Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= B0035_8
(612 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17538214|ref|NP_502127.1| putative cytoplasmic protein of anc... 410 e-114
gi|39593759|emb|CAE62052.1| Hypothetical protein CBG06070 [Caeno... 343 1e-93
gi|37748708|gb|AAH60026.1| MGC68697 protein [Xenopus laevis] 168 6e-41
gi|41054553|ref|NP_956843.1| hypothetical protein MGC65960 [Dani... 166 3e-40
gi|19527384|ref|NP_598908.1| RIKEN cDNA D930010J01 [Mus musculus... 162 5e-39
gi|32129718|sp|Q922B1|LR16_MOUSE Protein LRP16 162 5e-39
gi|21326475|ref|NP_647553.1| LRP16 protein [Rattus norvegicus] >... 160 1e-38
gi|32129697|sp|Q8K4G6|LR16_RAT Protein LRP16 160 1e-38
gi|48094483|ref|XP_392131.1| similar to MGC68697 protein [Apis m... 160 2e-38
gi|13112029|gb|AAH03188.1| LRP16 protein [Homo sapiens] 154 1e-36
gi|13569840|ref|NP_054786.2| LRP16 protein [Homo sapiens] >gnl|B... 154 1e-36
gi|45914482|ref|ZP_00192908.2| COG2110: Predicted phosphatase ho... 153 3e-36
gi|50255060|gb|EAL17799.1| hypothetical protein CNBL0610 [Crypto... 152 6e-36
gi|34541402|ref|NP_905881.1| conserved hypothetical protein [Por... 149 5e-35
gi|41720091|ref|ZP_00148930.1| COG2110: Predicted phosphatase ho... 148 7e-35
gi|48859455|ref|ZP_00313389.1| COG2110: Predicted phosphatase ho... 147 1e-34
gi|32416306|ref|XP_328631.1| hypothetical protein [Neurospora cr... 147 2e-34
gi|13476415|ref|NP_107985.1| hypothetical protein mll7730 [Mesor... 144 1e-33
gi|21226279|ref|NP_632201.1| conserved protein [Methanosarcina m... 144 1e-33
gi|38104874|gb|EAA51377.1| hypothetical protein MG09394.4 [Magna... 144 2e-33
gi|49080196|ref|XP_403648.1| hypothetical protein UM06033.1 [Ust... 143 2e-33
gi|39995633|ref|NP_951584.1| conserved hypothetical protein [Geo... 142 6e-33
gi|46116674|ref|XP_384355.1| hypothetical protein FG04179.1 [Gib... 140 1e-32
gi|42525750|ref|NP_970848.1| appr-1-p processing enzyme domain p... 140 2e-32
gi|42519805|ref|NP_965735.1| hypothetical protein LJ0520 [Lactob... 140 2e-32
gi|48840767|ref|ZP_00297693.1| COG2110: Predicted phosphatase ho... 139 4e-32
gi|46164388|ref|ZP_00205062.1| COG2110: Predicted phosphatase ho... 137 1e-31
gi|15598889|ref|NP_252383.1| conserved hypothetical protein [Pse... 137 2e-31
gi|21675028|ref|NP_663093.1| histone macro-H2A1-related protein ... 137 2e-31
gi|20090472|ref|NP_616547.1| conserved hypothetical protein [Met... 136 4e-31
gi|49091658|ref|XP_407290.1| hypothetical protein AN3153.2 [Aspe... 135 8e-31
gi|48844901|ref|ZP_00299195.1| COG2110: Predicted phosphatase ho... 134 1e-30
gi|28211077|ref|NP_782021.1| conserved protein [Clostridium teta... 131 9e-30
gi|24216832|ref|NP_714313.1| Appr-1''-p processing enzyme family... 128 1e-28
gi|23105124|ref|ZP_00091582.1| COG2110: Predicted phosphatase ho... 128 1e-28
gi|45659116|ref|YP_003202.1| conserved hypothetical protein [Lep... 126 3e-28
gi|48786447|ref|ZP_00282581.1| COG2110: Predicted phosphatase ho... 124 1e-27
gi|33150826|gb|AAP97291.1| LRP16-like protein [Rattus norvegicus] 123 3e-27
gi|19705253|ref|NP_602748.1| ATPase associated with chromosome a... 122 4e-27
gi|46320773|ref|ZP_00221157.1| COG2110: Predicted phosphatase ho... 122 5e-27
gi|16764503|ref|NP_460118.1| putative polyprotein [Salmonella ty... 121 9e-27
gi|34499018|ref|NP_903233.1| conserved hypothetical protein [Chr... 121 9e-27
gi|16760024|ref|NP_455641.1| conserved hypothetical protein [Sal... 121 9e-27
gi|27380821|ref|NP_772350.1| bll5710 [Bradyrhizobium japonicum U... 120 2e-26
gi|48856784|ref|ZP_00310941.1| COG2110: Predicted phosphatase ho... 120 2e-26
gi|17545053|ref|NP_518455.1| CONSERVED HYPOTHETICAL PROTEIN [Ral... 120 3e-26
gi|34762140|ref|ZP_00143148.1| ATPase associated with chromosome... 119 6e-26
gi|50841892|ref|YP_055119.1| conserved protein [Propionibacteriu... 119 6e-26
gi|47169184|pdb|1SPV|A Chain A, Crystal Structure Of The Putativ... 118 1e-25
gi|15801162|ref|NP_287179.1| putative polyprotein [Escherichia c... 117 1e-25
gi|46315317|ref|ZP_00215900.1| COG2110: Predicted phosphatase ho... 117 1e-25
gi|39934677|ref|NP_946953.1| Appr-1''-p processing enzyme family... 117 2e-25
gi|20807475|ref|NP_622646.1| conserved hypothetical protein [The... 116 3e-25
gi|48833340|ref|ZP_00290360.1| COG2110: Predicted phosphatase ho... 116 3e-25
gi|46140638|ref|ZP_00203689.1| COG2110: Predicted phosphatase ho... 116 3e-25
gi|28379740|ref|NP_786632.1| unknown [Lactobacillus plantarum WC... 116 3e-25
gi|21282031|ref|NP_645119.1| conserved hypothetical protein [Sta... 116 4e-25
gi|21244068|ref|NP_643650.1| conserved hypothetical protein [Xan... 115 5e-25
gi|25453353|sp|Q8PHB6|YX43_XANAC Hypothetical UPF0189 protein XA... 115 5e-25
gi|21232613|ref|NP_638530.1| conserved hypothetical protein [Xan... 115 5e-25
gi|49482557|ref|YP_039781.1| conserved hypothetical protein [Sta... 115 5e-25
gi|24112446|ref|NP_706956.1| putative polyprotein [Shigella flex... 115 6e-25
gi|47095567|ref|ZP_00233175.1| Appr-1-p processing enzyme family... 114 1e-24
gi|16804796|ref|NP_466281.1| similar to unknown protein [Listeri... 114 1e-24
gi|19881427|ref|NP_612244.1| ORF022L [infectious spleen and kidn... 114 2e-24
gi|46436407|gb|EAK95770.1| hypothetical protein CaO19.9825 [Cand... 114 2e-24
gi|46908947|ref|YP_015336.1| Appr-1-p processing enzyme family [... 113 2e-24
gi|20178154|sp|Q93RG0|Y189_TREMD Hypothetical UPF0189 protein in... 113 2e-24
gi|20178198|sp|Q44020|YGB2_ALCEU Hypothetical UPF0189 protein in... 113 2e-24
gi|33324322|gb|AAQ07955.1| unknown [Red sea bream iridovirus] 112 4e-24
gi|23099743|ref|NP_693209.1| hypothetical protein OB2288 [Oceano... 112 5e-24
gi|16801961|ref|NP_472229.1| similar to unknown protein [Listeri... 112 7e-24
gi|15923315|ref|NP_370849.1| conserved hypothetical protein [Sta... 112 7e-24
gi|48772638|ref|ZP_00276980.1| COG2110: Predicted phosphatase ho... 112 7e-24
gi|23397339|gb|AAK93649.2| unknown protein [Arabidopsis thaliana] 110 2e-23
gi|30688336|ref|NP_030605.2| appr-1-p processing enzyme family p... 110 2e-23
gi|20196872|gb|AAB87596.2| expressed protein [Arabidopsis thaliana] 110 2e-23
gi|15807279|ref|NP_296009.1| conserved hypothetical protein [Dei... 110 2e-23
gi|46436472|gb|EAK95834.1| hypothetical protein CaO19.2285 [Cand... 110 3e-23
gi|20178171|sp|Q9KHE2|Y189_STRGR Hypothetical UPF0189 protein in... 110 3e-23
gi|23465381|ref|NP_695984.1| conserved hypothetical protein [Bif... 109 4e-23
gi|49235683|ref|ZP_00329749.1| COG2110: Predicted phosphatase ho... 109 4e-23
gi|46132187|ref|ZP_00170597.2| COG2110: Predicted phosphatase ho... 109 4e-23
gi|42526189|ref|NP_971287.1| appr-1-p processing enzyme family d... 108 6e-23
gi|46106097|ref|ZP_00199828.1| COG2110: Predicted phosphatase ho... 108 1e-22
gi|13541550|ref|NP_111238.1| Uncharacterized conserved protein [... 108 1e-22
gi|21224756|ref|NP_630535.1| conserved hypothetical protein SC9B... 107 2e-22
gi|28899958|ref|NP_799613.1| hypothetical protein VPA0103 [Vibri... 107 2e-22
gi|15341897|gb|AAH13132.1| GDAP2 protein [Homo sapiens] 106 3e-22
gi|11544738|emb|CAC17644.1| dJ776P7.1 (Novel protein) [Homo sapi... 106 3e-22
gi|8923143|ref|NP_060156.1| ganglioside induced differentiation ... 106 3e-22
gi|25348551|pir||E84831 hypothetical protein At2g40600 [imported... 103 2e-21
gi|21910392|ref|NP_664660.1| conserved hypothetical protein [Str... 103 3e-21
gi|46117540|ref|XP_384788.1| hypothetical protein FG04612.1 [Gib... 103 3e-21
gi|28895968|ref|NP_802318.1| hypothetical protein [Streptococcus... 103 3e-21
gi|19746149|ref|NP_607285.1| hypothetical protein [Streptococcus... 103 3e-21
gi|20178165|sp|Q9EYI6|Y189_STRNO Hypothetical UPF0189 protein in... 102 4e-21
gi|20178229|sp|Q9HJ67|YB05_THEAC Hypothetical UPF0189 protein Ta... 101 1e-20
gi|16082127|ref|NP_394564.1| conserved hypothetical protein [The... 101 1e-20
gi|49135893|ref|XP_413319.1| hypothetical protein AN9182.2 [Aspe... 101 1e-20
gi|15675180|ref|NP_269354.1| hypothetical protein SPy1216 [Strep... 101 1e-20
gi|34859654|ref|XP_342304.1| similar to ganglioside-induced diff... 100 2e-20
gi|22094097|ref|NP_034399.1| ganglioside-induced differentiation... 100 2e-20
gi|26350139|dbj|BAC38709.1| unnamed protein product [Mus musculus] 100 2e-20
gi|50877275|emb|CAG37115.1| conserved hypothetical protein [Desu... 100 4e-20
gi|37534804|ref|NP_921704.1| unknown protein [Oryza sativa (japo... 99 8e-20
gi|18409248|ref|NP_564960.1| appr-1-p processing enzyme family p... 98 1e-19
gi|12597804|gb|AAG60116.1| unknown protein [Arabidopsis thaliana... 98 1e-19
gi|38505728|ref|NP_942348.1| slr7060 [Synechocystis sp. PCC 6803... 97 2e-19
gi|22537216|ref|NP_688067.1| conserved hypothetical protein [Str... 92 6e-18
gi|23474635|ref|ZP_00129928.1| COG2110: Predicted phosphatase ho... 92 1e-17
gi|25011143|ref|NP_735538.1| Unknown [Streptococcus agalactiae N... 92 1e-17
gi|47077162|dbj|BAD18504.1| unnamed protein product [Homo sapiens] 91 1e-17
gi|14520863|ref|NP_126338.1| hypothetical protein PAB0445 [Pyroc... 91 2e-17
gi|20178155|sp|Q93SX7|Y189_ACISE Hypothetical UPF0189 protein (O... 90 3e-17
gi|18977908|ref|NP_579265.1| hypothetical protein PF1536 [Pyroco... 90 4e-17
gi|18312414|ref|NP_559081.1| conserved hypothetical protein [Pyr... 88 1e-16
gi|14591295|ref|NP_143373.1| hypothetical protein PH1513 [Pyroco... 87 3e-16
gi|15899613|ref|NP_344218.1| Conserved hypothetical protein [Sul... 86 4e-16
gi|47220224|emb|CAF98989.1| unnamed protein product [Tetraodon n... 86 7e-16
gi|15643274|ref|NP_228318.1| conserved hypothetical protein [The... 84 2e-15
gi|47207384|emb|CAF93717.1| unnamed protein product [Tetraodon n... 84 2e-15
gi|24586353|ref|NP_724597.1| CG18812-PC [Drosophila melanogaster... 84 2e-15
gi|15922714|ref|NP_378383.1| 182aa long hypothetical histone mac... 81 2e-14
gi|46200164|ref|YP_005831.1| hypothetical conserved protein [The... 81 2e-14
gi|40889955|pdb|1VHU|A Chain A, Crystal Structure Of A Putative ... 79 7e-14
gi|20178180|sp|O28751|YF21_ARCFU Hypothetical UPF0189 protein AF... 79 9e-14
gi|11499116|ref|NP_070350.1| conserved hypothetical protein [Arc... 79 9e-14
gi|47123187|gb|AAH70832.1| MGC83934 protein [Xenopus laevis] 77 3e-13
gi|31209997|ref|XP_313965.1| ENSANGP00000024314 [Anopheles gambi... 75 1e-12
gi|31209999|ref|XP_313966.1| ENSANGP00000009923 [Anopheles gambi... 75 1e-12
gi|15609036|ref|NP_216415.1| lppD [Mycobacterium tuberculosis H3... 74 2e-12
gi|20094386|ref|NP_614233.1| Predicted phosphatase homologous to... 74 2e-12
gi|20178237|sp|O07733|YI99_MYCTU Hypothetical UPF0189 protein Rv... 74 2e-12
gi|31793092|ref|NP_855585.1| POSSIBLE LIPOPROTEIN LPPD [Mycobact... 74 2e-12
gi|15841370|ref|NP_336407.1| conserved hypothetical protein [Myc... 74 2e-12
gi|12325096|gb|AAG52505.1| unknown protein; 30607-27264 [Arabido... 69 5e-11
gi|48101729|ref|XP_392707.1| similar to ENSANGP00000009923 [Apis... 69 7e-11
gi|26354633|dbj|BAC40943.1| unnamed protein product [Mus musculus] 68 2e-10
gi|50750722|ref|XP_422113.1| PREDICTED: similar to hypothetical ... 67 3e-10
gi|50750720|ref|XP_422112.1| PREDICTED: similar to B aggressive ... 66 5e-10
gi|15606296|ref|NP_213675.1| hypothetical protein aq_987 [Aquife... 66 5e-10
gi|34869210|ref|XP_221401.2| similar to hypothetical protein MGC... 65 1e-09
gi|47215353|emb|CAG12587.1| unnamed protein product [Tetraodon n... 65 1e-09
gi|6331213|dbj|BAA86582.1| KIAA1268 protein [Homo sapiens] 64 3e-09
gi|50512292|ref|NP_060024.1| KIAA1268 protein [Homo sapiens] >gn... 64 3e-09
gi|29729666|ref|XP_291055.1| KIAA1268 protein [Homo sapiens] 64 3e-09
gi|42734056|gb|AAS38928.1| similar to Dictyostelium discoideum (... 64 3e-09
gi|13899297|ref|NP_113646.1| B aggressive lymphoma gene [Homo sa... 62 8e-09
gi|48474734|sp|Q8IXQ6|BAL_HUMAN B aggressive lymphoma protein 62 8e-09
gi|12751141|gb|AAK07559.1| B aggressive lymphoma short isoform [... 62 8e-09
gi|24658781|gb|AAH39580.1| BAL protein [Homo sapiens] 62 8e-09
gi|14601536|ref|NP_148076.1| hypothetical protein 2 [Aeropyrum p... 61 1e-08
gi|50792299|ref|XP_423602.1| PREDICTED: similar to ganglioside-i... 61 1e-08
gi|26332334|dbj|BAC29897.1| unnamed protein product [Mus musculus] 60 3e-08
gi|13384918|ref|NP_084529.1| B aggressive lymphoma [Mus musculus... 60 3e-08
gi|48474733|sp|Q8CAS9|BAL_MOUSE B aggressive lymphoma protein ho... 60 3e-08
gi|23509688|ref|NP_702355.1| hypothetical protein [Plasmodium fa... 60 4e-08
gi|47220223|emb|CAF98988.1| unnamed protein product [Tetraodon n... 60 4e-08
gi|4262318|gb|AAD14562.1| nonstructural polyprotein [Venezuelan ... 59 7e-08
gi|50750726|ref|XP_422115.1| PREDICTED: similar to B aggressive ... 59 9e-08
gi|4262300|gb|AAD14550.1| nonstructural polyprotein [Venezuelan ... 58 1e-07
gi|3395780|gb|AAC28846.1| histone macroH2A1.1 [Gallus gallus] 57 2e-07
gi|9629247|ref|NP_054023.1| nonstructural polyprotein [Barmah Fo... 57 2e-07
gi|34869208|ref|XP_221404.2| similar to B aggressive lymphoma [R... 57 2e-07
gi|29612005|ref|NP_818997.1| nsP3 [Barmah Forest virus] 57 2e-07
gi|3201598|gb|AAC19326.1| putative nonstructural polyprotein pre... 57 3e-07
gi|9626527|ref|NP_040822.1| putative nonstructural polyprotein p... 57 3e-07
gi|323709|gb|AAB02518.1| nonstructural polyprotein 57 3e-07
gi|3249014|gb|AAC24033.1| nonstructural polyprotein [Venezuelan ... 57 3e-07
gi|20800450|gb|AAM28636.1| nonstructural polyprotein [Venezuelan... 57 3e-07
gi|323715|gb|AAB02516.1| nonstructural polyprotein 57 3e-07
gi|4887232|gb|AAC19321.2| putative nonstructural polyprotein pre... 57 3e-07
gi|14549693|gb|AAK66989.1| nonstructural polyprotein [Venezuelan... 57 3e-07
gi|18152935|gb|AAL61965.1| nonstructural polyprotein [Venezuelan... 57 3e-07
gi|548559|sp|P36328|POLN_EEVVP Nonstructural polyprotein [Contai... 57 3e-07
gi|5442473|gb|AAD43359.1| nonstructural polyprotein [Venezuelan ... 57 3e-07
gi|130535|sp|P27282|POLN_EEVVT Nonstructural polyprotein [Contai... 57 3e-07
gi|418966|pir||C44213 nonstructural polyprotein - Venezuelan equ... 57 3e-07
gi|9626529|ref|NP_040823.1| nonstructural polyprotein precursor ... 57 3e-07
gi|4887233|gb|AAC19323.2| putative nonstructural polyprotein pre... 57 3e-07
gi|6226676|sp|P36327|POLN_EEVV3 Nonstructural polyprotein [Conta... 57 3e-07
gi|5442470|gb|AAD43358.1| nonstructural polyprotein [Venezuelan ... 57 3e-07
gi|5442460|gb|AAD43355.1| nonstructural polyprotein [Venezuelan ... 57 3e-07
gi|4689188|gb|AAD27802.1| nonstructural polyprotein [Venezuelan ... 57 3e-07
gi|5442466|gb|AAD43357.1| nonstructural polyprotein [Venezuelan ... 57 3e-07
gi|25140292|ref|NP_740698.1| putative nonstructural protein nsP3... 57 3e-07
gi|13905316|gb|AAH06955.1| H2afy protein [Mus musculus] 56 6e-07
gi|4262324|gb|AAD14566.1| nonstructural polyprotein [Venezuelan ... 55 8e-07
gi|4262303|gb|AAD14552.1| nonstructural polyprotein [Venezuelan ... 55 1e-06
gi|4262321|gb|AAD14564.1| nonstructural polyprotein [Venezuelan ... 55 1e-06
gi|2143784|pir||I80811 histone H2A.1 - rat >gnl|BL_ORD_ID|125358... 55 1e-06
gi|20336746|ref|NP_613075.1| H2A histone family, member Y isofor... 54 2e-06
gi|29611987|ref|NP_818935.1| nonstructural protein nsP3 [Western... 54 2e-06
gi|21238455|ref|NP_640330.1| nonstructural polyprotein [Western ... 54 2e-06
gi|29611989|ref|NP_818937.1| ponstructural protein P123 [Western... 54 2e-06
gi|4262312|gb|AAD14558.1| nonstructural polyprotein [Venezuelan ... 54 3e-06
gi|17864997|gb|AAL47148.1| nonstructural polyprotein [Venezuelan... 54 3e-06
gi|17864994|gb|AAL47146.1| nonstructural polyprotein [Venezuelan... 54 3e-06
gi|17865006|gb|AAL47154.1| nonstructural polyprotein [Venezuelan... 54 3e-06
gi|1144528|gb|AAB04682.1| nonstructural polyprotein 54 3e-06
gi|17865000|gb|AAL47150.1| nonstructural polyprotein [Venezuelan... 54 3e-06
gi|7444407|pir||S72351 nonstructural polyprotein - western equin... 54 3e-06
gi|4262309|gb|AAD14556.1| nonstructural polyprotein [Venezuelan ... 54 3e-06
gi|28400593|emb|CAA52868.2| nonstructural polyprotein [Western e... 54 3e-06
gi|6625760|gb|AAF19383.1| RNA-directed RNA polymerase [murine he... 53 4e-06
gi|7739594|gb|AAF68919.1| RNA-directed RNA polymerase [murine he... 53 4e-06
gi|37999876|sp|Q9PYA3|R1AB_CVM2 Replicase polyprotein 1ab (pp1ab... 53 4e-06
gi|37999878|sp|P19751|R1AB_CVMJH Replicase polyprotein 1ab (pp1a... 53 5e-06
gi|67121|pir||RRIHM2 genome polyprotein 1a - murine hepatitis vi... 53 5e-06
gi|32442343|gb|AAP82232.1| ORF1 [Rubella virus] 53 5e-06
gi|331820|gb|AAA46443.1| long open reading frame [murine hepatit... 53 5e-06
gi|32442346|gb|AAP82234.1| ORF1 [Rubella virus] 52 7e-06
gi|4262315|gb|AAD14560.1| nonstructural polyprotein [Venezuelan ... 52 7e-06
gi|21218486|ref|NP_632020.1| Nonstructural polyprotein [Eastern ... 52 9e-06
gi|7444405|pir||S26372 nonstructural polyprotein - eastern equin... 52 9e-06
gi|7444406|pir||S72349 nonstructural polyprotein - eastern equin... 52 9e-06
gi|25121481|ref|NP_740651.1| NS3 [Eastern equine encephalitis vi... 52 9e-06
gi|46396859|sp|Q86500|POLN_RUBVM Nonstructural polyprotein [Cont... 52 1e-05
gi|4262306|gb|AAD14554.1| nonstructural polyprotein [Venezuelan ... 52 1e-05
gi|334112|gb|AAA96972.1| nonstructural polyprotein [Ockelbo virus] 51 1e-05
gi|130548|sp|P27283|POLN_SINDO Nonstructural polyprotein (P270) ... 51 1e-05
gi|38018023|ref|NP_937947.1| replicase polyprotein [Human corona... 51 2e-05
gi|12862576|dbj|BAB32473.1| non-structural protein [Rubella virus] 50 3e-05
gi|12862436|dbj|BAB32471.1| non-structural protein [Rubella virus] 50 3e-05
gi|16923734|gb|AAL31565.1| nonstructural proteins NSP1 and NSP2 ... 50 3e-05
gi|22774030|gb|AAN07181.1| nonstructural proteins P150 and P90 [... 50 3e-05
gi|2529631|gb|AAB81187.1| nonstructural protein [Rubella virus] 50 3e-05
gi|29396330|ref|NP_803427.1| p150 [Rubella virus] 50 3e-05
gi|46397818|sp|P13889|POLN_RUBVT Nonstructural polyprotein [Cont... 50 3e-05
gi|9790311|ref|NP_062883.1| nonstructural polyprotein precursor ... 50 3e-05
gi|6716709|gb|AAF26709.1| nonstructural capsid protein [Rubella ... 50 3e-05
gi|3873295|gb|AAC77464.1| nonstructural protein [Sindbis-like vi... 50 4e-05
gi|3873296|gb|AAC77465.1| p270 nonstructural polyprotein [Sindbi... 50 4e-05
gi|37999877|sp|P16342|R1AB_CVMA5 Replicase polyprotein 1ab (pp1a... 49 6e-05
gi|130545|sp|P13888|POLN_RRVT Nonstructural polyprotein [Contain... 49 6e-05
gi|483415|gb|AAA47407.1| polyprotein 49 6e-05
gi|25121562|ref|NP_740609.1| coronavirus nsp1 (PL1-PRO, PL2-PRO,... 49 6e-05
gi|26007546|ref|NP_068668.2| ORF1ab polyprotein [Murine hepatiti... 49 6e-05
gi|20066320|gb|AAM09375.1| nonstructural protein (readthrough) [... 49 6e-05
gi|20066321|gb|AAM09376.1| nonstructural protein (readthrough) [... 49 6e-05
gi|9629815|ref|NP_045298.1| ORF1a polyprotein [Murine hepatitis ... 49 6e-05
gi|7769352|gb|AAF69341.1| RNA-directed RNA polymerase [murine he... 49 6e-05
gi|7769341|gb|AAF69331.1| RNA-directed RNA polymerase [murine he... 49 7e-05
gi|47221760|emb|CAG08814.1| unnamed protein product [Tetraodon n... 49 7e-05
gi|38372858|sp|Q8V6W7|R1AB_CVBQ Replicase polyprotein 1ab (pp1ab... 49 1e-04
gi|16923737|gb|AAL31567.1| nonstructural proteins NSP1 and NSP2 ... 49 1e-04
gi|21218489|ref|NP_632023.1| Polyprotein 1; Nonstructural polypr... 49 1e-04
gi|18033972|gb|AAL57305.1| replicase [bovine coronavirus] 49 1e-04
gi|38372857|sp|Q66198|R1AB_CVBM Replicase polyprotein 1ab (pp1ab... 49 1e-04
gi|38372859|sp|Q8V439|R1AB_CVBLU Replicase polyprotein 1ab (pp1a... 49 1e-04
gi|15077820|gb|AAK83365.1| replicase [bovine coronavirus] 49 1e-04
gi|26008080|ref|NP_150073.2| orf1ab polyprotein [Bovine coronavi... 49 1e-04
gi|130544|sp|P13887|POLN_RRVN Nonstructural polyprotein [Contain... 49 1e-04
gi|9790306|ref|NP_062879.1| nonstructural polyprotein [Ross Rive... 49 1e-04
gi|29653356|ref|NP_819014.1| Nonstructural protein P123 [Aura vi... 49 1e-04
gi|26008083|ref|NP_742169.1| coronavirus nsp1 (PL1-PRO, PL2-PRO,... 49 1e-04
gi|25121494|ref|NP_740680.1| nsP3 protein [Ross River virus] 49 1e-04
gi|18033982|gb|AAL57315.1| replicase [bovine coronavirus] 49 1e-04
gi|15081555|ref|NP_150074.1| orf1a polyprotein [Bovine coronavir... 49 1e-04
gi|17529671|gb|AAL40396.1| RNA polymerase 1a [bovine coronavirus] 49 1e-04
gi|1125067|gb|AAA86133.1| nonstructural polyprotein 48 1e-04
gi|1125070|gb|AAA86135.1| nonstructural polyprotein 48 1e-04
gi|7023247|dbj|BAA91897.1| unnamed protein product [Homo sapiens] 48 2e-04
gi|42528338|gb|AAS18435.1| nonstructural protein [Cloning vector... 47 2e-04
gi|3978526|gb|AAC83378.1| nonstructural polyprotein [Sindbis virus] 47 2e-04
gi|45384360|ref|NP_990338.1| histone macroH2A1.2 [Gallus gallus]... 47 4e-04
gi|9790317|ref|NP_062888.1| p270 nonstructural polyprotein (read... 46 5e-04
gi|25121508|ref|NP_740672.1| nsp3 nonstructural protein [Sindbis... 46 5e-04
gi|9790318|ref|NP_062889.1| p230 nonstructural polyprotein [Sind... 46 5e-04
gi|20127134|gb|AAM10974.1| nonstructural polyprotein 1234 [Sindb... 46 5e-04
gi|20127135|gb|AAM10975.1| nonstructural polyprotein 123 [Sindbi... 46 5e-04
gi|130549|sp|P03317|POLN_SINDV Nonstructural polyprotein (P270) ... 46 5e-04
gi|29653354|ref|NP_819012.1| Nonstructural protein nsP3 [Aura vi... 46 6e-04
gi|41323720|gb|AAS00002.1| nonstructural polyprotein [SARS coron... 46 6e-04
gi|22789217|ref|NP_690588.1| nonstructural polyprotein [Chikungu... 46 6e-04
gi|12643340|sp|O75367|H2AY_HUMAN Core histone macro-H2A.1 (Histo... 46 6e-04
gi|41152517|ref|NP_036145.1| H2A histone family, member Y; MACRO... 46 6e-04
gi|7288149|dbj|BAA92846.1| polyprotein [Sagiyama virus] 45 8e-04
gi|31416293|gb|AAP51225.1| orf1ab [SARS coronavirus GD01] 45 8e-04
gi|32473062|ref|NP_866056.1| conserved hypothetical protein [Pir... 45 8e-04
gi|20336748|ref|NP_613258.1| H2A histone family, member Y isofor... 45 8e-04
gi|10435335|dbj|BAB14565.1| unnamed protein product [Homo sapiens] 45 8e-04
gi|12643399|sp|Q02874|H2AY_RAT Core histone macro-H2A.1 (Histone... 45 8e-04
gi|31416294|gb|AAP51226.1| orf1a polyprotein [SARS coronavirus G... 45 8e-04
gi|12850873|dbj|BAB28879.1| unnamed protein product [Mus musculus] 45 8e-04
gi|7288148|dbj|BAA92845.1| polyprotein [Sagiyama virus] 45 8e-04
gi|32492946|gb|AAN08620.1| medulloblastoma antigen MU-MB-50.205 ... 45 0.001
gi|15426458|gb|AAH13331.1| H2AFY protein [Homo sapiens] 45 0.001
gi|4758496|ref|NP_004884.1| H2A histone family, member Y isoform... 45 0.001
gi|8393519|ref|NP_058878.1| H2A histone family, member Y [Rattus... 45 0.001
gi|34555776|ref|NP_828862.2| nsp3-pp1a/pp1ab [SARS coronavirus] 44 0.002
gi|40457449|gb|AAR86774.1| orf1ab [SARS coronavirus ShanghaiQXC2] 44 0.002
gi|40548922|gb|AAR87543.1| putative polyprotein [SARS coronaviru... 44 0.002
gi|40548970|gb|AAR87587.1| putative polyprotein [SARS coronaviru... 44 0.002
gi|30124074|ref|NP_828849.2| orf1ab polyprotein (pp1ab) [SARS co... 44 0.002
gi|38231938|gb|AAR14810.1| putative orf1ab polyprotein [SARS cor... 44 0.002
gi|40557708|gb|AAP82978.2| orf1ab [SARS coronavirus ShanghaiQXC1] 44 0.002
gi|40548910|gb|AAR87532.1| putative polyprotein [SARS coronaviru... 44 0.002
gi|30027621|gb|AAP13442.1| nonstructural polyprotein pp1ab [SARS... 44 0.002
gi|38505492|gb|AAR23251.1| orf1ab polyprotein [SARS coronavirus ... 44 0.002
gi|50365701|gb|AAT76146.1| replicase 1ab [SARS coronavirus TJF] 44 0.002
gi|38324306|gb|AAP49011.4| orf1ab polyprotein [SARS coronavirus ... 44 0.002
gi|40795745|gb|AAR91584.1| nonstructural polyprotein [SARS coron... 44 0.002
gi|30023953|gb|AAP13566.1| putative orf1ab polyprotein [SARS cor... 44 0.002
gi|40548982|gb|AAR87598.1| putative polyprotein [SARS coronaviru... 44 0.002
gi|38231928|gb|AAR14802.1| putative orf1ab polyprotein [SARS cor... 44 0.002
gi|30795144|gb|AAP41036.1| replicase 1AB [SARS coronavirus Tor2] 44 0.002
gi|30275667|gb|AAP30028.1| orf1ab [SARS coronavirus BJ01] 44 0.002
gi|40548886|gb|AAR87510.1| putative polyprotein [SARS coronaviru... 44 0.002
gi|31581504|gb|AAP33696.1| polyprotein 1ab [SARS coronavirus Fra... 44 0.002
gi|33114215|gb|AAP94757.1| putative orf1ab polyprotein [SARS cor... 44 0.002
gi|38505483|gb|AAR23243.1| orf1ab polyprotein [SARS coronavirus ... 44 0.002
gi|40548887|gb|AAR87511.1| orf1a polyprotein [SARS coronavirus T... 44 0.002
gi|30275668|gb|AAP30029.1| orf1a polyprotein [SARS coronavirus B... 44 0.002
gi|40795746|gb|AAR91585.1| orf1a polyprotein [SARS coronavirus N... 44 0.002
gi|31581503|gb|AAP33695.1| polyprotein 1a [SARS coronavirus Fran... 44 0.002
gi|40548983|gb|AAR87599.1| orf1a polyprotein [SARS coronavirus TW9] 44 0.002
gi|30023962|gb|AAP13575.1| orf1a polyprotein [SARS coronavirus C... 44 0.002
gi|29836495|ref|NP_828850.1| orf1a polyprotein (pp1a) [SARS coro... 44 0.002
gi|38304882|gb|AAR16181.1| orf1a polyprotein [SARS coronavirus Z... 44 0.002
gi|40548923|gb|AAR87544.1| orf1a polyprotein [SARS coronavirus TW4] 44 0.002
gi|30027618|gb|AAP13439.1| nonstructural polyprotein pp1a [SARS ... 44 0.002
gi|38505484|gb|AAR23244.1| orf1a polyprotein [SARS coronavirus S... 44 0.002
gi|38505493|gb|AAR23252.1| orf1a polyprotein [SARS coronavirus S... 44 0.002
gi|40548911|gb|AAR87533.1| orf1a polyprotein [SARS coronavirus TW3] 44 0.002
gi|50365703|gb|AAT76148.1| Orf1a polyprotein [SARS coronavirus TJF] 44 0.002
gi|3396054|gb|AAC97204.1| nonstructural polyprotein [O'nyong-nyo... 44 0.002
gi|49900191|gb|AAH76893.1| Unknown (protein for MGC:88985) [Xeno... 44 0.003
gi|15240948|ref|NP_195751.1| basic helix-loop-helix (bHLH) famil... 43 0.004
gi|24379154|ref|NP_721109.1| hypothetical protein [Streptococcus... 43 0.004
gi|38636779|dbj|BAD03022.1| hypothetical protein [Oryza sativa (... 43 0.004
gi|9630654|ref|NP_047209.1| nonstructural polyprotein [Igbo Ora ... 43 0.005
gi|25140283|ref|NP_740714.1| nonstructural protein 3; nsP3 [Igbo... 43 0.005
gi|19073907|ref|NP_579969.1| nonstructural polyprotein nsP1-nsP2... 43 0.005
gi|25121715|ref|NP_740689.1| nonstructural protein nsP3 [Mayaro ... 43 0.005
gi|33416694|gb|AAH56065.1| H2afy2-prov protein [Xenopus laevis] 43 0.005
gi|19073905|ref|NP_579968.1| nonstructural polyprotein nsP1-nsP2... 43 0.005
gi|25121485|ref|NP_740705.1| nonstructural protein P3 [O'nyong-n... 42 0.007
gi|9627008|ref|NP_041254.1| O'Nyong-nyong polyprotein A [O'nyong... 42 0.007
gi|49115274|gb|AAH73272.1| Unknown (protein for MGC:80637) [Xeno... 42 0.012
gi|21321728|ref|NP_647496.1| non-structural polyprotein [Salmon ... 41 0.016
gi|19352424|ref|NP_598184.1| Nonstructural polyprotein [Sleeping... 41 0.016
gi|25121755|ref|NP_740655.1| non structural protein P3 [Sleeping... 41 0.020
gi|25121764|ref|NP_740637.1| non structural protein P3 [Salmon p... 41 0.020
gi|13559285|emb|CAC36071.1| dJ1069O1.1 (novel protein similar to... 41 0.020
gi|30519796|emb|CAD90833.1| non-structural polyprotein [Semliki ... 39 0.077
gi|38075286|ref|XP_357220.1| similar to dJ855L24.1.2 (novel prot... 39 0.10
gi|47225263|emb|CAG09763.1| unnamed protein product [Tetraodon n... 39 0.10
gi|2052236|emb|CAA73118.1| nsp3 [Semliki forest virus] 39 0.10
gi|38233254|ref|NP_939021.1| Conserved hypothetical protein [Cor... 38 0.17
gi|47229000|emb|CAG09515.1| unnamed protein product [Tetraodon n... 37 0.22
gi|30138154|ref|NP_839958.1| putative coronavirus nsp1 [Porcine ... 37 0.38
gi|50082762|gb|AAT70073.1| replicase polyprotein 1ab [Avian infe... 37 0.38
gi|29650476|ref|NP_819009.1| Nonstructural protein P123 [Semliki... 37 0.38
gi|38372861|sp|Q91AV2|R1AB_PEDV7 Replicase polyprotein 1ab (pp1a... 37 0.38
gi|19387582|ref|NP_598309.1| Pol1 [Porcine epidemic diarrhea vir... 37 0.38
gi|25121503|ref|NP_740667.1| nonstructural protein nsP3 [Semliki... 37 0.38
gi|13559047|emb|CAC36070.1| dJ855L24.1.2 (novel protein similar ... 37 0.38
gi|9650543|emb|CAC00665.1| dJ855L24.1.1 (novel protein similar t... 37 0.38
gi|21655312|gb|AAM64226.1| non-structural polyprotein [Semliki f... 37 0.38
gi|16767846|ref|NP_463457.1| Precursor of nonstructural proteins... 37 0.38
gi|23613124|ref|NP_703446.1| hypothetical protein [Plasmodium fa... 36 0.50
gi|46369872|gb|AAS89766.1| ORF 1a [Human group 1 coronavirus ass... 36 0.50
gi|49169783|ref|YP_003766.2| replicase polyprotein 1ab [Human co... 36 0.50
gi|46369871|gb|AAS89765.1| ORF 1ab [Human group 1 coronavirus as... 36 0.50
gi|2498759|sp|Q01962|PEX8_PICPA Peroxisomal protein PER3 precurs... 35 0.85
gi|47229001|emb|CAG09516.1| unnamed protein product [Tetraodon n... 35 1.1
gi|6523491|emb|CAB62256.1| polyprotein nsP1234 [Semliki forest v... 35 1.1
gi|47225265|emb|CAG09765.1| unnamed protein product [Tetraodon n... 35 1.1
gi|41324070|gb|AAS00079.1| 1a [Avian infectious bronchitis virus] 35 1.5
gi|50729506|ref|XP_416539.1| PREDICTED: similar to ganglioside i... 35 1.5
gi|41324069|gb|AAS00078.1| 1ab [Avian infectious bronchitis virus] 35 1.5
gi|23619089|ref|NP_705051.1| hypothetical protein [Plasmodium fa... 34 2.5
gi|30024077|ref|NP_835345.1| coronavirus p195/p210 protein (nsp1... 33 3.2
gi|38075136|ref|XP_355346.1| RIKEN cDNA 2900006F19 [Mus musculus] 33 3.2
gi|9187230|emb|CAB96944.1| bA67K15.1 (continued from dJ631M13.5.... 33 3.2
gi|37999893|sp|Q9IW06|R1AB_CVPPU Replicase polyprotein 1ab (pp1a... 33 3.2
gi|872319|emb|CAA83979.1| orf1a [Transmissible gastroenteritis v... 33 3.2
gi|9635158|ref|NP_058423.1| replicase [Transmissible gastroenter... 33 3.2
gi|12175747|ref|NP_073549.1| replicase polyprotein 1ab [Human co... 33 3.2
gi|30146761|ref|NP_840002.1| putative coronavirus nsp1 [Transmis... 33 3.2
gi|9635157|ref|NP_058422.1| replicase [Transmissible gastroenter... 33 3.2
gi|281286|pir||S28600 hypothetical protein 1a - human coronaviru... 33 3.2
gi|12175746|ref|NP_073550.1| replicase polyprotein 1a [Human cor... 33 3.2
gi|33569221|gb|AAQ21583.1| 1ab polyprotein [Avian infectious bro... 33 4.2
gi|33569222|gb|AAQ21584.1| 1a protein [Avian infectious bronchit... 33 4.2
gi|22266324|emb|CAD23627.1| outer surface protein [Borrelia gari... 33 5.5
gi|48863613|ref|ZP_00317507.1| hypothetical protein Mdeg02001706... 32 7.2
gi|4884773|gb|AAD31800.1| TDP-glucose-4,6-dehydratase homolog [S... 32 7.2
gi|32476225|ref|NP_869219.1| hypothetical protein-transmembrane ... 32 9.4
gi|46250077|gb|AAH68694.1| LOC414543 protein [Xenopus laevis] 32 9.4
gi|25121546|ref|NP_740622.1| coronavirus nsp1 (HD1); hydrophobic... 32 9.4
gi|50255914|gb|EAL18644.1| hypothetical protein CNBI3440 [Crypto... 32 9.4
gi|19074297|ref|NP_585803.1| NUCLEAR PORE COMPLEX PROTEIN NUP155... 32 9.4
gi|9626536|ref|NP_040829.1| ORF1a polyprotein [Avian infectious ... 32 9.4
gi|31210001|ref|XP_313967.1| ENSANGP00000022491 [Anopheles gambi... 32 9.4
gi|38372862|sp|Q91QT2|R1AB_IBVBC Replicase polyprotein 1ab (pp1a... 32 9.4
gi|14149033|emb|CAC39112.1| replicase polyprotein 1ab [Avian inf... 32 9.4
gi|10242469|ref|NP_066134.1| ORF1ab polyprotein; frameshift prod... 32 9.4
>gi|17538214|ref|NP_502127.1| putative cytoplasmic protein of
ancient origin (22.1 kD) (4M80) [Caenorhabditis elegans]
gi|7494733|pir||T18653 hypothetical protein B0035.3 -
Caenorhabditis elegans
gi|3873699|emb|CAA97408.1| Hypothetical protein B0035.3
[Caenorhabditis elegans]
Length = 203
Score = 410 bits (1055), Expect = e-114
Identities = 203/203 (100%), Positives = 203/203 (100%)
Frame = -1
Query: 612 MAAAKISEIPTLFEKFKVAKNVLGRISVWDGDITKLSVDAIVNAANSRLAGGGGVDGAIH 433
MAAAKISEIPTLFEKFKVAKNVLGRISVWDGDITKLSVDAIVNAANSRLAGGGGVDGAIH
Sbjct: 1 MAAAKISEIPTLFEKFKVAKNVLGRISVWDGDITKLSVDAIVNAANSRLAGGGGVDGAIH 60
Query: 432 RAAGRKQLQEECQQYNGCAVGDAVITSGCNINHIKKIIHTVGPQVYGNVTDERRENLVAC 253
RAAGRKQLQEECQQYNGCAVGDAVITSGCNINHIKKIIHTVGPQVYGNVTDERRENLVAC
Sbjct: 61 RAAGRKQLQEECQQYNGCAVGDAVITSGCNINHIKKIIHTVGPQVYGNVTDERRENLVAC 120
Query: 252 YRTSLDIAIENGMKSIAFCCISTGVYGYPNDDAAKTVTNFLTEYLEKNDTIERIVLVTFL 73
YRTSLDIAIENGMKSIAFCCISTGVYGYPNDDAAKTVTNFLTEYLEKNDTIERIVLVTFL
Sbjct: 121 YRTSLDIAIENGMKSIAFCCISTGVYGYPNDDAAKTVTNFLTEYLEKNDTIERIVLVTFL 180
Query: 72 DIDNEHYNKYFGDYAASKDQSIA 4
DIDNEHYNKYFGDYAASKDQSIA
Sbjct: 181 DIDNEHYNKYFGDYAASKDQSIA 203