Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= 583f11
(360 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508509|ref|NP_493176.1| DNA PRImase homolog (58.3 kD) (pri-... 229 1e-59
gi|39580725|emb|CAE64111.1| Hypothetical protein CBG08720 [Caeno... 181 3e-45
gi|13358936|dbj|BAB33081.1| hypothetical protein [Macaca fascicu... 89 2e-17
gi|25336973|pir||G87948 protein W02D9.1 [imported] - Caenorhabdi... 89 2e-17
gi|47550859|ref|NP_999947.1| primase, polypeptide 2A, 58kDa [Dan... 89 2e-17
gi|34874606|ref|XP_217375.2| similar to DNA polymerase alpha sub... 88 4e-17
gi|34395744|sp|O89044|PRI2_RAT DNA primase large subunit (DNA pr... 88 4e-17
gi|1346793|sp|P49643|PRI2_HUMAN DNA primase large subunit (DNA p... 88 5e-17
gi|41349495|ref|NP_000938.2| DNA primase large subunit, 58kDa; D... 88 5e-17
gi|442472|dbj|BAA04203.1| DNA primase large subunit p58 [Mus mus... 87 6e-17
gi|6679461|ref|NP_032948.1| DNA primase, p58 subunit [Mus muscul... 87 6e-17
gi|50744830|ref|XP_419895.1| PREDICTED: similar to DNA primase l... 82 2e-15
gi|47228918|emb|CAG09433.1| unnamed protein product [Tetraodon n... 78 5e-14
gi|49074702|ref|XP_401467.1| hypothetical protein UM03852.1 [Ust... 58 4e-08
gi|42563014|ref|NP_564893.2| DNA primase, large subunit family [... 57 9e-08
gi|27808614|gb|AAO24587.1| At1g67320 [Arabidopsis thaliana] 57 9e-08
gi|34395762|sp|Q84WJ2|PRI2_ARATH Probable DNA primase large subu... 57 9e-08
gi|25404955|pir||G96696 protein F1N21.14 [imported] - Arabidopsi... 57 9e-08
gi|5679048|gb|AAD46835.1| GM13640p [Drosophila melanogaster] 57 9e-08
gi|24667411|ref|NP_652001.2| CG5553-PA [Drosophila melanogaster]... 57 9e-08
gi|31217416|ref|XP_316421.1| ENSANGP00000004257 [Anopheles gambi... 57 1e-07
gi|50292827|ref|XP_448846.1| unnamed protein product [Candida gl... 55 3e-07
gi|50310557|ref|XP_455298.1| unnamed protein product [Kluyveromy... 55 4e-07
gi|23613628|ref|NP_704649.1| DNA primase, large subunit, putativ... 55 4e-07
gi|23483206|gb|EAA18951.1| DNA primase large subunit [Plasmodium... 54 7e-07
gi|50510201|dbj|BAD31369.1| putative DNA primase large subunit [... 54 7e-07
gi|50510202|dbj|BAD31370.1| putative DNA primase large subunit [... 54 7e-07
gi|50255800|gb|EAL18532.1| hypothetical protein CNBJ1740 [Crypto... 53 2e-06
gi|49084390|ref|XP_404397.1| hypothetical protein AN0260.2 [Aspe... 52 2e-06
gi|50412320|ref|XP_457125.1| unnamed protein product [Debaryomyc... 52 4e-06
gi|6322806|ref|NP_012879.1| Subunit of DNA primase, which is req... 50 8e-06
gi|46109914|ref|XP_382015.1| hypothetical protein FG01839.1 [Gib... 49 2e-05
gi|38109196|gb|EAA55106.1| hypothetical protein MG06763.4 [Magna... 49 2e-05
gi|46437167|gb|EAK96518.1| hypothetical protein CaO19.2885 [Cand... 49 3e-05
gi|32406778|ref|XP_324002.1| hypothetical protein [Neurospora cr... 45 3e-04
gi|50555177|ref|XP_504997.1| hypothetical protein [Yarrowia lipo... 44 8e-04
gi|34897562|ref|NP_910127.1| putative DNA primase [Oryza sativa ... 43 0.001
gi|19113172|ref|NP_596380.1| putative dna primase large subunit ... 42 0.002
gi|46228808|gb|EAK89678.1| DNA primase large subunit [Cryptospor... 42 0.002
gi|32189706|ref|NP_859436.1| DNA primase large subunit p58, puta... 39 0.019
gi|45185285|ref|NP_983002.1| ABR056Cp [Eremothecium gossypii] >g... 36 0.16
gi|48696744|ref|YP_024568.1| ORF23 [Ostreid herpesvirus 1] >gnl|... 35 0.47
gi|50292413|ref|XP_448639.1| unnamed protein product [Candida gl... 33 1.0
gi|47214907|emb|CAG04101.1| unnamed protein product [Tetraodon n... 33 1.4
gi|47218672|emb|CAG12396.1| unnamed protein product [Tetraodon n... 33 1.8
gi|49073015|ref|XP_400758.1| hypothetical protein UM03143.1 [Ust... 32 3.0
gi|6685541|sp|Q9XHR2|IF3A_MAIZE Eukaryotic translation initiatio... 32 4.0
gi|38049615|ref|XP_136686.3| similar to chromosome 20 open readi... 31 5.2
gi|41719663|ref|ZP_00148539.1| COG0610: Type I site-specific res... 31 6.8
gi|39588832|emb|CAE69462.1| Hypothetical protein CBG15658 [Caeno... 31 6.8
gi|39580046|emb|CAE71572.1| Hypothetical protein CBG18524 [Caeno... 31 6.8
gi|15645762|ref|NP_207939.1| tRNA (guanine-N1)-methyltransferase... 31 6.8
gi|15612140|ref|NP_223792.1| TRNA (GUANINE-N1)-METHYLTRANSFERASE... 31 6.8
gi|47825406|ref|NP_001001478.1| complement related-long precurso... 30 8.8
gi|13357652|ref|NP_077926.1| type I restriction enzyme R protein... 30 8.8
gi|21392392|dbj|BAC00846.1| AcylCoA:Cholesterol Acyltransferase ... 30 8.8
gi|22122547|ref|NP_666176.1| sterol O-acyltransferase 2 [Mus mus... 30 8.8
>gi|17508509|ref|NP_493176.1| DNA PRImase homolog (58.3 kD) (pri-2)
[Caenorhabditis elegans]
gi|14917028|sp|O02334|PRI2_CAEEL Probable DNA primase large subunit
gi|7508838|pir||T26114 hypothetical protein W02D9.1 -
Caenorhabditis elegans
gi|5824647|emb|CAB03469.2| C. elegans PRI-2 protein (corresponding
sequence W02D9.1) [Caenorhabditis elegans]
Length = 503
Score = 229 bits (584), Expect = 1e-59
Identities = 112/112 (100%), Positives = 112/112 (100%)
Frame = -1
Query: 360 ILRNPPSAVDCHGCPFRHSEKQVLKQKLGSDAILKKEQIERIAELAELNQYDKACTRYFE 181
ILRNPPSAVDCHGCPFRHSEKQVLKQKLGSDAILKKEQIERIAELAELNQYDKACTRYFE
Sbjct: 392 ILRNPPSAVDCHGCPFRHSEKQVLKQKLGSDAILKKEQIERIAELAELNQYDKACTRYFE 451
Query: 180 FMHNLEEGGLGQLITHPNQFYEESQKIVAERIAAKQESQEAPAPKIEKMDTE 25
FMHNLEEGGLGQLITHPNQFYEESQKIVAERIAAKQESQEAPAPKIEKMDTE
Sbjct: 452 FMHNLEEGGLGQLITHPNQFYEESQKIVAERIAAKQESQEAPAPKIEKMDTE 503