Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= 204a8
(360 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|7498104|pir||T33855 hypothetical protein D1037.4 - Caenorhabd... 90 9e-18
gi|6841490|gb|AAF29098.1| HSPC134 [Homo sapiens] >gnl|BL_ORD_ID|... 35 0.36
gi|48257063|gb|AAH10893.2| C14orf123 protein [Homo sapiens] 34 0.61
gi|13182765|gb|AAK14928.1| CDA04 [Homo sapiens] 34 0.61
gi|24636263|sp|Q9BY43|CNC3_HUMAN Protein C14orf123 (HSPC134) (CD... 34 0.61
gi|40548422|ref|NP_054888.2| Snf7 homologue associated with Alix... 34 0.61
gi|23509485|ref|NP_702152.1| hypothetical protein [Plasmodium fa... 33 1.0
gi|38107247|gb|EAA53445.1| hypothetical protein MG07722.4 [Magna... 33 1.4
gi|14192869|gb|AAK55774.1| Putative polyprotein [Oryza sativa] 33 1.8
gi|23490788|gb|EAA22478.1| erythrocyte membrane protein 3 [Plasm... 33 1.8
gi|48109317|ref|XP_396228.1| similar to dynein, axonemal, heavy ... 32 3.0
gi|30721681|gb|AAP34256.1| R3L [Plasmodium falciparum] 32 3.0
gi|16804944|ref|NP_472973.1| hypothetical protein [Plasmodium fa... 31 5.2
gi|30682523|ref|NP_680154.2| expressed protein [Arabidopsis thal... 31 5.2
gi|23507851|ref|NP_700521.1| hypothetical protein [Plasmodium fa... 31 5.2
gi|17366777|sp|Q9GJQ1|HSP1_DENGO Sperm protamine P1 >gnl|BL_ORD_... 31 5.2
gi|19114879|ref|NP_593967.1| similarity to phosphoproteins [Schi... 31 5.2
gi|39585444|emb|CAE70527.1| Hypothetical protein CBG17156 [Caeno... 31 6.8
gi|46444961|gb|EAL04232.1| hypothetical protein CaO19.13305 [Can... 31 6.8
gi|1170390|sp|P42131|HSP1_CAEFU Sperm protamine P1 >gnl|BL_ORD_I... 31 6.8
gi|1582120|prf||2117429N protamine P1 31 6.8
gi|23613824|ref|NP_704845.1| hypothetical protein [Plasmodium fa... 30 8.8
gi|1170399|sp|P42142|HSP1_MACRU Sperm protamine P1 >gnl|BL_ORD_I... 30 8.8
gi|23490080|gb|EAA21939.1| hypothetical protein [Plasmodium yoel... 30 8.8
gi|14626300|gb|AAK71568.1| putative receptor-associated protein ... 30 8.8
>gi|7498104|pir||T33855 hypothetical protein D1037.4 -
Caenorhabditis elegans
Length = 224
Score = 90.1 bits (222), Expect = 9e-18
Identities = 42/42 (100%), Positives = 42/42 (100%)
Frame = -3
Query: 358 GAAICFKFIALSPCSALFEVDCDSIQFNFNSVPYLFSYFLSV 233
GAAICFKFIALSPCSALFEVDCDSIQFNFNSVPYLFSYFLSV
Sbjct: 183 GAAICFKFIALSPCSALFEVDCDSIQFNFNSVPYLFSYFLSV 224