Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= 391b2
(297 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|11466696|ref|NP_039292.1| ORF2136 [Marchantia polymorpha] >gn... 33 1.9
>gi|11466696|ref|NP_039292.1| ORF2136 [Marchantia polymorpha]
gi|140550|sp|P09975|YCF2_MARPO Protein ycf2
gi|81341|pir||A05037 hypothetical protein 2136 - liverwort
(Marchantia polymorpha) chloroplast
gi|11665|emb|CAA28078.1| unnamed protein product [Marchantia
polymorpha]
Length = 2136
Score = 32.7 bits (73), Expect = 1.9
Identities = 19/52 (36%), Positives = 29/52 (55%)
Frame = +1
Query: 1 EK*VKLSSKFIFFSKNWIFLLXTSLEKISRKKLAQNFEFLESFWNFHNQVFF 156
+K + L +K+ FF+KN I + +KIS K + N E+ + WN N FF
Sbjct: 692 KKNIYLQNKY-FFNKNLINNKLITWKKISNKLVISNSEYNKIIWNKKNMKFF 742
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
Posted date: Aug 11, 2004 12:04 AM
Number of letters in database: 661,712,633
Number of sequences in database: 1,967,186
Lambda K H
0.318 0.135 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 274,259,753
Number of Sequences: 1967186
Number of extensions: 4129569
Number of successful extensions: 9702
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 9521
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9693
length of database: 661,712,633
effective HSP length: 74
effective length of database: 516,140,869
effective search space used: 12387380856
frameshift window, decay const: 50, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)