Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= 357e6
(373 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17558110|ref|NP_507437.1| ubiquitin interacting motif (5S5C) ... 130 6e-30
gi|33300422|emb|CAB07255.2| Hypothetical protein K10G4.5 [Caenor... 74 7e-13
gi|17562494|ref|NP_507379.1| cyclin-like F-box and Protein of un... 74 7e-13
gi|17560784|ref|NP_507340.1| cyclin-like F-box and Protein of un... 67 8e-11
gi|32567140|ref|NP_503905.2| predicted CDS, cyclin-like F-box an... 44 8e-04
gi|7508625|pir||T28991 hypothetical protein T28A11.21 - Caenorha... 44 8e-04
gi|17558050|ref|NP_503929.1| cyclin-like F-box and Protein of un... 40 0.011
gi|7495522|pir||T19004 hypothetical protein C06C3.9 - Caenorhabd... 34 0.60
gi|17556717|ref|NP_497376.1| predicted CDS, cyclin-like F-box an... 33 1.0
gi|17556626|ref|NP_497399.1| predicted CDS, cyclin-like F-box fa... 33 1.8
gi|10719880|sp|O86131|ARCA_BACLI Arginine deiminase (ADI) (Argin... 32 2.3
gi|17556590|ref|NP_497383.1| predicted CDS, cyclin-like F-box an... 32 3.0
gi|47497038|dbj|BAD19091.1| putative H+-exporting ATPase [Oryza ... 32 3.0
gi|20302441|emb|CAD29312.1| plasma membrane H+-ATPase [Oryza sat... 32 3.0
gi|39582868|emb|CAE71644.1| Hypothetical protein CBG18615 [Caeno... 32 3.0
gi|7436350|pir||T02083 H+-exporting ATPase (EC 3.6.3.6) Mha1 - m... 32 3.0
gi|17555026|ref|NP_497304.1| cyclin-like F-box and Protein of un... 32 3.0
gi|20302433|emb|CAD29295.1| plasma membrane H+ ATPase [Oryza sat... 32 3.0
gi|7436354|pir||T03846 probable plasma membrane H+-ATPase - rice... 32 3.0
gi|497242|gb|AAA20601.1| plasma-membrane H+ ATPase 32 3.0
gi|497240|gb|AAA20600.1| plasma-membrane H+ ATPase 32 3.0
gi|50284731|ref|XP_444793.1| unnamed protein product [Candida gl... 32 3.9
gi|38176015|gb|AAC68786.2| Hypothetical protein F54D10.6 [Caenor... 32 3.9
gi|17556588|ref|NP_497384.1| cyclin-like F-box and Protein of un... 32 3.9
gi|34856160|ref|XP_218638.2| similar to RIKEN cDNA 4933405K07 [R... 31 5.1
gi|28209917|ref|NP_780861.1| thiol:disulfide interchange protein... 31 5.1
gi|39587355|emb|CAE75009.1| Hypothetical protein CBG22910 [Caeno... 31 6.7
gi|7495580|pir||T19028 hypothetical protein C06H5.1 - Caenorhabd... 31 6.7
gi|46430479|dbj|BAD16686.1| plasma membrane H+-ATPase [Daucus ca... 31 6.7
gi|25290694|pir||T52414 H+-exporting ATPase (EC 3.6.3.6), plasma... 31 6.7
gi|14530343|emb|CAB07161.2| Hypothetical protein C06H5.1 [Caenor... 31 6.7
gi|39582410|emb|CAE74794.1| Hypothetical protein CBG22625 [Caeno... 31 6.7
gi|30692952|ref|NP_190378.2| ATPase, plasma membrane-type, putat... 31 6.7
gi|12230481|sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type ... 31 6.7
gi|17557722|ref|NP_507510.1| predicted CDS, cyclin-like F-box an... 31 6.7
gi|46444705|gb|EAL03978.1| hypothetical protein CaO19.4643 [Cand... 30 8.7
gi|553114|gb|AAA34099.1| plasma membrane H+ ATPase 30 8.7
gi|46226450|gb|EAK87450.1| B-box zinc finger domain containing p... 30 8.7
gi|39587357|emb|CAE75011.1| Hypothetical protein CBG22913 [Caeno... 30 8.7
gi|46444861|gb|EAL04133.1| hypothetical protein CaO19.12113 [Can... 30 8.7
gi|31580855|dbj|BAC77532.1| plasma membrane H+-ATPase [Sesbania ... 30 8.7
gi|584795|sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 (Proton ... 30 8.7
gi|12697496|emb|CAC28224.1| p-type H+-ATPase [Sesbania rostrata] 30 8.7
gi|12697490|emb|CAC28221.1| p-type H+-ATPase [Sesbania rostrata] 30 8.7
gi|40445321|ref|NP_954781.1| putative thiol-disulfide isomerase ... 30 8.7
>gi|17558110|ref|NP_507437.1| ubiquitin interacting motif (5S5C)
[Caenorhabditis elegans]
gi|7496279|pir||T19397 hypothetical protein C18D4.1 -
Caenorhabditis elegans
gi|3874463|emb|CAB03907.1| Hypothetical protein C18D4.1
[Caenorhabditis elegans]
gi|3878207|emb|CAB04562.1| Hypothetical protein C18D4.1
[Caenorhabditis elegans]
Length = 1304
Score = 130 bits (327), Expect = 6e-30
Identities = 63/64 (98%), Positives = 63/64 (98%)
Frame = +3
Query: 180 MENQEFIDVLITDLELLLNEVSDRLDEFNVTFRWCGVXQVDLAHLQNVYDQLTLITSHKK 359
MENQEFIDVLITDLELLLNEVSDRLDEFNVTFRWCGV QVDLAHLQNVYDQLTLITSHKK
Sbjct: 1 MENQEFIDVLITDLELLLNEVSDRLDEFNVTFRWCGVEQVDLAHLQNVYDQLTLITSHKK 60
Query: 360 INAC 371
INAC
Sbjct: 61 INAC 64