464|emb|CAE66555.1| Hypothetical protein CBG11867 [Caeno... 42 0.028
gi|20178621|gb|AAL50184.1| collagen-like protein 2 [Streptococcu... 41 0.036
gi|436268|gb|AAC60712.1| LAP16 [Saccharomyces cerevisiae] 41 0.036
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 41 0.036
gi|37619788|emb|CAA86755.2| Hypothetical protein C09G5.6 [Caenor... 41 0.036
gi|28829482|gb|AAL92370.2| similar to Dictyostelium discoideum (... 41 0.036
gi|17531393|ref|NP_496311.1| nematode cuticle collagen, BLIstere... 41 0.036
gi|39595517|emb|CAE60555.1| Hypothetical protein CBG04182 [Caeno... 41 0.036
gi|49077026|ref|XP_402424.1| hypothetical protein UM04809.1 [Ust... 41 0.036
gi|39593313|emb|CAE64783.1| Hypothetical protein CBG09576 [Caeno... 41 0.036
gi|17557218|ref|NP_505646.1| COLlagen structural gene (30.6 kD) ... 41 0.036
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ... 41 0.036
gi|15021422|gb|AAK77699.1| ORF30, putative collagen [shrimp whit... 41 0.036
gi|17158634|ref|NP_477523.1| wsv001 [shrimp white spot syndrome ... 41 0.036
gi|39586931|emb|CAE62866.1| Hypothetical protein CBG07049 [Caeno... 41 0.036
gi|27924402|gb|AAH44962.1| LOC397739 protein [Xenopus laevis] 41 0.047
gi|214044|gb|AAA49679.1| alpha-1 type II' collagen 41 0.047
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo... 41 0.047
gi|13235588|emb|CAC33777.1| SclB protein [Streptococcus pyogenes] 41 0.047
gi|1222642|emb|CAA63070.1| collagen [Brugia pahangi] 41 0.047
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto... 41 0.047
gi|17557220|ref|NP_505647.1| COLlagen structural gene (col-150) ... 41 0.047
gi|85719|pir||A40333 collagen alpha 1'(II) chain precursor - Afr... 41 0.047
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p... 41 0.047
gi|13560500|gb|AAK30078.1| collagen-like protein B [Streptococcu... 41 0.047
gi|14164561|gb|AAK55123.1| Swift [Xenopus laevis] 41 0.047
gi|34859306|ref|XP_341933.1| similar to Snf2-related CBP activat... 41 0.047
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ... 40 0.061
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 40 0.061
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 40 0.061
gi|18202034|sp|O42350|CA21_RANCA Collagen alpha 2(I) chain precu... 40 0.061
gi|29179577|gb|AAH49287.1| Col1a2-prov protein [Xenopus laevis] 40 0.080
gi|45383309|ref|NP_989757.1| alpha 1 type IIA collagen precursor... 40 0.080
gi|11096153|gb|AAG30216.1| collagen-like surface protein [Strept... 40 0.080
gi|39585299|emb|CAE61621.1| Hypothetical protein CBG05547 [Caeno... 40 0.080
gi|31340542|gb|AAO33039.2| alpha 1 type II procollagen [Gallus g... 40 0.080
gi|17551340|ref|NP_509274.1| DumPY : shorter than wild-type DPY-... 40 0.080
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno... 40 0.10
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno... 40 0.10
gi|23491066|gb|EAA22695.1| hypothetical protein [Plasmodium yoel... 40 0.10
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 40 0.10
gi|46114916|ref|XP_383476.1| hypothetical protein FG03300.1 [Gib... 40 0.10
gi|17539078|ref|NP_502507.1| COLlagen structural gene (col-131) ... 40 0.10
gi|24213723|ref|NP_711204.1| conserved hypothetical protein [Lep... 40 0.10
gi|467292|gb|AAA17387.1| glutamine-asparagine rich protein 40 0.10
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 40 0.10
gi|50554801|ref|XP_504809.1| hypothetical protein [Yarrowia lipo... 40 0.10
gi|23612884|ref|NP_704423.1| hypothetical protein [Plasmodium fa... 40 0.10
gi|34525764|gb|AAQ73928.1| erythrocyte membrane protein 1 [Plasm... 39 0.14
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 39 0.14
gi|17507511|ref|NP_492619.1| COLlagen structural gene (col-64) [... 39 0.14
gi|23509044|ref|NP_701712.1| hypothetical protein [Plasmodium fa... 39 0.14
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [... 39 0.14
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ... 39 0.14
gi|17542298|ref|NP_501532.1| COLlagen structural gene (col-118) ... 39 0.14
gi|9453886|dbj|BAB03287.1| pro-alpha 1 type V/XI collagen [Pagru... 39 0.14
gi|39597872|emb|CAE68564.1| Hypothetical protein CBG14399 [Caeno... 39 0.14
gi|23612220|ref|NP_703800.1| myosin-like protein, putative [Plas... 39 0.14
gi|50417567|gb|AAH77588.1| K14 protein [Xenopus laevis] 39 0.14
gi|13235596|emb|CAC33780.1| SclB protein [Streptococcus pyogenes] 39 0.14
gi|13560506|gb|AAK30079.1| collagen-like protein B [Streptococcu... 39 0.14
gi|50731940|ref|XP_418425.1| PREDICTED: similar to collagen, typ... 39 0.14
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 39 0.14
gi|1513206|gb|AAC48704.1| involucrin 39 0.18
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ... 39 0.18
gi|18640526|ref|NP_570367.1| collagen alpha 1(I) chain precursor... 39 0.18
gi|42562838|ref|NP_176263.2| expressed protein [Arabidopsis thal... 39 0.18
gi|15777923|dbj|BAB68504.1| adipocyte-specific protein 6 [Mus mu... 39 0.18
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 39 0.18
gi|3645944|gb|AAC60380.1| yotiao [Homo sapiens] 39 0.18
gi|22538387|ref|NP_005742.4| A-kinase anchor protein 9 isoform 2... 39 0.18
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno... 39 0.18
gi|50751732|ref|XP_422531.1| PREDICTED: similar to mesoderm indu... 39 0.18
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno... 39 0.18
gi|22538389|ref|NP_671695.1| A-kinase anchor protein 9 isoform 4... 39 0.18
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno... 39 0.18
gi|4584423|emb|CAB40713.1| AKAP450 protein [Homo sapiens] 39 0.18
gi|11036632|ref|NP_055023.1| dentin sialophosphoprotein prepropr... 39 0.18
gi|22538391|ref|NP_671700.1| A-kinase anchor protein 9 isoform 1... 39 0.18
gi|22538393|ref|NP_671714.1| A-kinase anchor protein 9 isoform 3... 39 0.18
gi|5051743|dbj|BAA78718.1| Centrosome- and Golgi-localized PKN-a... 39 0.18
gi|45361285|ref|NP_989220.1| hypothetical protein MGC75588 [Xeno... 39 0.18
gi|7513208|pir||T08880 NMDA receptor-binding protein yotiao - hu... 39 0.18
gi|50405081|ref|YP_054173.1| hypothetical protein with coiled-co... 39 0.18
gi|8393173|ref|NP_058615.1| procollagen, type V, alpha 3; Pro-al... 39 0.18
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno... 39 0.18
gi|19923672|ref|NP_036922.2| dentin sailophosphoprotein; Dentin ... 39 0.18
gi|13540523|ref|NP_110390.1| nucleosomal binding protein 1 [Homo... 39 0.18
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 39 0.18
gi|39594122|emb|CAE70232.1| Hypothetical protein CBG16719 [Caeno... 39 0.18
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab... 39 0.18
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 39 0.18
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [... 39 0.23
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 39 0.23
gi|18780273|ref|NP_110447.2| alpha 1 type XXI collagen precursor... 39 0.23
gi|10801049|dbj|BAB16607.1| collagen type IV alpha-2 [Sarcophaga... 39 0.23
gi|12052774|emb|CAB66559.1| hypothetical protein [Homo sapiens] 39 0.23
gi|17974510|gb|AAL50033.1| alpha 1 chain-like collagen COLA1L pr... 39 0.23
gi|23510135|ref|NP_702801.1| hypothetical protein [Plasmodium fa... 39 0.23
gi|42781416|ref|NP_978663.1| collagen triple helix repeat domain... 39 0.23
gi|49069208|ref|XP_398893.1| hypothetical protein UM01278.1 [Ust... 39 0.23
gi|17506859|ref|NP_491822.1| predicted CDS, COLlagen structural ... 39 0.23
gi|13358439|ref|NP_078660.1| Collagen-like protein [Lymphocystis... 39 0.23
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 39 0.23
gi|4519617|dbj|BAA75668.1| collagen pro alpha-chain [Haliotis di... 39 0.23
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 39 0.23
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p... 39 0.23
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet... 39 0.23
gi|49477241|ref|YP_035673.1| collagen-like protein [Bacillus thu... 39 0.23
gi|38173761|gb|AAH60753.1| MGC69046 protein [Xenopus laevis] 39 0.23
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 39 0.23
gi|39595798|emb|CAE67301.1| Hypothetical protein CBG12754 [Caeno... 38 0.30
gi|26351037|dbj|BAC39155.1| unnamed protein product [Mus musculus] 38 0.30
gi|28172191|emb|CAD62259.1| bM340H1.1 (novel collagen triple hel... 38 0.30
gi|49022813|dbj|BAC41451.2| mKIAA0835 protein [Mus musculus] 38 0.30
gi|28828532|gb|AAO51140.1| similar to Homo sapiens (Human). FLJ0... 38 0.30
gi|46439924|gb|EAK99236.1| hypothetical protein CaO19.3345 [Cand... 38 0.30
gi|50511151|dbj|BAD32561.1| mKIAA1870 protein [Mus musculus] 38 0.30
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 38 0.30
gi|3334657|emb|CAA05172.1| hormone receptor 38 [Drosophila melan... 38 0.30
gi|49075734|ref|XP_401913.1| hypothetical protein UM04298.1 [Ust... 38 0.30
gi|12644294|sp|P49869|HR38_DROME Probable nuclear hormone recept... 38 0.30
gi|13235601|emb|CAC33781.1| SclB protein [Streptococcus pyogenes] 38 0.30
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 38 0.30
gi|47217757|emb|CAG05979.1| unnamed protein product [Tetraodon n... 38 0.30
gi|38454234|ref|NP_942042.1| collagen, type XXVII, alpha 1; coll... 38 0.30
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e... 38 0.30
gi|50545103|ref|XP_500089.1| hypothetical protein [Yarrowia lipo... 38 0.30
gi|23346429|ref|NP_032691.2| myelin transcription factor 1; neur... 38 0.30
gi|11360369|pir||T42712 myelin transcription factor 1 - mouse >g... 38 0.30
gi|17137128|ref|NP_477119.1| CG1864-PB [Drosophila melanogaster]... 38 0.30
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 38 0.30
gi|39580106|emb|CAE56125.1| Hypothetical protein CBG23734 [Caeno... 38 0.30
gi|41352097|gb|AAS00715.1| serine-aspartate repeat family protei... 38 0.30
gi|50289215|ref|XP_447038.1| unnamed protein product [Candida gl... 38 0.30
gi|47551001|ref|NP_999674.1| alpha-1 collagen [Strongylocentrotu... 38 0.30
gi|37202117|ref|NP_079961.2| procollagen, type XXVII, alpha 1 [M... 38 0.30
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno... 38 0.30
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ... 38 0.30
gi|39594909|emb|CAE70777.1| Hypothetical protein CBG17531 [Caeno... 38 0.30
gi|32822777|gb|AAH55077.1| Procollagen, type V, alpha 2 [Mus mus... 38 0.30
gi|47214275|emb|CAG01332.1| unnamed protein product [Tetraodon n... 38 0.30
gi|50307259|ref|XP_453608.1| unnamed protein product [Kluyveromy... 38 0.40
gi|2388676|gb|AAB80719.1| precollagen P [Mytilus edulis] 38 0.40
gi|49186559|ref|YP_029811.1| conserved hypothetical protein [Bac... 38 0.40
gi|30354436|gb|AAH52161.1| Procollagen, type XI, alpha 1 [Mus mu... 38 0.40
gi|6680958|ref|NP_031755.1| procollagen, type XI, alpha 1; pro-a... 38 0.40
gi|11120710|ref|NP_068528.1| collagen, type V, alpha 3; procolla... 38 0.40
gi|17557828|ref|NP_505635.1| COLlagen structural gene (col-148) ... 38 0.40
gi|6165882|gb|AAF04725.1| collagen type XI alpha-1 isoform A [Ho... 38 0.40
gi|18375518|ref|NP_001845.2| alpha 1 type XI collagen isoform A ... 38 0.40
gi|21542396|sp|P12107|CA1B_HUMAN Collagen alpha 1(XI) chain prec... 38 0.40
gi|1360670|pir||CGHU1E collagen alpha 1(XI) chain precursor - hu... 38 0.40
gi|50420779|ref|XP_458929.1| unnamed protein product [Debaryomyc... 38 0.40
gi|34859865|ref|XP_342326.1| similar to type XI collagen alpha-1... 38 0.40
gi|50303115|ref|XP_451495.1| unnamed protein product [Kluyveromy... 38 0.40
gi|21711663|gb|AAM75022.1| GH26723p [Drosophila melanogaster] 38 0.40
gi|6165883|gb|AAF04726.1| collagen type XI alpha-a isoform B [Ho... 38 0.40
gi|18375520|ref|NP_542196.1| alpha 1 type XI collagen isoform B ... 38 0.40
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 38 0.40
gi|39597388|emb|CAE59617.1| Hypothetical protein CBG03026 [Caeno... 38 0.40
gi|11875612|gb|AAG40729.1| type IV collagen alpha 1 chain precur... 38 0.40
gi|11096151|gb|AAG30215.1| collagen-like surface protein [Strept... 38 0.40
gi|39591412|emb|CAE73466.1| Hypothetical protein CBG20917 [Caeno... 38 0.40
gi|6165881|gb|AAF04724.1| collagen type XI alpha-1 [Homo sapiens] 38 0.40
gi|17508597|ref|NP_492170.1| AdaPTin or adaptin-related protein ... 38 0.40
gi|18375522|ref|NP_542197.1| alpha 1 type XI collagen isoform C ... 38 0.40
gi|4502959|ref|NP_000384.1| alpha 2 type V collagen preproprotei... 38 0.40
gi|30263715|ref|NP_846092.1| conserved hypothetical protein [Bac... 38 0.40
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 38 0.40
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha... 38 0.40
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 38 0.40
gi|24585253|ref|NP_609977.1| CG10188-PB [Drosophila melanogaster... 38 0.40
gi|16197600|gb|AAL13166.1| type V preprocollagen alpha 2 chain [... 38 0.40
gi|37498970|gb|AAQ91576.1| collagen-like protein 3 [Streptococcu... 38 0.40
gi|45433317|emb|CAD27462.1| nucleosome assembly protein 1-like p... 38 0.40
gi|42561024|ref|NP_975475.1| Cell division protein FtsY [Mycopla... 38 0.40
gi|34875814|ref|XP_343565.1| collagen, type V, alpha 2 [Rattus n... 38 0.40
gi|159960|gb|AAA29439.1| collagen-like protein 38 0.40
gi|103623|pir||A32249 collagen - sea urchin (Paracentrotus livid... 38 0.40
gi|46229766|gb|EAK90584.1| protein with 2 bromo domains [Cryptos... 38 0.40
gi|17508599|ref|NP_492171.1| AdaPTin or adaptin-related protein ... 38 0.40
gi|179698|gb|AAA51859.1| collagen type V alpha-2 precursor 38 0.40
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 38 0.40
gi|21401689|ref|NP_657674.1| hypothetical protein predicted by G... 38 0.40
gi|50750041|ref|XP_421846.1| PREDICTED: similar to procollagen t... 38 0.40
gi|46440293|gb|EAK99601.1| hypothetical protein CaO19.2504 [Cand... 37 0.52
gi|7656989|ref|NP_056534.1| collagen, type V, alpha 3 preproprot... 37 0.52
gi|31231815|ref|XP_318597.1| ENSANGP00000020852 [Anopheles gambi... 37 0.52
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ... 37 0.52
gi|47228961|emb|CAG09476.1| unnamed protein product [Tetraodon n... 37 0.52
gi|23613480|ref|NP_703324.1| glutamic acid-rich protein (garp) [... 37 0.52
gi|537329|gb|AAA52043.1| alpha-2 type IV collagen 37 0.52
gi|25411565|pir||B84517 hypothetical protein At2g14430 [imported... 37 0.52
gi|17568307|ref|NP_509837.1| COLlagen structural gene (col-177) ... 37 0.52
gi|47847440|dbj|BAD21392.1| mFLJ00158 protein [Mus musculus] 37 0.52
gi|47228931|emb|CAG09446.1| unnamed protein product [Tetraodon n... 37 0.52
gi|103624|pir||A35763 collagen alpha 2 chain - sea urchin (Parac... 37 0.52
gi|85169|pir||S02708 troponin T - fruit fly (Drosophila melanoga... 37 0.52
gi|15828750|ref|NP_326110.1| conserved hypothetical protein [Myc... 37 0.52
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 37 0.52
gi|31231753|ref|XP_318588.1| ENSANGP00000021001 [Anopheles gambi... 37 0.52
gi|23479216|gb|EAA16104.1| hypothetical protein [Plasmodium yoel... 37 0.52
gi|17508941|ref|NP_491800.1| COLlagen structural gene (col-56) [... 37 0.52
gi|29551|emb|CAA29098.1| alpha (2) chain [Homo sapiens] 37 0.52
gi|630905|pir||S42731 collagen alpha 1 chain - sea urchin (Hemic... 37 0.52
gi|13325096|gb|AAB30065.2| fibrillar collagen alpha 120 and 140 ... 37 0.52
gi|627310|pir||B34493 collagen alpha 1(IX) chain long form precu... 37 0.52
gi|23466431|ref|ZP_00122019.1| COG5295: Autotransporter adhesin ... 37 0.52
gi|50744818|ref|XP_419889.1| PREDICTED: similar to alpha(IX) col... 37 0.52
gi|31207045|ref|XP_312489.1| ENSANGP00000021340 [Anopheles gambi... 37 0.52
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno... 37 0.52
gi|39587564|emb|CAE58502.1| Hypothetical protein CBG01652 [Caeno... 37 0.52
gi|115349|sp|P08572|CA24_HUMAN Collagen alpha 2(IV) chain precur... 37 0.52
gi|31195073|ref|XP_306484.1| ENSANGP00000014653 [Anopheles gambi... 37 0.52
gi|17986277|ref|NP_001837.1| alpha 2 type IV collagen preproprot... 37 0.52
gi|34866787|ref|XP_243609.2| similar to alpha 1 type XXII collag... 37 0.52
gi|50754535|ref|XP_425157.1| PREDICTED: similar to type VII coll... 37 0.52
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 37 0.52
gi|12018306|ref|NP_072143.1| nucleolin-related protein [Rattus n... 37 0.52
gi|136401|sp|P19351|TRT_DROME Troponin T, skeletal muscle (Uphel... 37 0.52
gi|47565679|ref|ZP_00236719.1| PE_PGRS family protein [Bacillus ... 37 0.52
gi|103432|pir||S13251 troponin T - fruit fly (Drosophila melanog... 37 0.52
gi|19584340|emb|CAD28466.1| hypothetical protein [Homo sapiens] 37 0.52
gi|33303460|gb|AAQ02306.1| dentin matrix protein 1 [Sigmodon his... 37 0.52
gi|7949133|ref|NP_037010.1| surfactant associated protein D; Pul... 37 0.52
gi|47682816|gb|AAH70507.1| Surfactant associated protein D [Ratt... 37 0.52
gi|6680970|ref|NP_031763.1| procollagen, type V, alpha 2 [Mus mu... 37 0.52
gi|211499|gb|AAA48675.1| HMW/LMW collagen subunit precursor 37 0.52
gi|50290483|ref|XP_447673.1| unnamed protein product [Candida gl... 37 0.68
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno... 37 0.68
gi|15903446|ref|NP_358996.1| Hypothetical protein [Streptococcus... 37 0.68
gi|26335321|dbj|BAC31361.1| unnamed protein product [Mus musculus] 37 0.68
gi|21901969|dbj|BAC05523.1| collectin placenta 1 [Mus musculus] ... 37 0.68
gi|18485494|ref|NP_569716.1| collectin sub-family member 12 [Mus... 37 0.68
gi|47229883|emb|CAG07079.1| unnamed protein product [Tetraodon n... 37 0.68
gi|49109243|ref|XP_411663.1| hypothetical protein AN7526.2 [Aspe... 37 0.68
gi|48696432|ref|YP_024473.1| ORF43 [Staphylococcus phage K] >gnl... 37 0.68
gi|15077111|gb|AAK83075.1| collagen [Meloidogyne javanica] 37 0.68
gi|46228734|gb|EAK89604.1| hypothetical protein, transcripts ide... 37 0.68
gi|13235584|emb|CAC33775.1| SclB protein [Streptococcus pyogenes] 37 0.68
gi|38107659|gb|EAA53803.1| hypothetical protein MG09553.4 [Magna... 37 0.68
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ... 37 0.68
gi|543516|pir||A48295 collagen 1 - marine sponge (Microciona pro... 37 0.68
gi|26000358|gb|AAN75475.1| dentin matrix protein 1 [Myzopoda aur... 37 0.68
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi... 37 0.68
gi|17534889|ref|NP_495294.1| COLlagen structural gene (col-75) [... 37 0.68
gi|39593552|emb|CAE61844.1| Hypothetical protein CBG05818 [Caeno... 37 0.68
gi|50424343|ref|XP_460758.1| unnamed protein product [Debaryomyc... 37 0.68
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 37 0.68
gi|17507951|ref|NP_491958.1| COLlagen structural gene (col-59) [... 37 0.68
gi|23508380|ref|NP_701049.1| hypothetical protein [Plasmodium fa... 37 0.68
gi|49094848|ref|XP_408885.1| hypothetical protein AN4748.2 [Aspe... 37 0.68
gi|26327181|dbj|BAC27334.1| unnamed protein product [Mus musculus] 37 0.68
gi|538245|dbj|BAA03980.1| secreted phosphoprotein-1 precursor [O... 37 0.68
gi|34877879|ref|XP_341575.1| similar to collectin placenta 1 [Ra... 37 0.68
gi|48097882|ref|XP_393913.1| similar to ENSANGP00000017516 [Apis... 37 0.68
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ... 37 0.68
gi|37498977|gb|AAQ91579.1| collagen-like protein 3 [Streptococcu... 37 0.89
gi|7507809|pir||T16872 hypothetical protein T14A8.1 - Caenorhabd... 37 0.89
gi|18309937|ref|NP_561871.1| collagen-like protein [Clostridium ... 37 0.89
gi|11386161|ref|NP_001843.1| alpha 2 type IX collagen; collagen ... 37 0.89
gi|49068056|ref|XP_398317.1| hypothetical protein UM00702.1 [Ust... 37 0.89
gi|28895851|ref|NP_802201.1| SclB protein [Streptococcus pyogene... 37 0.89
gi|46227005|gb|EAK87955.1| membrane associated thioredoxin [Cryp... 37 0.89
gi|18641360|ref|NP_569057.1| collectin sub-family member 12 isof... 37 0.89
gi|25392184|pir||JC7595 scavenger receptor with C-type lectin ty... 37 0.89
gi|29466645|dbj|BAC66788.1| collagen like protein ClgA [Streptoc... 37 0.89
gi|38174510|gb|AAH60789.1| Collectin sub-family member 12, isofo... 37 0.89
gi|446631|prf||1912189A collagen:SUBUNIT=alpha2:ISOTYPE=IX 37 0.89
gi|47937947|gb|AAH71418.1| Unknown (protein for IMAGE:6898978) [... 37 0.89
gi|420027|pir||S32436 collagen alpha 2(IX) chain - human (fragment) 37 0.89
gi|4519619|dbj|BAA75669.1| collagen pro alpha-chain [Haliotis di... 37 0.89
gi|42528111|ref|NP_973209.1| conserved hypothetical protein [Tre... 37 0.89
gi|7485840|pir||T04249 hypothetical protein F20B18.50 - Arabidop... 37 0.89
gi|530998|gb|AAB04165.1| proline rotamase 37 0.89
gi|13365553|dbj|BAB39148.1| scavenger receptor with C-type lecti... 37 0.89
gi|18641358|ref|NP_110408.2| collectin sub-family member 12 isof... 37 0.89
gi|46309585|ref|NP_908998.1| retrotransposon-like 1 [Mus musculu... 37 0.89
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 37 0.89
gi|17551704|ref|NP_508747.1| COLlagen structural gene (33.9 kD) ... 37 0.89
gi|22328940|ref|NP_194324.2| epsin N-terminal homology (ENTH) do... 37 0.89
gi|11096143|gb|AAG30211.1| collagen-like surface protein [Strept... 37 0.89
gi|21910274|ref|NP_664542.1| collagen-like protein SclB [Strepto... 37 0.89
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 37 0.89
gi|47229954|emb|CAG10368.1| unnamed protein product [Tetraodon n... 37 0.89
gi|27502806|gb|AAH42428.1| COL23A1 protein [Homo sapiens] 37 0.89
gi|13560496|gb|AAK30077.1| collagen-like protein B [Streptococcu... 37 0.89
gi|50286567|ref|XP_445712.1| unnamed protein product [Candida gl... 37 0.89
gi|23613548|ref|NP_704569.1| hypothetical protein [Plasmodium fa... 37 0.89
gi|23508027|ref|NP_700697.1| dynein heavy chain, putative [Plasm... 37 0.89
gi|31239123|ref|XP_319975.1| ENSANGP00000016783 [Anopheles gambi... 37 0.89
gi|47212298|emb|CAF90561.1| unnamed protein product [Tetraodon n... 37 0.89
>gi|17535735|ref|NP_496421.1| SQuaT SQT-1, ROLler: helically
twisted, animals roll when moving ROL-5, cuticle
collagen sqt-1 family member (32.9 kD) (sqt-1)
[Caenorhabditis elegans]
gi|7494963|pir||T18763 hypothetical protein B0491.2 -
Caenorhabditis elegans
gi|3873801|emb|CAA90084.1| Hypothetical protein B0491.2
[Caenorhabditis elegans]
Length = 324
Score = 364 bits (934), Expect = 2e-99
Identities = 204/324 (62%), Positives = 204/324 (62%)
Frame = -1
Query: 975 MSVKLACYVTASVTVATLMVCFMTMSTIYSEVDGFREKLDTEMNVFRQSTNGLWKDIVVI 796
MSVKLACYVTASVTVATLMVCFMTMSTIYSEVDGFREKLDTEMNVFRQSTNGLWKDIVVI
Sbjct: 1 MSVKLACYVTASVTVATLMVCFMTMSTIYSEVDGFREKLDTEMNVFRQSTNGLWKDIVVI 60
Query: 795 GRSSKRVRRQYEETNATPTPHADXXXXXXXXXXXXXXXVFNQPKTPNGANGNGPTCNCNA 616
GRSSKRVRRQYEETNATPTPHAD VFNQPKTPNGANGNGPTCNCNA
Sbjct: 61 GRSSKRVRRQYEETNATPTPHADGSPSAPPGQPPAVPPVFNQPKTPNGANGNGPTCNCNA 120
Query: 615 DNKCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIAPQRESVGCFTCPQXXXXXXXXX 436
DNKC DIAPQRESVGCFTCPQ
Sbjct: 121 DNKCPAGPSGPKGVPGVPGLDGVPGLDGVPGVGADDIAPQRESVGCFTCPQGPVGPPGAL 180
Query: 435 XXXXXXXXXXXXXXXXXXXXXXXXGHPGEQGSSGQXXXXXXXXXXXXXGRDAEHXXXXXX 256
GHPGEQGSSGQ GRDAEH
Sbjct: 181 GRPGPRGLPGPRGQNGNPGRDGQPGHPGEQGSSGQIGKIGEPGPPGEKGRDAEHPIGRPG 240
Query: 255 XXXXXXXXXPTGPAGQNGLHXXXXXXXXXXXXXPSGKQGRQGPDGTQGETGPDGRPGKDA 76
PTGPAGQNGLH PSGKQGRQGPDGTQGETGPDGRPGKDA
Sbjct: 241 PKGPRGDQGPTGPAGQNGLHGPPGEPGTVGPEGPSGKQGRQGPDGTQGETGPDGRPGKDA 300
Query: 75 EYCQCPDKSPPSEAVNANRGYRNI 4
EYCQCPDKSPPSEAVNANRGYRNI
Sbjct: 301 EYCQCPDKSPPSEAVNANRGYRNI 324